F377430

General Info

Members Datasets Scaffolds Average Seq Length
271 177 542 336

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100074378|Ga0070683_1000743781
Length 360
Sequence MMSDLEIYQLTGPFGFAHHVTRNIDAKSERQKGMSGSETKIFDPRDSSTDSRGAELLDPSLALRGKQWCLYLAGQQHGHGATDIYSAALAPGATLSPNGWQVTRDVSGQLIPAAGRNLSAPWDGKGGRHCPSYVKGFDPHKDAWVERIYYAGAAENLWGPYKIGFLEWDGGKWVDQTHPVFVPSEDWERGSVYEPNLIYHDNKWKMWYVAGSNHEDYLVQGYAESEDGSTHWSKHVVFAPAERKIFDFCVRQRGVEFDAIFARVWVGAGTPPPETGLWWCHALKPSGVFSGWSEPTQIMTATDRGWHSGPWKPSFHFREECHNHALVFFDGAYRTSDPGPFPFAFTLGCLEIDLPVDSSN

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0
Rhizoplane 2.95
Rhizosphere 87.82
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100074378 3300005329 Bacteria 3173
2 Ga0070676_10066245 3300005328 Bacteria 2158
3 Ga0070666_10022154 3300005335 Bacteria 4123
4 Ga0070680_100020977 3300005336 Bacteria 5188
5 Ga0070680_100219570 3300005336 Bacteria 1604
6 Ga0070682_100078759 3300005337 Bacteria 2127
7 Ga0068868_100008315 3300005338 Bacteria 7427
8 Ga0068868_100013208 3300005338 Bacteria 6048
9 Ga0070668_100165716 3300005347 Bacteria 1796
10 Ga0070675_100106883 3300005354 Bacteria 2362
11 Ga0070673_100102112 3300005364 Bacteria 2364
12 Ga0070667_100141611 3300005367 Bacteria 2106
13 Ga0070709_10152138 3300005434 Bacteria 1600
14 Ga0070714_100043267 3300005435 Bacteria 3808
15 Ga0070714_100057626 3300005435 Unclassified 3326
16 Ga0070714_100300121 3300005435 Bacteria 1497
17 Ga0070713_100022611 3300005436 Bacteria 4861
18 Ga0070713_100033093 3300005436 Bacteria 4137
19 Ga0070711_100000623 3300005439 Bacteria 18462
20 Ga0070705_100135859 3300005440 Bacteria 1611
21 Ga0070694_100014065 3300005444 Bacteria 5006
22 Ga0070678_100017000 3300005456 Bacteria 4669
23 Ga0070678_100391287 3300005456 Bacteria 1205
24 Ga0070662_100076924 3300005457 Bacteria 2475
25 Ga0070681_10032550 3300005458 Bacteria 5233
26 Ga0068867_100171145 3300005459 Bacteria 1720
27 Ga0070706_100003631 3300005467 Bacteria 15104
28 Ga0070706_100006804 3300005467 Bacteria 10792
29 Ga0070706_100456440 3300005467 Unclassified 1189
30 Ga0070699_100033589 3300005518 Bacteria 4432
31 Ga0070699_100189122 3300005518 Bacteria 1828
32 Ga0070679_100028411 3300005530 Bacteria 5514
33 Ga0070679_100038403 3300005530 Bacteria 4760
34 Ga0070684_100039507 3300005535 Bacteria 4059
35 Ga0070697_100006028 3300005536 Bacteria 9377
36 Ga0068853_100130973 3300005539 Bacteria 2245
37 Ga0068853_100139749 3300005539 Bacteria 2174
38 Ga0070672_100018679 3300005543 Bacteria 5018
39 Ga0070695_100067741 3300005545 Unclassified 2329
40 Ga0070695_100160823 3300005545 Bacteria 1576
41 Ga0070665_100107300 3300005548 Bacteria 2795
42 Ga0068855_100000216 3300005563 Bacteria 73411
43 Ga0068855_100000563 3300005563 Bacteria 45518
44 Ga0068855_100000676 3300005563 Bacteria 41621
45 Ga0068855_100065041 3300005563 Bacteria 4251
46 Ga0070664_100053981 3300005564 Bacteria 3408
47 Ga0068857_100302550 3300005577 Bacteria 1474
48 Ga0068854_100091577 3300005578 Bacteria 2263
49 Ga0068856_100000175 3300005614 Bacteria 66501
50 Ga0068856_100000448 3300005614 Bacteria 45521
