F377247

General Info

Members Datasets Scaffolds Average Seq Length
270 173 259 462

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0163994|Ga0501047_0163994_269_1879
Length 536
Sequence MVVIPDVRGSGFVSGSRIRKYSHQTIQPSDNARIGEYIAVPYQRAVYNISLVASKTKKVYMKKVVAAVVMFCCLWHTVTAQTSVKETKEAHDKRMEWWREARFGMFIHWGVYAVPAGYYNGQPINRIGEWIMNRGKIPVAEYQEFAKQFNPTKYDADAWVKMAKDAGMKYIVITAKHHDGFALFKSNASKWNMADATPYGKDLLKPLAEACRKYGIKLGFYYSQAQDWNNPGGAAARKVASEGWANPDSAKIDAYTAAHEGHWDPAQTTKTMAQYIDDVAVPQVKELLTNYGDVAVLWWDTPTGMTDEFAGKLNAALALQPNIITNDRLKRPDFPGDYKTPEQRIPKESELDGKDWETCMTMNGTWGYKKDDHNWKSTETIIRNLLDIASKGGNYLLNVGPKADGTFPDESIERLKQVGAWMKVNGEAIYDTKASPLPALAWGRCTKKEQKGNTILYLSVFDWPADKKLVVPGLTQPVISATLLAGNKKLATSASKEGVVITLPEQAPDKIASVIKLEVKGKVEDRRFTGAGASGL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
10 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
154 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
173 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 0
Rhizoplane 0
Rhizosphere 76.67
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003055 3300001979 Bacteria 7401
2 JGI24735J21928_10003467 3300002067 Bacteria 5371
3 JGI25154J39366_1000031 3300002738 Bacteria 190814
4 rootH2_10042475 3300003320 Bacteria 12139
5 rootL2_10075662 3300003322 Bacteria 3475
6 rootL2_10215643 3300003322 Bacteria 3039
7 rootH1_10039754 3300003323 Bacteria 16817
8 rootH1_10079307 3300003323 Bacteria 4650
9 Ga0055528_1000180 3300003790 Bacteria 53597
10 Ga0055543_1003696 3300004625 Bacteria 4395
11 Ga0065165_1000019 3300005262 Bacteria 271815
12 Ga0065165_1026187 3300005262 Bacteria 1923
13 Ga0065714_10015648 3300005288 Bacteria 2087
14 Ga0065712_10000474 3300005290 Bacteria 14806
15 Ga0070670_100163457 3300005331 Bacteria 1930
16 Ga0070666_10000728 3300005335 Bacteria 19966
17 Ga0070660_100057122 3300005339 Bacteria 3022
18 Ga0070668_100066349 3300005347 Bacteria 2801
19 Ga0070669_100177578 3300005353 Bacteria 1664
20 Ga0070675_100201867 3300005354 Bacteria 1726
21 Ga0070671_100060243 3300005355 Bacteria 3160
22 Ga0070674_100012119 3300005356 Bacteria 5284
23 Ga0070659_100000436 3300005366 Bacteria 31452
24 Ga0070659_100003226 3300005366 Bacteria 11613
25 Ga0070659_100009717 3300005366 Bacteria 7067
26 Ga0070700_100041098 3300005441 Bacteria 2834
27 Ga0068867_100048745 3300005459 Bacteria 3117
28 Ga0070686_100111083 3300005544 Bacteria 1868
29 Ga0070665_100000093 3300005548 Bacteria 173153
30 Ga0068855_100005863 3300005563 Bacteria 14992
31 Ga0068855_100029796 3300005563 Bacteria 6526
32 Ga0070664_100019441 3300005564 Bacteria 5588
33 Ga0068857_100002056 3300005577 Bacteria 16345
34 Ga0068854_100020468 3300005578 Bacteria 4477
35 Ga0068852_100009163 3300005616 Bacteria 7332
36 Ga0068859_100000030 3300005617 Bacteria 175435
37 Ga0068859_100017421 3300005617 Bacteria 7220
38 Ga0068864_100179300 3300005618 Bacteria 1936
39 Ga0068861_100036846 3300005719 Bacteria 3633
40 Ga0068863_100017101 3300005841 Bacteria 6957
41 Ga0068863_100040603 3300005841 Bacteria 4424
42 Ga0068858_100015096 3300005842 Bacteria 7264
43 Ga0068860_100000006 3300005843 Bacteria 461966
44 Ga0068860_100003675 3300005843 Bacteria 15789
45 Ga0075366_10000514 3300006195 Bacteria 17870
46 Ga0097621_100003096 3300006237 Bacteria 11411
47 Ga0097621_100087570 3300006237 Bacteria 2601
48 Ga0097621_100185204 3300006237 Bacteria 1801
49 Ga0068871_100136294 3300006358 Bacteria 2085
50 Ga0075430_100069833 3300006846 Bacteria 2946
51 Ga0097620_100000030 3300006931 Bacteria 175435
52 Ga0097620_100017421 3300006931 Bacteria 7220
53 Ga0105240_10000095 3300009093 Bacteria 180935
54 Ga0105240_10000155 3300009093 Bacteria 140485
55 Ga0105240_10023766 3300009093 Bacteria 8097
56 Ga0105247_10020790 3300009101 Bacteria 3947
57 Ga0114129_10004260 3300009147 Bacteria 20220
58 Ga0105241_10011235 3300009174 Bacteria 6565
59 Ga0105242_10000764 3300009176 Bacteria 25007
60 Ga0105242_10048378 3300009176 Bacteria 3456
61 Ga0105248_10254746 3300009177 Bacteria 1975
