F377449

General Info

Members Datasets Scaffolds Average Seq Length
271 161 265 303

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100013134|Ga0070682_1000131341
Length 347
Sequence VPPLFFEDEEQKSKSTPGQSIFLFTNKRTCIYYLIFKIYXXXXMNKHFRKLTALLFFIYTYNTYAQTSPVQNIFPQGTITYSNIPYANDTLKKHLLDIYLPQNAKSNTPLVIWIHGGAWMLNDKYADMGYMKNTVKGFIDNGYALASINYRYSTEAAFPAQIQDCNEALEFLYQHAAQYKIDKDRVALIGFSAGGHLASLMGLSNNNDIKEFYPNGNKPHFKIKCVLDFYGPSDFIMLASNPDTSVNNMRNPVSILLGAMAVDRPDLAKRASPVTYIDKNDPPFFIVQGEKDESVPNTQSRILSSWLTLAGVKNKLTVVPNAPHYGEMFDAESIRKDLFQFLAENLK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 0
Rhizoplane 0.74
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000277 3300001989 Bacteria 17174
2 JGI24739J22299_10003846 3300001989 Bacteria 5730
3 JGI24739J22299_10012057 3300001989 Bacteria 3176
4 JGI24737J22298_10000218 3300001990 Bacteria 18823
5 JGI24743J22301_10012060 3300001991 Bacteria 1566
6 JGI24735J21928_10000001 3300002067 Bacteria 650042
7 JGI24744J21845_10001323 3300002077 Bacteria 4893
8 JGI25162J39368_1000427 3300002737 Bacteria 33903
9 JGI25164J39214_1003221 3300002772 Bacteria 2141
10 JGI25165J46597_1000548 3300003214 Bacteria 34311
11 rootH1_10040535 3300003316 Bacteria 1942
12 rootH1_10056014 3300003316 Bacteria 5781
13 rootH2_10105467 3300003320 Unclassified 2468
14 rootL2_10040009 3300003322 Bacteria 11488
15 rootH1_10029634 3300003323 Bacteria 17261
16 rootH1_10039695 3300003323 Bacteria 4005
17 JGI25160J50197_1005161 3300003354 Bacteria 5483
18 Ga0055526_1007839 3300003771 Bacteria 5461
19 Ga0055528_1000180 3300003790 Bacteria 53597
20 Ga0055530_10005213 3300003791 Bacteria 6300
21 Ga0055530_10037242 3300003791 Bacteria 1218
22 Ga0065165_1000019 3300005262 Bacteria 271815
23 Ga0070658_10005770 3300005327 Bacteria 10042
24 Ga0070658_10220277 3300005327 Bacteria 1604
25 Ga0070676_10000502 3300005328 Bacteria 18694
26 Ga0070683_100031413 3300005329 Bacteria 4828
27 Ga0070683_100068628 3300005329 Bacteria 3303
28 Ga0070670_100284605 3300005331 Bacteria 1444
29 Ga0068869_100155453 3300005334 Bacteria 1777
30 Ga0070666_10019170 3300005335 Unclassified 4413
31 Ga0070680_100014280 3300005336 Bacteria 6203
32 Ga0070680_100056145 3300005336 Bacteria 3218
33 Ga0070682_100013134 3300005337 Bacteria 4757
34 Ga0068868_100051054 3300005338 Bacteria 3250
35 Ga0068868_100359154 3300005338 Bacteria 1249
36 Ga0070660_100069201 3300005339 Unclassified 2752
37 Ga0070660_100230010 3300005339 Bacteria 1509
38 Ga0070671_100022711 3300005355 Bacteria 5126
39 Ga0070673_100028690 3300005364 Bacteria 4141
40 Ga0070678_100003211 3300005456 Bacteria 9073
41 Ga0070678_100009089 3300005456 Bacteria 5994
42 Ga0070678_100027983 3300005456 Bacteria 3836
43 Ga0070662_100000103 3300005457 Bacteria 46838
44 Ga0070662_100047078 3300005457 Bacteria 3100
45 Ga0070681_10003760 3300005458 Bacteria 14247
46 Ga0068867_100003777 3300005459 Bacteria 10659
47 Ga0068867_100066140 3300005459 Unclassified 2692
48 Ga0068867_100235279 3300005459 Unclassified 1483
49 Ga0070679_100162606 3300005530 Bacteria 2206
50 Ga0070684_100647895 3300005535 Bacteria 983
51 Ga0068853_100031627 3300005539 Bacteria 4477
52 Ga0068853_100076126 3300005539 Bacteria 2930
53 Ga0068853_100134122 3300005539 Bacteria 2218
54 Ga0070672_100268264 3300005543 Unclassified 1441
55 Ga0070665_100000083 3300005548 Bacteria 181044
56 Ga0068855_100021807 3300005563 Bacteria 7683
57 Ga0068855_100040583 3300005563 Bacteria 5524
58 Ga0070664_100130770 3300005564 Bacteria 2205
59 Ga0068857_100071157 3300005577 Bacteria 3099
60 Ga0068856_100066515 3300005614 Bacteria 3561
61 Ga0068852_100005449 3300005616 Bacteria 9100
62 Ga0068864_100238527 3300005618 Bacteria 1684
63 Ga0068870_10032246 3300005840 Bacteria 2661
64 Ga0068863_100046687 3300005841 Bacteria 4111
65 Ga0068858_100259589 3300005842 Bacteria 1651
66 Ga0068860_100006989 3300005843 Bacteria 11309
67 Ga0068860_100039186 3300005843 Bacteria 4533
68 Ga0068860_100042069 3300005843 Bacteria 4366
69 Ga0068860_100063866 3300005843 Unclassified 3497
70 Ga0075366_10002823 3300006195 Bacteria 8994
71 Ga0097621_100000041 3300006237 Bacteria 66329
72 Ga0097621_100000278 3300006237 Bacteria 34561
73 Ga0097621_100008188 3300006237 Bacteria 7519
74 Ga0097621_100016252 3300006237 Bacteria 5620