51 Ga0068852_100000042 3300005616 Bacteria 91949
52 Ga0068852_100123518 3300005616 Bacteria 2374
53 Ga0068852_100360237 3300005616 Bacteria 1422
54 Ga0068864_100038101 3300005618 Bacteria 4103
55 Ga0068864_100052118 3300005618 Bacteria 3527
56 Ga0068864_100101548 3300005618 Unclassified 2551
57 Ga0068861_100000127 3300005719 Bacteria 39140
58 Ga0068861_100039745 3300005719 Bacteria 3513
59 Ga0068851_10093291 3300005834 Bacteria 1588
60 Ga0068863_100107178 3300005841 Bacteria 2659
61 Ga0068858_100017447 3300005842 Bacteria 6733
62 Ga0068858_100033046 3300005842 Unclassified 4805
63 Ga0068858_100040332 3300005842 Bacteria 4330
64 Ga0070717_10002881 3300006028 Bacteria 12205
65 Ga0070717_10004516 3300006028 Bacteria 10053
66 Ga0070717_10013249 3300006028 Bacteria 6311
67 Ga0070717_10099828 3300006028 Bacteria 2463
68 Ga0075365_10155211 3300006038 Bacteria 1593
69 Ga0075368_10074486 3300006042 Bacteria 1375
70 Ga0075364_10056559 3300006051 Bacteria 2568
71 Ga0075364_10081845 3300006051 Bacteria 2135
72 Ga0070715_10026258 3300006163 Bacteria 2315
73 Ga0070716_100006205 3300006173 Bacteria 5833
74 Ga0070712_100000952 3300006175 Bacteria 17401
75 Ga0075362_10103204 3300006177 Bacteria 1335
76 Ga0075367_10009854 3300006178 Bacteria 5005
77 Ga0075367_10023489 3300006178 Bacteria 3469
78 Ga0075366_10000211 3300006195 Bacteria 25584
79 Ga0097621_100000279 3300006237 Bacteria 34252
80 Ga0097621_100070211 3300006237 Bacteria 2892
81 Ga0075370_10026424 3300006353 Bacteria 3216
82 Ga0068871_100000304 3300006358 Bacteria 34254
83 Ga0068871_100001026 3300006358 Bacteria 18715
84 Ga0068871_100113201 3300006358 Bacteria 2285
85 Ga0075428_100040100 3300006844 Bacteria 5153
86 Ga0075433_10056213 3300006852 Bacteria 3436
87 Ga0075429_100151775 3300006880 Bacteria 2029
88 Ga0068865_100227508 3300006881 Bacteria 1461
89 Ga0105240_10000065 3300009093 Bacteria 213992
90 Ga0105240_10007213 3300009093 Bacteria 16187
91 Ga0105240_10059117 3300009093 Unclassified 4785
92 Ga0111539_10000113 3300009094 Bacteria 89042
93 Ga0105247_10145380 3300009101 Bacteria 1558
94 Ga0114129_10808381 3300009147 Unclassified 1195
95 Ga0105241_10026581 3300009174 Bacteria 4307
96 Ga0105241_10036982 3300009174 Bacteria 3676
97 Ga0105242_10275880 3300009176 Bacteria 1525
98 Ga0105248_10043791 3300009177 Bacteria 5020
99 Ga0105248_10138841 3300009177 Bacteria 2742
100 Ga0105237_10120535 3300009545 Bacteria 2617
101 Ga0105238_10018330 3300009551 Bacteria 7124
102 Ga0105238_10156922 3300009551 Bacteria 2251
103 Ga0105249_10096939 3300009553 Bacteria 2768
104 Ga0105249_10107248 3300009553 Bacteria 2636
105 Ga0105239_10039890 3300010375 Bacteria 5143
106 Ga0157373_10174970 3300013100 Bacteria 1511
107 Ga0157370_10000009 3300013104 Bacteria 231270
108 Ga0157369_10000022 3300013105 Bacteria 233081
109 Ga0157369_10000243 3300013105 Bacteria 75602
110 Ga0157369_10180637 3300013105 Bacteria 2220
111 Ga0157369_10232250 3300013105 Unclassified 1928
112 Ga0157374_10000564 3300013296 Bacteria 32849
113 Ga0157374_10111133 3300013296 Bacteria 2636
114 Ga0157374_10283832 3300013296 Bacteria 1635