62 Ga0105237_10000061 3300009545 Bacteria 146107
63 Ga0105237_10004448 3300009545 Bacteria 16226
64 Ga0105237_10005050 3300009545 Bacteria 15013
65 Ga0105237_10008035 3300009545 Bacteria 11477
66 Ga0105237_10009012 3300009545 Bacteria 10728
67 Ga0105237_10018746 3300009545 Bacteria 7156
68 Ga0105238_10003635 3300009551 Bacteria 15374
69 Ga0105238_10106491 3300009551 Bacteria 2785
70 Ga0105249_10000878 3300009553 Bacteria 26707
71 Ga0105249_10069121 3300009553 Bacteria 3259
72 Ga0105239_10000083 3300010375 Bacteria 132046
73 Ga0105239_10001893 3300010375 Bacteria 27361
74 Ga0105239_10012672 3300010375 Bacteria 9381
75 Ga0105239_10013276 3300010375 Bacteria 9154
76 Ga0105239_10097021 3300010375 Bacteria 3257
77 Ga0105246_10010380 3300011119 Bacteria 5761
78 Ga0157371_10000617 3300013102 Bacteria 42318
79 Ga0157371_10001565 3300013102 Bacteria 23529
80 Ga0157371_10015737 3300013102 Bacteria 5662
81 Ga0157370_10049975 3300013104 Bacteria 3998
82 Ga0157369_10000439 3300013105 Bacteria 55404
83 Ga0157374_10000003 3300013296 Bacteria 854471
84 Ga0157378_10040268 3300013297 Bacteria 4143
85 Ga0163162_10000348 3300013306 Bacteria 42027
86 Ga0163162_10000476 3300013306 Bacteria 37123
87 Ga0163162_10001042 3300013306 Bacteria 25777
88 Ga0157372_10000087 3300013307 Bacteria 95840
89 Ga0157372_10000483 3300013307 Bacteria 44004
90 Ga0157372_10030628 3300013307 Bacteria 5887
91 Ga0157375_10133357 3300013308 Bacteria 2605
92 Ga0163163_10084356 3300014325 Bacteria 3183
93 Ga0157377_10007253 3300014745 Bacteria 5343
94 Ga0157379_10058292 3300014968 Bacteria 3452
95 Ga0157376_10000351 3300014969 Bacteria 30762
96 Ga0157376_10002527 3300014969 Bacteria 12400
97 Ga0157376_10013959 3300014969 Bacteria 6010
98 Ga0163161_10005800 3300017792 Bacteria 8563
99 Ga0163161_10008811 3300017792 Bacteria 6975
100 Ga0209646_1000009 3300025246 Bacteria 652154
101 Ga0209646_1003977 3300025246 Bacteria 2788
102 Ga0209026_1000258 3300025250 Bacteria 65976
103 Ga0209233_1000659 3300025261 Bacteria 16690
104 Ga0209673_1000042 3300025273 Bacteria 300704
105 Ga0209564_1001966 3300025295 Bacteria 18095
106 Ga0209564_1003438 3300025295 Bacteria 10834
107 Ga0209758_1003644 3300025297 Bacteria 13740
108 Ga0209758_1004920 3300025297 Bacteria 10738
109 Ga0209758_1008987 3300025297 Bacteria 6319
110 Ga0209050_1000308 3300025298 Bacteria 99516
111 Ga0209050_1020811 3300025298 Bacteria 2422
112 Ga0207426_1000175 3300025302 Bacteria 160332
113 Ga0207426_1000243 3300025302 Bacteria 122575
114 Ga0207426_1008024 3300025302 Bacteria 4331
115 Ga0207426_1016505 3300025302 Bacteria 2650
116 Ga0209257_1001059 3300025304 Bacteria 36382
117 Ga0207680_10000415 3300025903 Bacteria 20318
118 Ga0207647_10000043 3300025904 Bacteria 91109
119 Ga0207647_10002370 3300025904 Bacteria 14319
120 Ga0207645_10033905 3300025907 Bacteria 3281
121 Ga0207645_10048137 3300025907 Bacteria 2722
122 Ga0207654_10042288 3300025911 Bacteria 2578
123 Ga0207654_10092498 3300025911 Bacteria 1847
124 Ga0207695_10000043 3300025913 Bacteria 444585
125 Ga0207695_10000165 3300025913 Bacteria 195908
126 Ga0207695_10056367 3300025913 Bacteria 4089
127 Ga0207671_10000542 3300025914 Bacteria 50975
128 Ga0207671_10000874 3300025914 Bacteria 38160
129 Ga0207671_10003416 3300025914 Bacteria 15871
130 Ga0207671_10007785 3300025914 Bacteria 9225
131 Ga0207671_10054222 3300025914 Bacteria 2971
132 Ga0207671_10066904 3300025914 Bacteria 2675
133 Ga0207662_10009588 3300025918 Bacteria 5334
134 Ga0207694_10070031 3300025924 Bacteria 2740
135 Ga0207650_10030120 3300025925 Bacteria 3906
136 Ga0207644_10043958 3300025931 Bacteria 3172
137 Ga0207690_10000244 3300025932 Bacteria 39487
138 Ga0207690_10002837 3300025932 Bacteria 10451
139 Ga0207690_10065736 3300025932 Bacteria 2481
140 Ga0207686_10000843 3300025934 Bacteria 18616
141 Ga0207670_10007777 3300025936 Bacteria 6013
142 Ga0207704_10100225 3300025938 Bacteria 1929