75 Ga0068871_100000825 3300006358 Bacteria 20742
76 Ga0068871_100003606 3300006358 Bacteria 10633
77 Ga0068871_100020660 3300006358 Bacteria 5049
78 Ga0068871_100023990 3300006358 Bacteria 4727
79 Ga0068871_100352908 3300006358 Bacteria 1301
80 Ga0075428_100039278 3300006844 Bacteria 5208
81 Ga0068865_100030425 3300006881 Bacteria 3591
82 Ga0097620_100263828 3300006931 Bacteria 1814
83 Ga0105240_10003660 3300009093 Bacteria 23789
84 Ga0105240_10005530 3300009093 Bacteria 18821
85 Ga0105240_10012588 3300009093 Bacteria 11667
86 Ga0105240_10095743 3300009093 Bacteria 3619
87 Ga0105240_10102814 3300009093 Bacteria 3472
88 Ga0105240_10154766 3300009093 Bacteria 2728
89 Ga0105241_10000775 3300009174 Bacteria 24313
90 Ga0105242_10057161 3300009176 Unclassified 3193
91 Ga0105242_10153543 3300009176 Bacteria 2009
92 Ga0105242_10199204 3300009176 Unclassified 1778
93 Ga0105237_10001839 3300009545 Bacteria 27294
94 Ga0105237_10004837 3300009545 Bacteria 15473
95 Ga0105237_10005970 3300009545 Bacteria 13644
96 Ga0105238_10083451 3300009551 Bacteria 3184
97 Ga0105239_10003720 3300010375 Bacteria 18575
98 Ga0105239_10030957 3300010375 Bacteria 5887
99 Ga0105239_10056980 3300010375 Bacteria 4286
100 Ga0157373_10004673 3300013100 Bacteria 10295
101 Ga0157373_10073893 3300013100 Bacteria 2405
102 Ga0157373_10213975 3300013100 Bacteria 1359
103 Ga0157371_10001841 3300013102 Bacteria 21386
104 Ga0157371_10003210 3300013102 Bacteria 15011
105 Ga0157371_10008924 3300013102 Bacteria 7938
106 Ga0157371_10011875 3300013102 Bacteria 6685
107 Ga0157371_10034349 3300013102 Bacteria 3638
108 Ga0157371_10101938 3300013102 Unclassified 2036
109 Ga0157371_10118802 3300013102 Bacteria 1879
110 Ga0157371_10153353 3300013102 Bacteria 1643
111 Ga0157370_10090837 3300013104 Bacteria 2867
112 Ga0157370_10132356 3300013104 Bacteria 2326
113 Ga0157369_10204379 3300013105 Unclassified 2072
114 Ga0157374_10000129 3300013296 Bacteria 69468
115 Ga0157374_10003215 3300013296 Bacteria 13719
116 Ga0157374_10074921 3300013296 Bacteria 3197
117 Ga0157378_10005613 3300013297 Bacteria 10990
118 Ga0157378_10016153 3300013297 Bacteria 6537
119 Ga0157378_10020697 3300013297 Bacteria 5786
120 Ga0157378_10084353 3300013297 Bacteria 2876
121 Ga0157378_10090839 3300013297 Bacteria 2775
122 Ga0163162_10007649 3300013306 Bacteria 10525
123 Ga0163162_10136508 3300013306 Unclassified 2564
124 Ga0157372_10010840 3300013307 Bacteria 9704
125 Ga0157372_10011467 3300013307 Bacteria 9425
126 Ga0157372_10028706 3300013307 Bacteria 6074
127 Ga0157372_10062223 3300013307 Unclassified 4181
128 Ga0157372_10179638 3300013307 Unclassified 2449
129 Ga0157372_10232679 3300013307 Bacteria 2137
130 Ga0157372_10307232 3300013307 Bacteria 1845
131 Ga0157375_10000857 3300013308 Bacteria 26479
132 Ga0157375_10114797 3300013308 Bacteria 2795
133 Ga0157375_10119385 3300013308 Bacteria 2744
134 Ga0157375_10259471 3300013308 Bacteria 1899
135 Ga0157375_10283095 3300013308 Bacteria 1821
136 Ga0163163_10002460 3300014325 Bacteria 15651
137 Ga0157379_10002909 3300014968 Bacteria 14457
138 Ga0157379_10390211 3300014968 Bacteria 1278
139 Ga0157376_10018227 3300014969 Bacteria 5376
140 Ga0157376_10246210 3300014969 Bacteria 1668
141 Ga0163161_10003589 3300017792 Bacteria 10873
142 Ga0207427_100090 3300025231 Bacteria 133759
143 Ga0209437_100034 3300025233 Bacteria 494007
144 Ga0209233_1000038 3300025261 Bacteria 548972
145 Ga0209455_1001458 3300025272 Bacteria 10640
146 Ga0209673_1000042 3300025273 Bacteria 300704
147 Ga0209564_1000840 3300025295 Bacteria 41373
148 Ga0209564_1003122 3300025295 Bacteria 11698
149 Ga0209564_1004207 3300025295 Bacteria 8973
150 Ga0209758_1001003 3300025297 Bacteria 37543
151 Ga0209758_1005063 3300025297 Bacteria 10452
152 Ga0209050_1000308 3300025298 Bacteria 99516
153 Ga0209050_1004552 3300025298 Bacteria 9310
154 Ga0209050_1040256 3300025298 Bacteria 1304
155 Ga0207426_1000442 3300025302 Bacteria 66642
156 Ga0207426_1000934 3300025302 Bacteria 29145
157 Ga0207426_1002510 3300025302 Bacteria 11539
158 Ga0209257_1001059 3300025304 Bacteria 36382
159 Ga0209257_1033383 3300025304 Bacteria 1619
160 Ga0207680_10200553 3300025903 Unclassified 1359
161 Ga0207680_10305067 3300025903 Unclassified 1110