115 Ga0157378_10000377 3300013297 Bacteria 44150
116 Ga0157378_10030684 3300013297 Bacteria 4748
117 Ga0157378_10052766 3300013297 Bacteria 3618
118 Ga0163162_10225783 3300013306 Bacteria 2002
119 Ga0157372_10000040 3300013307 Bacteria 163677
120 Ga0157372_10002584 3300013307 Bacteria 19592
121 Ga0157372_10256255 3300013307 Bacteria 2031
122 Ga0157372_10339944 3300013307 Bacteria 1748
123 Ga0157372_10413616 3300013307 Bacteria 1571
124 Ga0157375_10106839 3300013308 Bacteria 2891
125 Ga0157375_10131302 3300013308 Bacteria 2624
126 Ga0157375_10328032 3300013308 Bacteria 1695
127 Ga0163163_10014249 3300014325 Bacteria 7307
128 Ga0157379_10139489 3300014968 Bacteria 2185
129 Ga0157376_10020436 3300014969 Bacteria 5122
130 Ga0157376_10187952 3300014969 Bacteria 1892
131 Ga0157376_10197823 3300014969 Unclassified 1847
132 Ga0163161_10106084 3300017792 Bacteria 2096
133 Ga0213872_10003135 3300021361 Bacteria 9287
134 Ga0213876_10055440 3300021384 Bacteria 2093
135 Ga0213876_10167557 3300021384 Bacteria 1168
136 Ga0207680_10012632 3300025903 Bacteria 4308
137 Ga0207647_10038576 3300025904 Bacteria 3019
138 Ga0207699_10038616 3300025906 Bacteria 2738
139 Ga0207705_10008642 3300025909 Bacteria 7422
140 Ga0207684_10005859 3300025910 Bacteria 11253
141 Ga0207684_10010210 3300025910 Bacteria 8265
142 Ga0207695_10000052 3300025913 Bacteria 398089
143 Ga0207695_10020143 3300025913 Bacteria 7650
144 Ga0207693_10001731 3300025915 Bacteria 19165
145 Ga0207663_10007198 3300025916 Bacteria 5758
146 Ga0207660_10137701 3300025917 Bacteria 1864
147 Ga0207652_10003767 3300025921 Bacteria 12413
148 Ga0207652_10144879 3300025921 Bacteria 2125
149 Ga0207694_10000896 3300025924 Bacteria 26371
150 Ga0207650_10061228 3300025925 Bacteria 2810
151 Ga0207659_10083087 3300025926 Bacteria 2373
152 Ga0207700_10003049 3300025928 Bacteria 9665
153 Ga0207700_10046874 3300025928 Bacteria 3200
154 Ga0207700_10237000 3300025928 Bacteria 1554
155 Ga0207664_10038257 3300025929 Bacteria 3719
156 Ga0207664_10231207 3300025929 Bacteria 1607
157 Ga0207704_10187238 3300025938 Bacteria 1502
158 Ga0207665_10049480 3300025939 Bacteria 2824
159 Ga0207691_10085897 3300025940 Bacteria 2824
160 Ga0207711_10063933 3300025941 Unclassified 3178
161 Ga0207711_10233011 3300025941 Unclassified 1687
162 Ga0207661_10054742 3300025944 Bacteria 3197
163 Ga0207679_10086623 3300025945 Bacteria 2410
164 Ga0207667_10000302 3300025949 Bacteria 68245
165 Ga0207667_10000518 3300025949 Bacteria 50833
166 Ga0207667_10002600 3300025949 Bacteria 22399
167 Ga0207667_10048132 3300025949 Unclassified 4510
168 Ga0207667_10216571 3300025949 Bacteria 1962
169 Ga0207668_10071179 3300025972 Bacteria 2483
170 Ga0207640_10016445 3300025981 Bacteria 4303
171 Ga0207640_10481349 3300025981 Bacteria 1030
172 Ga0207658_10097781 3300025986 Bacteria 2292
173 Ga0207677_10025585 3300026023 Bacteria 3684
174 Ga0207677_10036187 3300026023 Bacteria 3215
175 Ga0207703_10019211 3300026035 Bacteria 5338
176 Ga0207703_10191778 3300026035 Bacteria 1810
177 Ga0207639_10027263 3300026041 Bacteria 4160
178 Ga0207639_10139668 3300026041 Bacteria 2017