143 Ga0207689_10002909 3300025942 Bacteria 15810
144 Ga0207667_10004106 3300025949 Bacteria 17891
145 Ga0207712_10000496 3300025961 Bacteria 32480
146 Ga0207712_10040178 3300025961 Bacteria 3209
147 Ga0207712_10086722 3300025961 Bacteria 2294
148 Ga0207668_10139698 3300025972 Bacteria 1861
149 Ga0207640_10014717 3300025981 Bacteria 4510
150 Ga0207702_10174414 3300026078 Bacteria 1974
151 Ga0207641_10000013 3300026088 Bacteria 341378
152 Ga0207641_10005131 3300026088 Bacteria 11217
153 Ga0207641_10115413 3300026088 Bacteria 2387
154 Ga0207648_10001512 3300026089 Bacteria 25627
155 Ga0207648_10086104 3300026089 Bacteria 2741
156 Ga0207648_10153303 3300026089 Bacteria 2034
157 Ga0207676_10060105 3300026095 Bacteria 3004
158 Ga0207676_10070601 3300026095 Bacteria 2801
159 Ga0207674_10007940 3300026116 Bacteria 12318
160 Ga0207674_10153732 3300026116 Unclassified 2257
161 Ga0207675_100023437 3300026118 Bacteria 5741
162 Ga0207675_100029815 3300026118 Bacteria 5079
163 Ga0207683_10150155 3300026121 Bacteria 2103
164 Ga0207683_10240903 3300026121 Bacteria 1650
165 Ga0207698_10001975 3300026142 Bacteria 12069
166 Ga0207698_10087493 3300026142 Bacteria 2538
167 Ga0268266_10000060 3300028379 Bacteria 269063
168 Ga0268264_10000175 3300028381 Bacteria 136178
169 Ga0268264_10002768 3300028381 Bacteria 15293
170 Ga0268264_10073510 3300028381 Bacteria 2902
171 Ga0307517_10000129 3300028786 Bacteria 114359
172 Ga0307515_10000001 3300028794 Bacteria 4259510
173 Ga0307515_10000016 3300028794 Bacteria 554870
174 Ga0307515_10001828 3300028794 Bacteria 47434
175 Ga0307513_10023098 3300031456 Bacteria 7278
176 Ga0307509_10042880 3300031507 Bacteria 4899
177 Ga0307509_10100581 3300031507 Bacteria 2929
178 Ga0307508_10001155 3300031616 Bacteria 30353
179 Ga0307514_10164196 3300031649 Bacteria 1464
180 Ga0307507_10071272 3300033179 Bacteria 3144
181 Ga0307510_10000107 3300033180 Bacteria 65945
182 Ga0395899_0000204 3300037312 Bacteria 87147
183 Ga0436365_1576427 3300039437 Bacteria 11885
184 Ga0451853_3423511 3300041512 Bacteria 2433
185 Ga0439462_0028735 3300042015 Bacteria 1470
186 Ga0451577_0002794 3300042876 Bacteria 20144
187 Ga0451577_0009418 3300042876 Bacteria 9413
188 Ga0466969_0000151 3300044656 Bacteria 37632
189 Ga0466972_0000007 3300044658 Bacteria 277010
190 Ga0466972_0000024 3300044658 Bacteria 187985
191 Ga0466972_0012755 3300044658 Bacteria 4219
192 Ga0466972_0017413 3300044658 Bacteria 3597
193 Ga0453683_0000015 3300044673 Bacteria 346024
194 Ga0453683_0001066 3300044673 Bacteria 25472
195 Ga0453683_0055339 3300044673 Bacteria 2483
196 Ga0466966_0000113 3300044684 Bacteria 49984
197 Ga0466966_0036002 3300044684 Bacteria 3197
198 Ga0453684_0000651 3300044712 Bacteria 125123
199 Ga0453684_0001742 3300044712 Bacteria 58225
200 Ga0453684_0084910 3300044712 Bacteria 3936
201 Ga0466970_0000827 3300044765 Bacteria 14871
202 Ga0466957_0001218 3300044842 Bacteria 13420
203 Ga0466957_0006376 3300044842 Bacteria 6659
204 Ga0466959_0000015 3300045049 Bacteria 149242
205 Ga0466959_0087907 3300045049 Bacteria 2235
206 Ga0451576_0000080 3300045051 Bacteria 242782
207 Ga0451576_0001351 3300045051 Bacteria 42332
208 Ga0451576_0001982 3300045051 Bacteria 32524
209 Ga0451576_0002811 3300045051 Bacteria 25096
210 Ga0466958_0019565 3300045836 Bacteria 3943
211 Ga0495638_0000003 3300046460 Bacteria 888792
212 Ga0495638_0026453 3300046460 Bacteria 3760
213 Ga0495585_0019814 3300046492 Bacteria 3874
214 Ga0495606_0003277 3300046507 Bacteria 17347
215 Ga0495648_0001625 3300046524 Bacteria 21826
216 Ga0495648_0006172 3300046524 Bacteria 9818
217 Ga0495609_0007731 3300046538 Bacteria 5328
218 Ga0495622_0034305 3300046557 Bacteria 2367
219 Ga0495668_0000127 3300046616 Bacteria 114097
220 Ga0495611_0000025 3300046648 Bacteria 118583
221 Ga0495625_0000175 3300046660 Bacteria 99386
222 Ga0495625_0000993 3300046660 Bacteria 37558
223 Ga0495625_0035019 3300046660 Bacteria 3703
224 Ga0495625_0051777 3300046660 Bacteria 2942