162 Ga0207647_10000062 3300025904 Bacteria 83809
163 Ga0207645_10000224 3300025907 Bacteria 46998
164 Ga0207705_10007695 3300025909 Bacteria 7919
165 Ga0207654_10002243 3300025911 Bacteria 9913
166 Ga0207707_10071395 3300025912 Bacteria 3026
167 Ga0207695_10003717 3300025913 Bacteria 21241
168 Ga0207695_10120982 3300025913 Bacteria 2586
169 Ga0207695_10181896 3300025913 Bacteria 2023
170 Ga0207671_10000961 3300025914 Bacteria 35766
171 Ga0207671_10005876 3300025914 Bacteria 11140
172 Ga0207671_10075589 3300025914 Bacteria 2520
173 Ga0207660_10008783 3300025917 Bacteria 6531
174 Ga0207657_10010543 3300025919 Bacteria 9215
175 Ga0207657_10097182 3300025919 Bacteria 2449
176 Ga0207657_10202134 3300025919 Bacteria 1598
177 Ga0207652_10000180 3300025921 Bacteria 66974
178 Ga0207652_10013779 3300025921 Bacteria 6539
179 Ga0207652_10139550 3300025921 Bacteria 2167
180 Ga0207694_10050519 3300025924 Bacteria 3221
181 Ga0207659_10013529 3300025926 Bacteria 5231
182 Ga0207644_10014794 3300025931 Bacteria 5229
183 Ga0207706_10000851 3300025933 Bacteria 31416
184 Ga0207686_10181069 3300025934 Bacteria 1494
185 Ga0207704_10000037 3300025938 Bacteria 93990
186 Ga0207691_10223148 3300025940 Unclassified 1633
187 Ga0207689_10003933 3300025942 Bacteria 13528
188 Ga0207689_10004503 3300025942 Bacteria 12609
189 Ga0207689_10180492 3300025942 Bacteria 1741
190 Ga0207661_10050434 3300025944 Bacteria 3316
191 Ga0207667_10017568 3300025949 Bacteria 8045
192 Ga0207667_10032715 3300025949 Bacteria 5599
193 Ga0207667_10137265 3300025949 Bacteria 2518
194 Ga0207712_10083923 3300025961 Bacteria 2326
195 Ga0207640_10321378 3300025981 Bacteria 1232
196 Ga0207677_10079381 3300026023 Bacteria 2347
197 Ga0207703_10225365 3300026035 Unclassified 1678
198 Ga0207703_10401445 3300026035 Bacteria 1272
199 Ga0207639_10019750 3300026041 Bacteria 4811
200 Ga0207639_10092274 3300026041 Bacteria 2427
201 Ga0207678_10067428 3300026067 Unclassified 3072
202 Ga0207641_10041194 3300026088 Bacteria 3870
203 Ga0207648_10000241 3300026089 Bacteria 58974
204 Ga0207648_10081251 3300026089 Unclassified 2827
205 Ga0207648_10282598 3300026089 Unclassified 1484
206 Ga0207674_10400500 3300026116 Bacteria 1326
207 Ga0207675_100042377 3300026118 Bacteria 4250
208 Ga0207683_10006368 3300026121 Bacteria 10109
209 Ga0207683_10025601 3300026121 Bacteria 5091
210 Ga0207683_10144098 3300026121 Bacteria 2147
211 Ga0207698_10004698 3300026142 Bacteria 8353
212 Ga0268266_10000095 3300028379 Bacteria 186169
213 Ga0268264_10004919 3300028381 Bacteria 11321
214 Ga0268264_10016575 3300028381 Bacteria 6034
215 Ga0268264_10221081 3300028381 Bacteria 1743
216 Ga0307517_10000719 3300028786 Bacteria 56987
217 Ga0307515_10004038 3300028794 Bacteria 30636
218 Ga0307515_10006107 3300028794 Bacteria 24219
219 Ga0307513_10111269 3300031456 Bacteria 2732
220 Ga0307510_10006060 3300033180 Bacteria 14412
221 Ga0395899_0078159 3300037312 Bacteria 2412
222 Ga0395900_0001938 3300037418 Bacteria 23442
223 Ga0395900_0028047 3300037418 Bacteria 5764
224 Ga0395905_0019529 3300037471 Bacteria 6424
225 Ga0395905_0086521 3300037471 Bacteria 2938
226 Ga0395901_0105192 3300038443 Unclassified 2962
227 Ga0436365_0298838 3300039437 Bacteria 7530
228 Ga0451577_0052118 3300042876 Unclassified 3654
229 Ga0466970_0000119 3300044765 Bacteria 35288
230 Ga0495638_0000005 3300046460 Bacteria 680627
231 Ga0495650_0000014 3300046471 Bacteria 581606
232 Ga0495585_0001451 3300046492 Bacteria 18615
233 Ga0495585_0002526 3300046492 Bacteria 13003
234 Ga0495606_0000241 3300046507 Bacteria 96663
235 Ga0495610_0001644 3300046512 Bacteria 19645
236 Ga0495610_0064205 3300046512 Bacteria 1736
237 Ga0495616_0001895 3300046513 Bacteria 14129
238 Ga0495628_0190621 3300046516 Bacteria 1548
239 Ga0495648_0005339 3300046524 Bacteria 10707
240 Ga0495648_0167026 3300046524 Bacteria 1131
241 Ga0495654_0013201 3300046530 Bacteria 4424
242 Ga0495609_0001800 3300046538 Bacteria 13764
243 Ga0495633_0011124 3300046558 Bacteria 4877
244 Ga0495668_0002237 3300046616 Bacteria 16368
245 Ga0495625_0000003 3300046660 Bacteria 686847
246 Ga0495625_0000381 3300046660 Bacteria 67732
247 Ga0495625_0003720 3300046660 Bacteria 14873
248 Ga0495625_0019500 3300046660 Bacteria 5260
249 Ga0495669_0058147 3300046684 Bacteria 1745