179 Ga0207639_10144486 3300026041 Bacteria 1986
180 Ga0207702_10000120 3300026078 Bacteria 91853
181 Ga0207702_10023792 3300026078 Bacteria 5082
182 Ga0207702_10096976 3300026078 Bacteria 2594
183 Ga0207641_10035616 3300026088 Bacteria 4148
184 Ga0207641_10246149 3300026088 Bacteria 1668
185 Ga0207648_10189655 3300026089 Bacteria 1821
186 Ga0207648_10336963 3300026089 Bacteria 1358
187 Ga0207676_10084472 3300026095 Unclassified 2588
188 Ga0207674_10031652 3300026116 Bacteria 5554
189 Ga0207675_100000081 3300026118 Bacteria 74948
190 Ga0207675_100087260 3300026118 Bacteria 2930
191 Ga0207683_10003608 3300026121 Bacteria 13486
192 Ga0207698_10000007 3300026142 Bacteria 289457
193 Ga0207698_10018945 3300026142 Unclassified 4700
194 Ga0207698_10056276 3300026142 Bacteria 3036
195 Ga0207698_10092557 3300026142 Bacteria 2479
196 Ga0207698_10320247 3300026142 Bacteria 1452
197 Ga0209813_10043623 3300027866 Bacteria 1375
198 Ga0207428_10001085 3300027907 Bacteria 29652
199 Ga0268266_10106482 3300028379 Bacteria 2479
200 Ga0265338_10015731 3300028800 Bacteria 8290
201 Ga0265762_1017752 3300030760 Unclassified 1296
202 Ga0265765_1000551 3300030879 Bacteria 3016
203 Ga0265330_10029138 3300031235 Bacteria 2484
204 Ga0265325_10003215 3300031241 Bacteria 10750
205 Ga0265339_10013789 3300031249 Bacteria 4892
206 Ga0265339_10108019 3300031249 Bacteria 1443
207 Ga0265316_10003088 3300031344 Bacteria 16965
208 Ga0265313_10018532 3300031595 Unclassified 3904
209 Ga0265314_10009773 3300031711 Bacteria 8058
210 Ga0265314_10053672 3300031711 Bacteria 2794
211 Ga0265342_10004570 3300031712 Bacteria 10823
212 Ga0373936_0001465 3300035113 Bacteria 8573
213 Ga0373945_0031006 3300035116 Unclassified 1887
214 Ga0373946_0058353 3300035171 Bacteria 1635
215 Ga0373947_0008064 3300035725 Bacteria 6074
216 Ga0373937_0040732 3300036401 Bacteria 4235
217 Ga0436364_1215266 3300037853 Bacteria 2416
218 Ga0436364_1461680 3300037853 Bacteria 2301
219 Ga0436365_0486244 3300039437 Bacteria 2277
220 Ga0436365_0565678 3300039437 Bacteria 2442
221 Ga0436365_1710907 3300039437 Bacteria 3199
222 Ga0436360_0252808 3300039438 Bacteria 14609
223 Ga0436361_0116595 3300039447 Unclassified 1172
224 Ga0436361_0791915 3300039447 Unclassified 1100
225 Ga0436361_0982317 3300039447 Bacteria 1102
226 Ga0436362_0534567 3300039453 Bacteria 7418
227 Ga0436362_0636385 3300039453 Unclassified 1148
228 Ga0453683_0089125 3300044673 Bacteria 1934
229 Ga0466963_0104668 3300044694 Bacteria 1939
230 Ga0466959_0062720 3300045049 Bacteria 2701
231 Ga0466967_0146954 3300045976 Unclassified 2199
232 Ga0495592_0159080 3300046454 Bacteria 1556
233 Ga0495629_0006688 3300046459 Bacteria 8527
234 Ga0495580_0000390 3300046472 Bacteria 35923
235 Ga0495580_0106269 3300046472 Unclassified 1950
236 Ga0495582_0076380 3300046473 Unclassified 1857
237 Ga0495630_0077598 3300046517 Bacteria 2504
238 Ga0495652_0253786 3300046529 Bacteria 1302
239 Ga0495587_0003114 3300046536 Bacteria 11096
240 Ga0495645_0100363 3300046543 Bacteria 2059
241 Ga0495599_0036590 3300046678 Unclassified 3084
242 Ga0495658_0005225 3300046683 Bacteria 6386