225 Ga0495625_0089767 3300046660 Bacteria 2127
226 Ga0495674_0045325 3300047319 Bacteria 3905
227 Ga0495683_0011355 3300047323 Bacteria 4690
228 Ga0495686_0012399 3300047472 Bacteria 5963
229 Ga0495686_0055024 3300047472 Bacteria 2490
230 Ga0501298_005377 3300049521 Bacteria 2053
231 Ga0501047_0163994 3300049581 Bacteria 2093
232 Ga0501198_000398 3300049649 Bacteria 5392
233 Ga0501207_000246 3300049654 Bacteria 5538
234 Ga0501224_001231 3300049664 Bacteria 3364
235 Ga0501243_000477 3300049675 Bacteria 5319
236 Ga0501247_000162 3300049677 Bacteria 4132
237 Ga0501221_001150 3300049704 Bacteria 4364
238 Ga0501225_0002509 3300049705 Bacteria 5680
239 Ga0501225_0003561 3300049705 Bacteria 4697
240 Ga0501234_001486 3300049707 Bacteria 3688
241 Ga0501264_000022 3300049761 Bacteria 24436
242 Ga0501044_0046134 3300049823 Bacteria 4513
243 nmdc:mga0k408_570_c1 3300050493 Bacteria 20339
244 nmdc:mga05p37_2426_c2 3300050507 Bacteria 15408
245 Ga0500635_0000519 3300053080 Bacteria 10598
246 Ga0500578_0000457 3300053086 Bacteria 49613
247 Ga0500646_0001774 3300053090 Bacteria 5681
248 Ga0500583_0000028 3300053092 Bacteria 108276
249 Ga0500583_0030523 3300053092 Bacteria 2362
250 Ga0500583_0053056 3300053092 Unclassified 1889
251 Ga0500618_000036 3300053125 Bacteria 118803
252 Ga0500652_007386 3300053131 Bacteria 3597
253 Ga0500568_0001696 3300053139 Bacteria 13743
254 Ga0500588_0004714 3300053146 Bacteria 2972
255 Ga0500616_0018756 3300053153 Bacteria 3909
256 Ga0500622_0000004 3300053156 Bacteria 557587
257 Ga0500622_0028499 3300053156 Unclassified 2940
258 Ga0500622_0091016 3300053156 Bacteria 1514
259 Ga0500611_000066 3300053727 Bacteria 42948

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10056367 Ga0207695_100563672 390
2 3300013308 Ga0157375_10133357 Ga0157375_101333571 418
3 3300053156 Ga0500622_0091016 Ga0500622_0091016_28_1338 418
4 3300005355 Ga0070671_100060243 Ga0070671_1000602432 420
5 3300005544 Ga0070686_100111083 Ga0070686_1001110831 420
6 3300006237 Ga0097621_100185204 Ga0097621_1001852041 420
7 3300025907 Ga0207645_10033905 Ga0207645_100339052 420
8 3300025918 Ga0207662_10009588 Ga0207662_100095884 420
9 3300025931 Ga0207644_10043958 Ga0207644_100439582 420
10 3300026089 Ga0207648_10086104 Ga0207648_100861042 420
11 3300026121 Ga0207683_10150155 Ga0207683_101501552 420
12 3300046660 Ga0495625_0035019 Ga0495625_0035019_1963_3390 424
13 3300005288 Ga0065714_10015648 Ga0065714_100156482 426
14 3300046660 Ga0495625_0051777 Ga0495625_0051777_41_1468 426
15 3300005353 Ga0070669_100177578 Ga0070669_1001775781 427
16 3300009551 Ga0105238_10106491 Ga0105238_101064912 428
17 3300025924 Ga0207694_10070031 Ga0207694_100700312 428
18 3300042015 Ga0439462_0028735 Ga0439462_0028735_13_1341 428
19 3300010375 Ga0105239_10012672 Ga0105239_100126723 429
20 3300031456 Ga0307513_10023098 Ga0307513_100230982 429
21 3300044842 Ga0466957_0001218 Ga0466957_0001218_3858_5285 429
22 3300009093 Ga0105240_10000155 Ga0105240_1000015527 430
23 3300025913 Ga0207695_10000043 Ga0207695_1000004343 430
24 3300046660 Ga0495625_0089767 Ga0495625_0089767_491_1918 431
25 3300049675 Ga0501243_000477 Ga0501243_000477_1624_2940 431
26 3300053153 Ga0500616_0018756 Ga0500616_0018756_1369_2751 431
27 3300009551 Ga0105238_10003635 Ga0105238_100036352 433
28 3300025911 Ga0207654_10042288 Ga0207654_100422882 433
29 3300026078 Ga0207702_10174414 Ga0207702_101744142 433
30 3300044658 Ga0466972_0012755 Ga0466972_0012755_1551_2915 433
31 3300053727 Ga0500611_000066 Ga0500611_000066_26867_28291 433
32 3300006195 Ga0075366_10000514 Ga0075366_1000051410 436
33 3300028786 Ga0307517_10000129 Ga0307517_1000012965 436
34 3300042876 Ga0451577_0002794 Ga0451577_0002794_1947_3380 436
35 3300044712 Ga0453684_0000651 Ga0453684_0000651_70166_71599 436
36 3300045051 Ga0451576_0000080 Ga0451576_0000080_89214_90647 436
37 3300046660 Ga0495625_0000993 Ga0495625_0000993_4973_6400 436