250 Ga0495649_0000002 3300046694 Bacteria 1093458
251 Ga0495649_0080274 3300046694 Unclassified 1745
252 Ga0495683_0035898 3300047323 Bacteria 2519
253 Ga0495687_002135 3300047443 Bacteria 16518
254 Ga0495687_003277 3300047443 Bacteria 11922
255 Ga0495686_0004577 3300047472 Bacteria 11288
256 Ga0496114_0047361 3300048917 Bacteria 3577
257 Ga0495678_012200 3300049459 Bacteria 4081
258 nmdc:mga0k408_1219_c1 3300050493 Bacteria 14084
259 nmdc:mga07m45_93620_c1 3300050496 Bacteria 1722
260 Ga0500635_0033940 3300053080 Bacteria 1668
261 Ga0500608_009310 3300053122 Bacteria 4166
262 Ga0500618_000150 3300053125 Bacteria 57266
263 Ga0500618_016638 3300053125 Bacteria 1838
264 Ga0500616_0000003 3300053153 Bacteria 1220687
265 Ga0500637_0063637 3300053178 Bacteria 2115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0011124 Ga0495633_0011124_4035_4832 265
2 3300003791 Ga0055530_10037242 Ga0055530_100372421 267
3 3300025304 Ga0209257_1033383 Ga0209257_10333832 267
4 3300013307 Ga0157372_10011467 Ga0157372_100114675 275
5 3300005331 Ga0070670_100284605 Ga0070670_1002846051 285
6 3300005327 Ga0070658_10220277 Ga0070658_102202771 286
7 3300013100 Ga0157373_10004673 Ga0157373_100046734 289
8 3300013102 Ga0157371_10008924 Ga0157371_100089243 289
9 3300013307 Ga0157372_10028706 Ga0157372_100287066 289
10 3300025272 Ga0209455_1001458 Ga0209455_100145813 290
11 3300003316 rootH1_10040535 rootH1_100405352 292
12 3300014325 Ga0163163_10002460 Ga0163163_100024605 292
13 iso_pu_bacteria 2919437846 2919439256 294
14 3300002737 JGI25162J39368_1000427 JGI25162J39368_100042722 296
15 3300002772 JGI25164J39214_1003221 JGI25164J39214_10032212 296
16 3300003214 JGI25165J46597_1000548 JGI25165J46597_100054825 296
17 3300003323 rootH1_10029634 rootH1_1002963416 296
18 3300006844 Ga0075428_100039278 Ga0075428_1000392782 296
19 3300025231 Ga0207427_100090 Ga0207427_10009089 296
20 3300025233 Ga0209437_100034 Ga0209437_100034298 296
21 3300025261 Ga0209233_1000038 Ga0209233_1000038298 296
22 3300028794 Ga0307515_10006107 Ga0307515_1000610717 296
23 3300046492 Ga0495585_0001451 Ga0495585_0001451_9335_10228 296
24 3300046516 Ga0495628_0190621 Ga0495628_0190621_409_1302 296
25 3300046524 Ga0495648_0005339 Ga0495648_0005339_4071_4964 296
26 3300046530 Ga0495654_0013201 Ga0495654_0013201_3005_3898 296
27 3300046538 Ga0495609_0001800 Ga0495609_0001800_5198_6091 296
28 3300046616 Ga0495668_0002237 Ga0495668_0002237_14989_15882 296
29 3300046660 Ga0495625_0000381 Ga0495625_0000381_31845_32738 296
30 iso_pu_bacteria 2919437846 2919442319 296
31 3300005530 Ga0070679_100162606 Ga0070679_1001626062 297
32 3300025298 Ga0209050_1040256 Ga0209050_10402562 297
33 3300026116 Ga0207674_10400500 Ga0207674_104005002 297
34 3300042876 Ga0451577_0052118 Ga0451577_0052118_2729_3634 297
35 iso_pu_bacteria 2599185184 2599477289 297
36 iso_pu_bacteria 2928078545 2928079205 297
37 iso_pu_bacteria 2928147474 2928148423 297
38 iso_pu_bacteria 2932082852 2932085720 297
39 3300001991 JGI24743J22301_10012060 JGI24743J22301_100120602 298
40 3300002077 JGI24744J21845_10001323 JGI24744J21845_100013236 298
41 3300003323 rootH1_10039695 rootH1_100396955 298
42 3300005328 Ga0070676_10000502 Ga0070676_100005028 298
43 3300005334 Ga0068869_100155453 Ga0068869_1001554532 298
44 3300005338 Ga0068868_100359154 Ga0068868_1003591541 298
45 3300005339 Ga0070660_100230010 Ga0070660_1002300102 298
46 3300005364 Ga0070673_100028690 Ga0070673_1000286904 298
47 3300005456 Ga0070678_100009089 Ga0070678_1000090895 298
48 3300005457 Ga0070662_100000103 Ga0070662_10000010336 298
49 3300005459 Ga0068867_100003777 Ga0068867_1000037774 298
50 3300005539 Ga0068853_100031627 Ga0068853_1000316276 298
51 3300005539 Ga0068853_100076126 Ga0068853_1000761262 298
52 3300005548 Ga0070665_100000083 Ga0070665_10000008376 298
53 3300005563 Ga0068855_100040583 Ga0068855_1000405833 298
54 3300005616 Ga0068852_100005449 Ga0068852_1000054498 298
55 3300005840 Ga0068870_10032246 Ga0068870_100322464 298
56 3300005842 Ga0068858_100259589 Ga0068858_1002595892 298
57 3300006237 Ga0097621_100000041 Ga0097621_10000004169 298
58 3300006358 Ga0068871_100003606 Ga0068871_1000036067 298
59 3300006881 Ga0068865_100030425 Ga0068865_1000304254 298