243 Ga0495674_0021138 3300047319 Bacteria 6021
244 Ga0495680_0071487 3300047322 Bacteria 2641
245 Ga0495602_0028185 3300048088 Bacteria 5379
246 Ga0496101_0156622 3300048904 Unclassified 1745
247 Ga0496106_0038784 3300048909 Bacteria 3567
248 Ga0496106_0087128 3300048909 Bacteria 2406
249 Ga0496107_0167906 3300048910 Unclassified 1627
250 Ga0496112_0004054 3300048915 Bacteria 12292
251 Ga0496112_0162211 3300048915 Unclassified 2202
252 Ga0496114_0065441 3300048917 Bacteria 3046
253 Ga0496115_0076414 3300048918 Unclassified 2722
254 nmdc:mga0yw44_17248_c1 3300050492 Bacteria 3925
255 nmdc:mga0k408_795_c1 3300050493 Bacteria 17409
256 nmdc:mga06z11_4893_c2 3300050494 Bacteria 4649
257 nmdc:mga06z11_51046_c1 3300050494 Bacteria 2116
258 nmdc:mga06z11_7667_c1 3300050494 Bacteria 4456
259 nmdc:mga04h51_52322_c1 3300050495 Bacteria 1375
260 nmdc:mga07m45_11083_c1 3300050496 Bacteria 4729
261 nmdc:mga07m45_8766_c1 3300050496 Bacteria 2756
262 nmdc:mga05p37_73841_c1 3300050507 Bacteria 4197
263 nmdc:mga09592_326178_c1 3300050508 Bacteria 1330
264 nmdc:mga09592_339988_c1 3300050508 Bacteria 1299
265 nmdc:mga06r32_526036_c1 3300050510 Bacteria 1158
266 nmdc:mga08y16_654_c1 3300050511 Bacteria 32535
267 nmdc:mga08x19_191453_c1 3300050514 Unclassified 1399
268 nmdc:mga0a205_16749_c1 3300050515 Bacteria 5588
269 nmdc:mga0a205_9305_c1 3300050515 Bacteria 8973
270 Ga0495601_0044134 3300053077 Bacteria 2802
271 Ga0495619_0203795 3300053085 Bacteria 1369
272 Ga0070683_100074378
273 Ga0070676_10066245
274 Ga0070666_10022154
275 Ga0070680_100020977
276 Ga0070680_100219570
277 Ga0070682_100078759
278 Ga0068868_100008315
279 Ga0068868_100013208
280 Ga0070668_100165716
281 Ga0070675_100106883
282 Ga0070673_100102112
283 Ga0070667_100141611
284 Ga0070709_10152138
285 Ga0070714_100043267
286 Ga0070714_100057626
287 Ga0070714_100300121
288 Ga0070713_100022611
289 Ga0070713_100033093
290 Ga0070711_100000623
291 Ga0070705_100135859
292 Ga0070694_100014065
293 Ga0070678_100017000
294 Ga0070678_100391287
295 Ga0070662_100076924
296 Ga0070681_10032550
297 Ga0068867_100171145
298 Ga0070706_100003631
299 Ga0070706_100006804
300 Ga0070706_100456440
301 Ga0070699_100033589
302 Ga0070699_100189122
303 Ga0070679_100028411
304 Ga0070679_100038403
305 Ga0070684_100039507
306 Ga0070697_100006028
307 Ga0068853_100130973
308 Ga0068853_100139749
309 Ga0070672_100018679
310 Ga0070695_100067741
311 Ga0070695_100160823
312 Ga0070665_100107300
313 Ga0068855_100000216
314 Ga0068855_100000563
315 Ga0068855_100000676
316 Ga0068855_100065041
317 Ga0070664_100053981
318 Ga0068857_100302550
319 Ga0068854_100091577
320 Ga0068856_100000175
321 Ga0068856_100000448
322 Ga0068852_100000042
323 Ga0068852_100123518
324 Ga0068852_100360237
325 Ga0068864_100038101
326 Ga0068864_100052118
327 Ga0068864_100101548
328 Ga0068861_100000127
329 Ga0068861_100039745
330 Ga0068851_10093291
331 Ga0068863_100107178
332 Ga0068858_100017447
333 Ga0068858_100033046
334 Ga0068858_100040332
335 Ga0070717_10002881
336 Ga0070717_10004516
337 Ga0070717_10013249
338 Ga0070717_10099828
339 Ga0075365_10155211