38 3300050493 nmdc:mga0k408_570_c1 nmdc:mga0k408_570_c1_3479_4906 436
39 3300046460 Ga0495638_0026453 Ga0495638_0026453_1561_2934 437
40 3300046524 Ga0495648_0001625 Ga0495648_0001625_17622_18995 437
41 3300053092 Ga0500583_0053056 Ga0500583_0053056_330_1703 437
42 3300053156 Ga0500622_0028499 Ga0500622_0028499_212_1585 437
43 3300002067 JGI24735J21928_10003467 JGI24735J21928_100034672 439
44 3300005366 Ga0070659_100009717 Ga0070659_1000097173 439
45 3300005577 Ga0068857_100002056 Ga0068857_1000020564 439
46 3300013102 Ga0157371_10000617 Ga0157371_100006178 439
47 3300013104 Ga0157370_10049975 Ga0157370_100499752 439
48 3300013307 Ga0157372_10000483 Ga0157372_100004834 439
49 3300025261 Ga0209233_1000659 Ga0209233_100065910 439
50 3300025904 Ga0207647_10000043 Ga0207647_100000433 439
51 3300025932 Ga0207690_10002837 Ga0207690_100028375 439
52 3300026116 Ga0207674_10007940 Ga0207674_100079407 439
53 3300046492 Ga0495585_0019814 Ga0495585_0019814_535_1962 441
54 3300046524 Ga0495648_0006172 Ga0495648_0006172_3302_4729 441
55 3300046538 Ga0495609_0007731 Ga0495609_0007731_288_1715 441
56 3300046557 Ga0495622_0034305 Ga0495622_0034305_776_2203 441
57 3300046616 Ga0495668_0000127 Ga0495668_0000127_10901_12328 441
58 3300046660 Ga0495625_0000175 Ga0495625_0000175_30460_31887 441
59 3300053125 Ga0500618_000036 Ga0500618_000036_70616_72043 441
60 3300009545 Ga0105237_10000061 Ga0105237_1000006161 442
61 3300025914 Ga0207671_10003416 Ga0207671_100034161 442
62 3300033180 Ga0307510_10000107 Ga0307510_1000010736 442
63 3300047323 Ga0495683_0011355 Ga0495683_0011355_1891_3318 442
64 3300009545 Ga0105237_10005050 Ga0105237_100050504 443
65 3300010375 Ga0105239_10097021 Ga0105239_100970213 443
66 3300013102 Ga0157371_10001565 Ga0157371_1000156514 443
67 3300005366 Ga0070659_100000436 Ga0070659_10000043616 444
68 3300005616 Ga0068852_100009163 Ga0068852_1000091633 444
69 3300025904 Ga0207647_10002370 Ga0207647_100023704 444
70 3300025932 Ga0207690_10065736 Ga0207690_100657362 444
71 3300026142 Ga0207698_10001975 Ga0207698_100019753 444
72 3300031507 Ga0307509_10100581 Ga0307509_101005812 444
73 3300026121 Ga0207683_10240903 Ga0207683_102409031 445
74 3300044673 Ga0453683_0055339 Ga0453683_0055339_660_2036 445
75 3300045051 Ga0451576_0002811 Ga0451576_0002811_4457_5833 445
76 3300046648 Ga0495611_0000025 Ga0495611_0000025_95535_96914 445
77 3300049823 Ga0501044_0046134 Ga0501044_0046134_2721_4121 445
78 3300003320 rootH2_10042475 rootH2_100424754 446
79 3300013297 Ga0157378_10040268 Ga0157378_100402683 446
80 3300014745 Ga0157377_10007253 Ga0157377_100072533 446
81 3300031616 Ga0307508_10001155 Ga0307508_1000115514 446
82 3300041512 Ga0451853_3423511 Ga0451853_3423511_563_1999 446
83 3300013105 Ga0157369_10000439 Ga0157369_1000043910 447
84 3300028794 Ga0307515_10000016 Ga0307515_10000016448 447
85 3300031649 Ga0307514_10164196 Ga0307514_101641961 447
86 3300053131 Ga0500652_007386 Ga0500652_007386_1309_2733 447
87 3300028794 Ga0307515_10001828 Ga0307515_1000182818 448
88 3300053090 Ga0500646_0001774 Ga0500646_0001774_792_2231 448
89 iso_pu_bacteria 2896109856 2896111000 448
90 3300005617 Ga0068859_100017421 Ga0068859_1000174214 449
91 3300006931 Ga0097620_100017421 Ga0097620_1000174214 449
92 3300010375 Ga0105239_10013276 Ga0105239_100132762 449
93 3300013296 Ga0157374_10000003 Ga0157374_10000003469 449
94 3300014969 Ga0157376_10000351 Ga0157376_100003513 449
95 3300025250 Ga0209026_1000258 Ga0209026_100025857 449
96 3300025972 Ga0207668_10139698 Ga0207668_101396981 449
97 3300044656 Ga0466969_0000151 Ga0466969_0000151_9802_11220 449
98 3300044684 Ga0466966_0000113 Ga0466966_0000113_16027_17445 449
99 3300045049 Ga0466959_0000015 Ga0466959_0000015_22840_24258 449
100 3300005331 Ga0070670_100163457 Ga0070670_1001634572 450
101 3300009147 Ga0114129_10004260 Ga0114129_1000426017 450
102 3300044684 Ga0466966_0036002 Ga0466966_0036002_404_1825 450