60 3300009093 Ga0105240_10012588 Ga0105240_100125885 298
61 3300009093 Ga0105240_10102814 Ga0105240_101028143 298
62 3300009174 Ga0105241_10000775 Ga0105241_1000077525 298
63 3300009176 Ga0105242_10199204 Ga0105242_101992042 298
64 3300009545 Ga0105237_10005970 Ga0105237_100059704 298
65 3300009551 Ga0105238_10083451 Ga0105238_100834513 298
66 3300010375 Ga0105239_10003720 Ga0105239_100037207 298
67 3300010375 Ga0105239_10056980 Ga0105239_100569804 298
68 3300013100 Ga0157373_10213975 Ga0157373_102139752 298
69 3300013296 Ga0157374_10000129 Ga0157374_1000012957 298
70 3300013296 Ga0157374_10003215 Ga0157374_100032158 298
71 3300013297 Ga0157378_10016153 Ga0157378_100161537 298
72 3300013307 Ga0157372_10307232 Ga0157372_103072322 298
73 3300013308 Ga0157375_10119385 Ga0157375_101193853 298
74 3300013308 Ga0157375_10259471 Ga0157375_102594712 298
75 3300014969 Ga0157376_10018227 Ga0157376_100182272 298
76 3300025904 Ga0207647_10000062 Ga0207647_1000006221 298
77 3300025907 Ga0207645_10000224 Ga0207645_1000022421 298
78 3300025911 Ga0207654_10002243 Ga0207654_100022439 298
79 3300025913 Ga0207695_10003717 Ga0207695_1000371723 298
80 3300025914 Ga0207671_10005876 Ga0207671_100058767 298
81 3300025914 Ga0207671_10075589 Ga0207671_100755893 298
82 3300025919 Ga0207657_10202134 Ga0207657_102021342 298
83 3300025924 Ga0207694_10050519 Ga0207694_100505193 298
84 3300025933 Ga0207706_10000851 Ga0207706_1000085114 298
85 3300025938 Ga0207704_10000037 Ga0207704_1000003764 298
86 3300025942 Ga0207689_10180492 Ga0207689_101804922 298
87 3300025949 Ga0207667_10032715 Ga0207667_100327153 298
88 3300026023 Ga0207677_10079381 Ga0207677_100793813 298
89 3300026035 Ga0207703_10401445 Ga0207703_104014452 298
90 3300026041 Ga0207639_10019750 Ga0207639_100197502 298
91 3300026089 Ga0207648_10000241 Ga0207648_1000024152 298
92 3300026121 Ga0207683_10006368 Ga0207683_100063685 298
93 3300026142 Ga0207698_10004698 Ga0207698_1000469811 298
94 3300028379 Ga0268266_10000095 Ga0268266_1000009580 298
95 3300033180 Ga0307510_10006060 Ga0307510_1000606016 298
96 3300046660 Ga0495625_0003720 Ga0495625_0003720_644_1543 298
97 3300046684 Ga0495669_0058147 Ga0495669_0058147_208_1107 298
98 3300046694 Ga0495649_0080274 Ga0495649_0080274_711_1610 298
99 3300047323 Ga0495683_0035898 Ga0495683_0035898_637_1536 298
100 3300047443 Ga0495687_003277 Ga0495687_003277_7255_8205 298
101 3300050496 nmdc:mga07m45_93620_c1 nmdc:mga07m45_93620_c1_148_1047 298
102 3300053122 Ga0500608_009310 Ga0500608_009310_2105_3004 298
103 3300003322 rootL2_10040009 rootL2_100400098 299
104 3300006195 Ga0075366_10002823 Ga0075366_1000282312 299
105 3300025298 Ga0209050_1004552 Ga0209050_100455213 299
106 3300028794 Ga0307515_10004038 Ga0307515_1000403830 299
107 3300031456 Ga0307513_10111269 Ga0307513_101112692 299
108 3300046460 Ga0495638_0000005 Ga0495638_0000005_511739_512647 299
109 3300050493 nmdc:mga0k408_1219_c1 nmdc:mga0k408_1219_c1_7516_8418 299
110 3300053080 Ga0500635_0033940 Ga0500635_0033940_59_961 299
111 3300053153 Ga0500616_0000003 Ga0500616_0000003_1051449_1052357 299
112 3300005618 Ga0068864_100238527 Ga0068864_1002385272 300
113 3300009093 Ga0105240_10095743 Ga0105240_100957434 300
114 3300013102 Ga0157371_10001841 Ga0157371_1000184118 300
115 3300025913 Ga0207695_10181896 Ga0207695_101818963 300
116 3300028786 Ga0307517_10000719 Ga0307517_1000071913 300
117 3300037418 Ga0395900_0001938 Ga0395900_0001938_17682_18587 300
118 3300046524 Ga0495648_0167026 Ga0495648_0167026_204_1106 300
119 3300046660 Ga0495625_0019500 Ga0495625_0019500_1406_2308 300
120 3300047472 Ga0495686_0004577 Ga0495686_0004577_2244_3149 300
121 3300049459 Ga0495678_012200 Ga0495678_012200_2025_2930 300
122 3300053125 Ga0500618_000150 Ga0500618_000150_6992_7894 300
123 3300001989 JGI24739J22299_10003846 JGI24739J22299_100038466 301
124 3300001989 JGI24739J22299_10012057 JGI24739J22299_100120572 301
125 3300001990 JGI24737J22298_10000218 JGI24737J22298_1000021816 301
126 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001336 301
127 3300003316 rootH1_10056014 rootH1_100560144 301
128 3300005329 Ga0070683_100031413 Ga0070683_1000314136 301
129 3300005335 Ga0070666_10019170 Ga0070666_100191702 301
130 3300005338 Ga0068868_100051054 Ga0068868_1000510542 301