340 Ga0075368_10074486
341 Ga0075364_10056559
342 Ga0075364_10081845
343 Ga0070715_10026258
344 Ga0070716_100006205
345 Ga0070712_100000952
346 Ga0075362_10103204
347 Ga0075367_10009854
348 Ga0075367_10023489
349 Ga0075366_10000211
350 Ga0097621_100000279
351 Ga0097621_100070211
352 Ga0075370_10026424
353 Ga0068871_100000304
354 Ga0068871_100001026
355 Ga0068871_100113201
356 Ga0075428_100040100
357 Ga0075433_10056213
358 Ga0075429_100151775
359 Ga0068865_100227508
360 Ga0105240_10000065
361 Ga0105240_10007213
362 Ga0105240_10059117
363 Ga0111539_10000113
364 Ga0105247_10145380
365 Ga0114129_10808381
366 Ga0105241_10026581
367 Ga0105241_10036982
368 Ga0105242_10275880
369 Ga0105248_10043791
370 Ga0105248_10138841
371 Ga0105237_10120535
372 Ga0105238_10018330
373 Ga0105238_10156922
374 Ga0105249_10096939
375 Ga0105249_10107248
376 Ga0105239_10039890
377 Ga0157373_10174970
378 Ga0157370_10000009
379 Ga0157369_10000022
380 Ga0157369_10000243
381 Ga0157369_10180637
382 Ga0157369_10232250
383 Ga0157374_10000564
384 Ga0157374_10111133
385 Ga0157374_10283832
386 Ga0157378_10000377
387 Ga0157378_10030684
388 Ga0157378_10052766
389 Ga0163162_10225783
390 Ga0157372_10000040
391 Ga0157372_10002584
392 Ga0157372_10256255
393 Ga0157372_10339944
394 Ga0157372_10413616
395 Ga0157375_10106839
396 Ga0157375_10131302
397 Ga0157375_10328032
398 Ga0163163_10014249
399 Ga0157379_10139489
400 Ga0157376_10020436
401 Ga0157376_10187952
402 Ga0157376_10197823
403 Ga0163161_10106084
404 Ga0213872_10003135
405 Ga0213876_10055440
406 Ga0213876_10167557
407 Ga0207680_10012632
408 Ga0207647_10038576
409 Ga0207699_10038616
410 Ga0207705_10008642
411 Ga0207684_10005859
412 Ga0207684_10010210
413 Ga0207695_10000052
414 Ga0207695_10020143
415 Ga0207693_10001731
416 Ga0207663_10007198
417 Ga0207660_10137701
418 Ga0207652_10003767
419 Ga0207652_10144879
420 Ga0207694_10000896
421 Ga0207650_10061228
422 Ga0207659_10083087
423 Ga0207700_10003049
424 Ga0207700_10046874
425 Ga0207700_10237000
426 Ga0207664_10038257
427 Ga0207664_10231207
428 Ga0207704_10187238
429 Ga0207665_10049480
430 Ga0207691_10085897
431 Ga0207711_10063933
432 Ga0207711_10233011
433 Ga0207661_10054742
434 Ga0207679_10086623
435 Ga0207667_10000302
436 Ga0207667_10000518
437 Ga0207667_10002600
438 Ga0207667_10048132
439 Ga0207667_10216571
440 Ga0207668_10071179
441 Ga0207640_10016445
442 Ga0207640_10481349
443 Ga0207658_10097781
444 Ga0207677_10025585
445 Ga0207677_10036187
446 Ga0207703_10019211
447 Ga0207703_10191778
448 Ga0207639_10027263
449 Ga0207639_10139668
450 Ga0207639_10144486
451 Ga0207702_10000120
452 Ga0207702_10023792
453 Ga0207702_10096976
454 Ga0207641_10035616
455 Ga0207641_10246149
456 Ga0207648_10189655
457 Ga0207648_10336963
458 Ga0207676_10084472
459 Ga0207674_10031652
460 Ga0207675_100000081
461 Ga0207675_100087260
462 Ga0207683_10003608
463 Ga0207698_10000007
464 Ga0207698_10018945
465 Ga0207698_10056276
466 Ga0207698_10092557
467 Ga0207698_10320247
468 Ga0209813_10043623
469 Ga0207428_10001085
470 Ga0268266_10106482
471 Ga0265338_10015731
472 Ga0265762_1017752
473 Ga0265765_1000551