103 3300045049 Ga0466959_0087907 Ga0466959_0087907_426_1847 450
104 3300045836 Ga0466958_0019565 Ga0466958_0019565_2012_3433 450
105 3300050507 nmdc:mga05p37_2426_c2 nmdc:mga05p37_2426_c2_11078_12508 450
106 3300005459 Ga0068867_100048745 Ga0068867_1000487452 451
107 3300005578 Ga0068854_100020468 Ga0068854_1000204682 451
108 3300009176 Ga0105242_10048378 Ga0105242_100483782 451
109 3300009545 Ga0105237_10004448 Ga0105237_100044489 451
110 3300025907 Ga0207645_10048137 Ga0207645_100481371 451
111 3300025914 Ga0207671_10000542 Ga0207671_1000054261 451
112 3300025914 Ga0207671_10000874 Ga0207671_1000087423 451
113 3300025981 Ga0207640_10014717 Ga0207640_100147172 451
114 3300026089 Ga0207648_10001512 Ga0207648_100015123 451
115 3300026116 Ga0207674_10153732 Ga0207674_101537321 451
116 3300049705 Ga0501225_0003561 Ga0501225_0003561_78_1499 451
117 3300049707 Ga0501234_001486 Ga0501234_001486_1028_2455 451
118 iso_pu_bacteria 2883068021 2883068539 451
119 iso_pu_bacteria 2884791551 2884797520 451
120 iso_pu_bacteria 2929177148 2929183405 451
121 iso_pu_bacteria 2945977869 2945979365 451
122 iso_pu_bacteria 2946013367 2946014764 451
123 3300003323 rootH1_10039754 rootH1_100397541 452
124 3300005563 Ga0068855_100029796 Ga0068855_1000297962 452
125 3300009093 Ga0105240_10023766 Ga0105240_100237662 452
126 3300009545 Ga0105237_10009012 Ga0105237_100090128 452
127 3300010375 Ga0105239_10000083 Ga0105239_1000008345 452
128 3300025914 Ga0207671_10066904 Ga0207671_100669042 452
129 3300053092 Ga0500583_0000028 Ga0500583_0000028_10681_12120 452
130 iso_pu_bacteria 2738541278 2738724356 452
131 iso_pu_bacteria 2818991460 2819677602 452
132 3300003322 rootL2_10215643 rootL2_102156432 453
133 3300005356 Ga0070674_100012119 Ga0070674_1000121191 453
134 3300047319 Ga0495674_0045325 Ga0495674_0045325_1651_3057 453
135 iso_pu_bacteria 2919437846 2919438826 453
136 iso_pu_bacteria 2929921140 2929924651 453
137 iso_pu_bacteria 8003151029 8003157086 453
138 3300005262 Ga0065165_1026187 Ga0065165_10261872 454
139 3300009093 Ga0105240_10000095 Ga0105240_1000009532 454
140 3300014325 Ga0163163_10084356 Ga0163163_100843561 454
141 3300025302 Ga0207426_1000175 Ga0207426_100017563 454
142 3300025913 Ga0207695_10000165 Ga0207695_1000016548 454
143 3300044673 Ga0453683_0000015 Ga0453683_0000015_50992_52422 454
144 3300044712 Ga0453684_0084910 Ga0453684_0084910_897_2333 454
145 3300046507 Ga0495606_0003277 Ga0495606_0003277_4585_6030 454
146 3300053092 Ga0500583_0030523 Ga0500583_0030523_701_2143 454
147 3300005290 Ga0065712_10000474 Ga0065712_1000047411 455
148 3300005719 Ga0068861_100036846 Ga0068861_1000368462 455
149 3300009177 Ga0105248_10254746 Ga0105248_102547462 455
150 3300009553 Ga0105249_10000878 Ga0105249_1000087820 455
151 3300017792 Ga0163161_10005800 Ga0163161_100058004 455
152 3300025246 Ga0209646_1003977 Ga0209646_10039773 455
153 3300025302 Ga0207426_1000243 Ga0207426_100024340 455
154 3300025936 Ga0207670_10007777 Ga0207670_100077772 455
155 3300025961 Ga0207712_10000496 Ga0207712_1000049622 455
156 3300026118 Ga0207675_100029815 Ga0207675_1000298153 455
157 3300028381 Ga0268264_10073510 Ga0268264_100735102 455
158 3300053146 Ga0500588_0004714 Ga0500588_0004714_819_2198 455
159 3300003323 rootH1_10079307 rootH1_100793075 456
160 3300005335 Ga0070666_10000728 Ga0070666_1000072810 456
161 3300005347 Ga0070668_100066349 Ga0070668_1000663492 456
162 3300005441 Ga0070700_100041098 Ga0070700_1000410982 456
163 3300005548 Ga0070665_100000093 Ga0070665_10000009386 456
164 3300005617 Ga0068859_100000030 Ga0068859_10000003037 456
165 3300005618 Ga0068864_100179300 Ga0068864_1001793002 456
166 3300005841 Ga0068863_100017101 Ga0068863_1000171013 456
167 3300005841 Ga0068863_100040603 Ga0068863_1000406032 456
168 3300005842 Ga0068858_100015096 Ga0068858_1000150964 456
169 3300005843 Ga0068860_100000006 Ga0068860_100000006237 456
170 3300005843 Ga0068860_100003675 Ga0068860_1000036755 456