131 3300005355 Ga0070671_100022711 Ga0070671_1000227113 301
132 3300005456 Ga0070678_100003211 Ga0070678_1000032113 301
133 3300005459 Ga0068867_100235279 Ga0068867_1002352791 301
134 3300005535 Ga0070684_100647895 Ga0070684_1006478951 301
135 3300005564 Ga0070664_100130770 Ga0070664_1001307703 301
136 3300005841 Ga0068863_100046687 Ga0068863_1000466874 301
137 3300005843 Ga0068860_100006989 Ga0068860_1000069895 301
138 3300006237 Ga0097621_100000278 Ga0097621_10000027810 301
139 3300006358 Ga0068871_100000825 Ga0068871_1000008254 301
140 3300006358 Ga0068871_100352908 Ga0068871_1003529082 301
141 3300009093 Ga0105240_10003660 Ga0105240_1000366025 301
142 3300009093 Ga0105240_10005530 Ga0105240_100055305 301
143 3300009545 Ga0105237_10001839 Ga0105237_1000183913 301
144 3300009545 Ga0105237_10004837 Ga0105237_100048375 301
145 3300010375 Ga0105239_10030957 Ga0105239_100309577 301
146 3300013102 Ga0157371_10034349 Ga0157371_100343492 301
147 3300013105 Ga0157369_10204379 Ga0157369_102043793 301
148 3300013297 Ga0157378_10005613 Ga0157378_100056136 301
149 3300013306 Ga0163162_10007649 Ga0163162_100076493 301
150 3300013307 Ga0157372_10010840 Ga0157372_100108405 301
151 3300013307 Ga0157372_10232679 Ga0157372_102326793 301
152 3300013308 Ga0157375_10000857 Ga0157375_100008576 301
153 3300013308 Ga0157375_10114797 Ga0157375_101147971 301
154 3300014968 Ga0157379_10002909 Ga0157379_100029095 301
155 3300017792 Ga0163161_10003589 Ga0163161_100035897 301
156 3300025903 Ga0207680_10200553 Ga0207680_102005532 301
157 3300025913 Ga0207695_10120982 Ga0207695_101209823 301
158 3300025914 Ga0207671_10000961 Ga0207671_100009615 301
159 3300025931 Ga0207644_10014794 Ga0207644_100147943 301
160 3300025944 Ga0207661_10050434 Ga0207661_100504344 301
161 3300025949 Ga0207667_10137265 Ga0207667_101372653 301
162 3300026035 Ga0207703_10225365 Ga0207703_102253652 301
163 3300026088 Ga0207641_10041194 Ga0207641_100411942 301
164 3300026089 Ga0207648_10282598 Ga0207648_102825981 301
165 3300026121 Ga0207683_10144098 Ga0207683_101440983 301
166 3300028381 Ga0268264_10004919 Ga0268264_100049195 301
167 3300039437 Ga0436365_0298838 Ga0436365_0298838_3873_4781 301
168 3300046471 Ga0495650_0000014 Ga0495650_0000014_14671_15579 301
169 3300046492 Ga0495585_0002526 Ga0495585_0002526_7351_8259 301
170 3300046507 Ga0495606_0000241 Ga0495606_0000241_67725_68633 301
171 3300046512 Ga0495610_0001644 Ga0495610_0001644_12625_13533 301
172 3300046512 Ga0495610_0064205 Ga0495610_0064205_193_1101 301
173 3300046513 Ga0495616_0001895 Ga0495616_0001895_4155_5063 301
174 3300046660 Ga0495625_0000003 Ga0495625_0000003_221226_222134 301
175 3300046694 Ga0495649_0000002 Ga0495649_0000002_784859_785767 301
176 3300047443 Ga0495687_002135 Ga0495687_002135_13942_14850 301
177 3300048917 Ga0496114_0047361 Ga0496114_0047361_2315_3223 301
178 3300053125 Ga0500618_016638 Ga0500618_016638_176_1084 301
179 3300006237 Ga0097621_100016252 Ga0097621_1000162525 302
180 3300006358 Ga0068871_100023990 Ga0068871_1000239905 302
181 3300013297 Ga0157378_10090839 Ga0157378_100908392 302
182 3300044765 Ga0466970_0000119 Ga0466970_0000119_6967_7908 302
183 3300005329 Ga0070683_100068628 Ga0070683_1000686282 304
184 3300005337 Ga0070682_100013134 Ga0070682_1000131341 304
185 3300005457 Ga0070662_100047078 Ga0070662_1000470781 304
186 3300005459 Ga0068867_100066140 Ga0068867_1000661402 304
187 3300005539 Ga0068853_100134122 Ga0068853_1001341222 304
188 3300005577 Ga0068857_100071157 Ga0068857_1000711571 304
189 3300005843 Ga0068860_100063866 Ga0068860_1000638662 304
190 3300009093 Ga0105240_10154766 Ga0105240_101547663 304
191 3300009176 Ga0105242_10057161 Ga0105242_100571612 304
192 3300013104 Ga0157370_10132356 Ga0157370_101323561 304
193 3300013296 Ga0157374_10074921 Ga0157374_100749212 304
194 3300014968 Ga0157379_10390211 Ga0157379_103902111 304
195 3300014969 Ga0157376_10246210 Ga0157376_102462101 304
196 3300025903 Ga0207680_10305067 Ga0207680_103050671 304
197 3300025919 Ga0207657_10010543 Ga0207657_100105435 304
198 3300025926 Ga0207659_10013529 Ga0207659_100135295 304
199 3300025934 Ga0207686_10181069 Ga0207686_101810691 304
200 3300025942 Ga0207689_10004503 Ga0207689_100045032 304