474 Ga0265330_10029138
475 Ga0265325_10003215
476 Ga0265339_10013789
477 Ga0265339_10108019
478 Ga0265316_10003088
479 Ga0265313_10018532
480 Ga0265314_10009773
481 Ga0265314_10053672
482 Ga0265342_10004570
483 Ga0373936_0001465
484 Ga0373945_0031006
485 Ga0373946_0058353
486 Ga0373947_0008064
487 Ga0373937_0040732
488 Ga0436364_1215266
489 Ga0436364_1461680
490 Ga0436365_0486244
491 Ga0436365_0565678
492 Ga0436365_1710907
493 Ga0436360_0252808
494 Ga0436361_0116595
495 Ga0436361_0791915
496 Ga0436361_0982317
497 Ga0436362_0534567
498 Ga0436362_0636385
499 Ga0453683_0089125
500 Ga0466963_0104668
501 Ga0466959_0062720
502 Ga0466967_0146954
503 Ga0495592_0159080
504 Ga0495629_0006688
505 Ga0495580_0000390
506 Ga0495580_0106269
507 Ga0495582_0076380
508 Ga0495630_0077598
509 Ga0495652_0253786
510 Ga0495587_0003114
511 Ga0495645_0100363
512 Ga0495599_0036590
513 Ga0495658_0005225
514 Ga0495674_0021138
515 Ga0495680_0071487
516 Ga0495602_0028185
517 Ga0496101_0156622
518 Ga0496106_0038784
519 Ga0496106_0087128
520 Ga0496107_0167906
521 Ga0496112_0004054
522 Ga0496112_0162211
523 Ga0496114_0065441
524 Ga0496115_0076414
525 nmdc:mga0yw44_17248_c1
526 nmdc:mga0k408_795_c1
527 nmdc:mga06z11_4893_c2
528 nmdc:mga06z11_51046_c1
529 nmdc:mga06z11_7667_c1
530 nmdc:mga04h51_52322_c1
531 nmdc:mga07m45_11083_c1
532 nmdc:mga07m45_8766_c1
533 nmdc:mga05p37_73841_c1
534 nmdc:mga09592_326178_c1
535 nmdc:mga09592_339988_c1
536 nmdc:mga06r32_526036_c1
537 nmdc:mga08y16_654_c1
538 nmdc:mga08x19_191453_c1
539 nmdc:mga0a205_16749_c1
540 nmdc:mga0a205_9305_c1
541 Ga0495601_0044134
542 Ga0495619_0203795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qz4-assembly2.cif.gz_B crystal structure of an endo-1,4-beta-xylanase d (bt_3675) from bacteroides thetaiotaomicron vpi-5482 at 1.74 a resolution 0.7122 30 335
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.7062 30 323
3qef-assembly1.cif.gz_A the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.7008 30 323
4nov-assembly1.cif.gz_A xsa43e, a gh43 family enzyme from butyrivibrio proteoclasticus 0.6878 11 323
3qz4-assembly2.cif.gz_B crystal structure of an endo-1,4-beta-xylanase d (bt_3675) from bacteroides thetaiotaomicron vpi-5482 at 1.74 a resolution 0.6765 30 335
ID Description Score Start End Superfamily
af_K7N4E5_123_231_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7573 168 269 2.115.10.20
3qz4B00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7208 30 335 2.115.10.20
af_Q93ZE3_64_156_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7125 156 216 2.115.10.20
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.6961 30 323 2.115.10.20
3qz4B00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.6839 30 335 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A5M8S520-F1-model_v4 Uncharacterized protein 0.9474 1 342
AF-A0A5M8S520-F1-model_v4 Uncharacterized protein 0.9284 1 342
AF-A0A4P6JJP2-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.9151 9 330
AF-A0A4R2R914-F1-model_v4 BNR repeat neuraminidase 0.9068 13 332
AF-A0A4V6PCP8-F1-model_v4 Glycosyl hydrolase family 43 0.8907 9 331

Map