171 3300006237 Ga0097621_100003096 Ga0097621_1000030963 456
172 3300006237 Ga0097621_100087570 Ga0097621_1000875701 456
173 3300006358 Ga0068871_100136294 Ga0068871_1001362942 456
174 3300006846 Ga0075430_100069833 Ga0075430_1000698331 456
175 3300006931 Ga0097620_100000030 Ga0097620_100000030108 456
176 3300009101 Ga0105247_10020790 Ga0105247_100207902 456
177 3300009174 Ga0105241_10011235 Ga0105241_100112353 456
178 3300009176 Ga0105242_10000764 Ga0105242_1000076410 456
179 3300009545 Ga0105237_10008035 Ga0105237_100080357 456
180 3300009553 Ga0105249_10069121 Ga0105249_100691211 456
181 3300011119 Ga0105246_10010380 Ga0105246_100103802 456
182 3300013306 Ga0163162_10000348 Ga0163162_1000034819 456
183 3300013306 Ga0163162_10000476 Ga0163162_1000047616 456
184 3300013306 Ga0163162_10001042 Ga0163162_100010422 456
185 3300014968 Ga0157379_10058292 Ga0157379_100582921 456
186 3300014969 Ga0157376_10002527 Ga0157376_100025276 456
187 3300014969 Ga0157376_10013959 Ga0157376_100139592 456
188 3300017792 Ga0163161_10008811 Ga0163161_100088113 456
189 3300025297 Ga0209758_1008987 Ga0209758_10089872 456
190 3300025298 Ga0209050_1020811 Ga0209050_10208113 456
191 3300025903 Ga0207680_10000415 Ga0207680_1000041510 456
192 3300025911 Ga0207654_10092498 Ga0207654_100924981 456
193 3300025914 Ga0207671_10007785 Ga0207671_100077852 456
194 3300025934 Ga0207686_10000843 Ga0207686_100008438 456
195 3300025938 Ga0207704_10100225 Ga0207704_101002251 456
196 3300025942 Ga0207689_10002909 Ga0207689_100029099 456
197 3300025961 Ga0207712_10040178 Ga0207712_100401783 456
198 3300025961 Ga0207712_10086722 Ga0207712_100867223 456
199 3300026088 Ga0207641_10000013 Ga0207641_1000001363 456
200 3300026088 Ga0207641_10005131 Ga0207641_100051316 456
201 3300026088 Ga0207641_10115413 Ga0207641_101154132 456
202 3300026089 Ga0207648_10153303 Ga0207648_101533032 456
203 3300026095 Ga0207676_10060105 Ga0207676_100601052 456
204 3300026095 Ga0207676_10070601 Ga0207676_100706012 456
205 3300026118 Ga0207675_100023437 Ga0207675_1000234374 456
206 3300028379 Ga0268266_10000060 Ga0268266_1000006012 456
207 3300028381 Ga0268264_10000175 Ga0268264_1000017517 456
208 3300028381 Ga0268264_10002768 Ga0268264_100027687 456
209 3300028794 Ga0307515_10000001 Ga0307515_100000012999 456
210 3300031507 Ga0307509_10042880 Ga0307509_100428802 456
211 3300033179 Ga0307507_10071272 Ga0307507_100712721 456
212 3300039437 Ga0436365_1576427 Ga0436365_1576427_7503_8924 456
213 3300042876 Ga0451577_0009418 Ga0451577_0009418_6735_8111 456
214 3300044658 Ga0466972_0000007 Ga0466972_0000007_221741_223177 456
215 3300044658 Ga0466972_0000024 Ga0466972_0000024_3901_5283 456
216 3300044658 Ga0466972_0017413 Ga0466972_0017413_247_1686 456
217 3300044673 Ga0453683_0001066 Ga0453683_0001066_4925_6301 456
218 3300044765 Ga0466970_0000827 Ga0466970_0000827_4239_5621 456
219 3300045051 Ga0451576_0001982 Ga0451576_0001982_26168_27544 456
220 3300046460 Ga0495638_0000003 Ga0495638_0000003_869459_870883 456
221 3300047472 Ga0495686_0012399 Ga0495686_0012399_1590_3014 456
222 3300047472 Ga0495686_0055024 Ga0495686_0055024_680_2104 456
223 3300049677 Ga0501247_000162 Ga0501247_000162_2631_4058 456
224 3300049761 Ga0501264_000022 Ga0501264_000022_19398_20825 456
225 3300053086 Ga0500578_0000457 Ga0500578_0000457_20295_21716 456
226 3300053139 Ga0500568_0001696 Ga0500568_0001696_11062_12495 456
227 3300053156 Ga0500622_0000004 Ga0500622_0000004_94297_95724 456
228 3300001979 JGI24740J21852_10003055 JGI24740J21852_100030556 457
229 3300002738 JGI25154J39366_1000031 JGI25154J39366_1000031137 457
230 3300003322 rootL2_10075662 rootL2_100756623 457
231 3300003790 Ga0055528_1000180 Ga0055528_100018011 457
232 3300004625 Ga0055543_1003696 Ga0055543_10036962 457
233 3300005262 Ga0065165_1000019 Ga0065165_1000019160 457
234 3300005339 Ga0070660_100057122 Ga0070660_1000571222 457
235 3300005354 Ga0070675_100201867 Ga0070675_1002018671 457