201 3300025961 Ga0207712_10083923 Ga0207712_100839232 304
202 3300026041 Ga0207639_10092274 Ga0207639_100922743 304
203 3300026089 Ga0207648_10081251 Ga0207648_100812513 304
204 3300028381 Ga0268264_10221081 Ga0268264_102210812 304
205 3300037418 Ga0395900_0028047 Ga0395900_0028047_3644_4558 304
206 3300037471 Ga0395905_0019529 Ga0395905_0019529_472_1386 304
207 3300005327 Ga0070658_10005770 Ga0070658_1000577010 305
208 3300005336 Ga0070680_100014280 Ga0070680_1000142805 305
209 3300005336 Ga0070680_100056145 Ga0070680_1000561454 305
210 3300005339 Ga0070660_100069201 Ga0070660_1000692013 305
211 3300005458 Ga0070681_10003760 Ga0070681_100037602 305
212 3300005563 Ga0068855_100021807 Ga0068855_1000218074 305
213 3300005614 Ga0068856_100066515 Ga0068856_1000665153 305
214 3300005843 Ga0068860_100039186 Ga0068860_1000391864 305
215 3300005843 Ga0068860_100042069 Ga0068860_1000420694 305
216 3300006237 Ga0097621_100008188 Ga0097621_1000081887 305
217 3300006358 Ga0068871_100020660 Ga0068871_1000206603 305
218 3300006931 Ga0097620_100263828 Ga0097620_1002638282 305
219 3300009176 Ga0105242_10153543 Ga0105242_101535433 305
220 3300013100 Ga0157373_10073893 Ga0157373_100738933 305
221 3300013102 Ga0157371_10003210 Ga0157371_1000321013 305
222 3300013102 Ga0157371_10011875 Ga0157371_100118758 305
223 3300013102 Ga0157371_10101938 Ga0157371_101019382 305
224 3300013102 Ga0157371_10153353 Ga0157371_101533532 305
225 3300013104 Ga0157370_10090837 Ga0157370_100908372 305
226 3300013297 Ga0157378_10020697 Ga0157378_100206974 305
227 3300013297 Ga0157378_10084353 Ga0157378_100843532 305
228 3300013307 Ga0157372_10062223 Ga0157372_100622234 305
229 3300013307 Ga0157372_10179638 Ga0157372_101796382 305
230 3300013308 Ga0157375_10283095 Ga0157375_102830952 305
231 3300025909 Ga0207705_10007695 Ga0207705_100076955 305
232 3300025912 Ga0207707_10071395 Ga0207707_100713953 305
233 3300025917 Ga0207660_10008783 Ga0207660_100087834 305
234 3300025919 Ga0207657_10097182 Ga0207657_100971822 305
235 3300025921 Ga0207652_10000180 Ga0207652_1000018029 305
236 3300025921 Ga0207652_10013779 Ga0207652_100137792 305
237 3300025921 Ga0207652_10139550 Ga0207652_101395502 305
238 3300025942 Ga0207689_10003933 Ga0207689_100039336 305
239 3300025949 Ga0207667_10017568 Ga0207667_100175683 305
240 3300026067 Ga0207678_10067428 Ga0207678_100674282 305
241 3300026118 Ga0207675_100042377 Ga0207675_1000423774 305
242 3300028381 Ga0268264_10016575 Ga0268264_100165754 305
243 3300037312 Ga0395899_0078159 Ga0395899_0078159_1214_2134 305
244 3300037471 Ga0395905_0086521 Ga0395905_0086521_1426_2343 305
245 3300038443 Ga0395901_0105192 Ga0395901_0105192_402_1322 305
246 3300053178 Ga0500637_0063637 Ga0500637_0063637_149_1075 305
247 3300025981 Ga0207640_10321378 Ga0207640_103213782 306
248 3300001989 JGI24739J22299_10000277 JGI24739J22299_100002778 307
249 3300003320 rootH2_10105467 rootH2_101054674 307
250 3300003354 JGI25160J50197_1005161 JGI25160J50197_10051617 307
251 3300003771 Ga0055526_1007839 Ga0055526_10078393 307
252 3300003790 Ga0055528_1000180 Ga0055528_100018040 307
253 3300003791 Ga0055530_10005213 Ga0055530_100052136 307
254 3300005262 Ga0065165_1000019 Ga0065165_1000019189 307
255 3300005456 Ga0070678_100027983 Ga0070678_1000279831 307
256 3300005543 Ga0070672_100268264 Ga0070672_1002682642 307
257 3300013102 Ga0157371_10118802 Ga0157371_101188022 307
258 3300013306 Ga0163162_10136508 Ga0163162_101365082 307
259 3300025273 Ga0209673_1000042 Ga0209673_1000042102 307
260 3300025295 Ga0209564_1000840 Ga0209564_100084023 307
261 3300025295 Ga0209564_1003122 Ga0209564_10031228 307
262 3300025295 Ga0209564_1004207 Ga0209564_10042074 307
263 3300025297 Ga0209758_1001003 Ga0209758_100100320 307
264 3300025297 Ga0209758_1005063 Ga0209758_10050631 307
265 3300025298 Ga0209050_1000308 Ga0209050_100030816 307
266 3300025302 Ga0207426_1000442 Ga0207426_10004428 307
267 3300025302 Ga0207426_1000934 Ga0207426_100093414 307
268 3300025302 Ga0207426_1002510 Ga0207426_10025108 307
269 3300025304 Ga0209257_1001059 Ga0209257_10010595 307
270 3300025940 Ga0207691_10223148 Ga0207691_102231482 307
271 3300026121 Ga0207683_10025601 Ga0207683_100256013 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

96

307

0.99

PF00326

Peptidase_S9

Prolyl oligopeptidase family

224

347

0.86

PF00135

COesterase

Carboxylesterase family

62

213

0.77

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

111

327

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nkf-assembly2.cif.gz_B crystal structure of the lipase lip_vut4 from goat rumen metagenome. 0.8825 38 306
6mly-assembly1.cif.gz_A bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8733 40 303
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.873 40 307
6xyc-assembly1.cif.gz_A truncated form of carbohydrate esterase from gut microbiota 0.861 34 303
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.8289 56 303
ID Description Score Start End Superfamily
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8787 42 304 3.40.50.1820
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8445 42 304 3.40.50.1820
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8342 41 294 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8013 56 305 3.40.50.1820
af_Q63HM1_47_299_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7997 39 299 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5C5XHP7-F1-model_v4 Carboxylesterase NlhH (EC 3.1.1.1) 0.9245 37 306 GO:0005509
GO:0106435
AF-A0A3L7N8H4-F1-model_v4 Alpha/beta hydrolase 0.9222 37 306 GO:0016787
AF-A0A3L7SQX0-F1-model_v4 Alpha/beta hydrolase 0.9206 39 307 GO:0016020
GO:0016787
AF-A0A349VGJ5-F1-model_v4 BD-FAE-like domain-containing protein 0.9199 205 307
AF-A0A5M6DE47-F1-model_v4 Alpha/beta hydrolase 0.9182 35 306 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.49 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map