236 3300005366 Ga0070659_100003226 Ga0070659_1000032263 457
237 3300005563 Ga0068855_100005863 Ga0068855_1000058639 457
238 3300005564 Ga0070664_100019441 Ga0070664_1000194415 457
239 3300009545 Ga0105237_10018746 Ga0105237_100187464 457
240 3300010375 Ga0105239_10001893 Ga0105239_100018933 457
241 3300013102 Ga0157371_10015737 Ga0157371_100157374 457
242 3300013307 Ga0157372_10000087 Ga0157372_1000008749 457
243 3300013307 Ga0157372_10030628 Ga0157372_100306282 457
244 3300025246 Ga0209646_1000009 Ga0209646_1000009409 457
245 3300025273 Ga0209673_1000042 Ga0209673_100004273 457
246 3300025295 Ga0209564_1001966 Ga0209564_10019666 457
247 3300025295 Ga0209564_1003438 Ga0209564_10034383 457
248 3300025297 Ga0209758_1003644 Ga0209758_10036449 457
249 3300025297 Ga0209758_1004920 Ga0209758_10049206 457
250 3300025298 Ga0209050_1000308 Ga0209050_100030845 457
251 3300025302 Ga0207426_1008024 Ga0207426_10080242 457
252 3300025302 Ga0207426_1016505 Ga0207426_10165051 457
253 3300025304 Ga0209257_1001059 Ga0209257_100105934 457
254 3300025914 Ga0207671_10054222 Ga0207671_100542222 457
255 3300025925 Ga0207650_10030120 Ga0207650_100301203 457
256 3300025932 Ga0207690_10000244 Ga0207690_1000024425 457
257 3300025949 Ga0207667_10004106 Ga0207667_100041063 457
258 3300026142 Ga0207698_10087493 Ga0207698_100874932 457
259 3300037312 Ga0395899_0000204 Ga0395899_0000204_79579_81078 457
260 3300044712 Ga0453684_0001742 Ga0453684_0001742_41665_43098 457
261 3300044842 Ga0466957_0006376 Ga0466957_0006376_1903_3348 457
262 3300045051 Ga0451576_0001351 Ga0451576_0001351_2565_3998 457
263 3300049521 Ga0501298_005377 Ga0501298_005377_480_1904 457
264 3300049581 Ga0501047_0163994 Ga0501047_0163994_269_1879 457
265 3300049649 Ga0501198_000398 Ga0501198_000398_1206_2630 457
266 3300049654 Ga0501207_000246 Ga0501207_000246_3792_5237 457
267 3300049664 Ga0501224_001231 Ga0501224_001231_830_2275 457
268 3300049704 Ga0501221_001150 Ga0501221_001150_2790_4235 457
269 3300049705 Ga0501225_0002509 Ga0501225_0002509_2653_4077 457
270 3300053080 Ga0500635_0000519 Ga0500635_0000519_7165_8547 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

72

427

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o18-assembly2.cif.gz_B-2 unliganded alpha-l-fucosidase alfc from lactobacillus casei 0.8883 29 361
6o1c-assembly2.cif.gz_B alpha-l-fucosidase alfc d200a mutant in complex with 4-nitrophenyl-a-l-fucopyranoside substrate 0.8842 29 360
6o18-assembly2.cif.gz_D-2 unliganded alpha-l-fucosidase alfc from lactobacillus casei 0.8824 28 360
6o1a-assembly2.cif.gz_D-2 alpha-l-fucosidase alfc from lactobacillus casei in complex with alpha-l-fucose product 0.8823 29 360
6o1c-assembly2.cif.gz_H alpha-l-fucosidase alfc d200a mutant in complex with 4-nitrophenyl-a-l-fucopyranoside substrate 0.8818 32 361
ID Description Score Start End Superfamily
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8592 29 364 3.20.20.80
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8541 29 364 3.20.20.80
2wvsA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8491 365 457 2.60.40.1180
2wvsA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8407 365 457 2.60.40.1180
4wskC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8182 29 374 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7V3I701-F1-model_v4 Alpha-L-fucosidase 0.987 27 160 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A849H7M8-F1-model_v4 Alpha-L-fucosidase 0.9868 27 145 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A0S8H5L3-F1-model_v4 DUF5077 domain-containing protein 0.9814 204 457 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7M3NX74-F1-model_v4 Alpha-L-fucosidase 0.9801 33 152 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A660V4G3-F1-model_v4 Alpha-L-fucosidase 0.9754 24 457 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Feature Viewer

pLDDT pTM Quality
91.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map