F377247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 173 | 259 | 462 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0163994|Ga0501047_0163994_269_1879 |
| Length | 536 |
| Sequence | MVVIPDVRGSGFVSGSRIRKYSHQTIQPSDNARIGEYIAVPYQRAVYNISLVASKTKKVYMKKVVAAVVMFCCLWHTVTAQTSVKETKEAHDKRMEWWREARFGMFIHWGVYAVPAGYYNGQPINRIGEWIMNRGKIPVAEYQEFAKQFNPTKYDADAWVKMAKDAGMKYIVITAKHHDGFALFKSNASKWNMADATPYGKDLLKPLAEACRKYGIKLGFYYSQAQDWNNPGGAAARKVASEGWANPDSAKIDAYTAAHEGHWDPAQTTKTMAQYIDDVAVPQVKELLTNYGDVAVLWWDTPTGMTDEFAGKLNAALALQPNIITNDRLKRPDFPGDYKTPEQRIPKESELDGKDWETCMTMNGTWGYKKDDHNWKSTETIIRNLLDIASKGGNYLLNVGPKADGTFPDESIERLKQVGAWMKVNGEAIYDTKASPLPALAWGRCTKKEQKGNTILYLSVFDWPADKKLVVPGLTQPVISATLLAGNKKLATSASKEGVVITLPEQAPDKIASVIKLEVKGKVEDRRFTGAGASGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 4 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 5 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 8 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 9 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 10 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 114 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 119 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 120 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 121 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 136 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 151 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 152 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 154 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 155 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 156 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 158 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 163 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 164 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 165 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 166 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 168 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 169 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 170 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 171 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 172 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 173 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.93 |
| Metatranscriptomes | 0 |
| Isolates | 4.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.96 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 76.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003055 | 3300001979 | Bacteria | 7401 |
| 2 | JGI24735J21928_10003467 | 3300002067 | Bacteria | 5371 |
| 3 | JGI25154J39366_1000031 | 3300002738 | Bacteria | 190814 |
| 4 | rootH2_10042475 | 3300003320 | Bacteria | 12139 |
| 5 | rootL2_10075662 | 3300003322 | Bacteria | 3475 |
| 6 | rootL2_10215643 | 3300003322 | Bacteria | 3039 |
| 7 | rootH1_10039754 | 3300003323 | Bacteria | 16817 |
| 8 | rootH1_10079307 | 3300003323 | Bacteria | 4650 |
| 9 | Ga0055528_1000180 | 3300003790 | Bacteria | 53597 |
| 10 | Ga0055543_1003696 | 3300004625 | Bacteria | 4395 |
| 11 | Ga0065165_1000019 | 3300005262 | Bacteria | 271815 |
| 12 | Ga0065165_1026187 | 3300005262 | Bacteria | 1923 |
| 13 | Ga0065714_10015648 | 3300005288 | Bacteria | 2087 |
| 14 | Ga0065712_10000474 | 3300005290 | Bacteria | 14806 |
| 15 | Ga0070670_100163457 | 3300005331 | Bacteria | 1930 |
| 16 | Ga0070666_10000728 | 3300005335 | Bacteria | 19966 |
| 17 | Ga0070660_100057122 | 3300005339 | Bacteria | 3022 |
| 18 | Ga0070668_100066349 | 3300005347 | Bacteria | 2801 |
| 19 | Ga0070669_100177578 | 3300005353 | Bacteria | 1664 |
| 20 | Ga0070675_100201867 | 3300005354 | Bacteria | 1726 |
| 21 | Ga0070671_100060243 | 3300005355 | Bacteria | 3160 |
| 22 | Ga0070674_100012119 | 3300005356 | Bacteria | 5284 |
| 23 | Ga0070659_100000436 | 3300005366 | Bacteria | 31452 |
| 24 | Ga0070659_100003226 | 3300005366 | Bacteria | 11613 |
| 25 | Ga0070659_100009717 | 3300005366 | Bacteria | 7067 |
| 26 | Ga0070700_100041098 | 3300005441 | Bacteria | 2834 |
| 27 | Ga0068867_100048745 | 3300005459 | Bacteria | 3117 |
| 28 | Ga0070686_100111083 | 3300005544 | Bacteria | 1868 |
| 29 | Ga0070665_100000093 | 3300005548 | Bacteria | 173153 |
| 30 | Ga0068855_100005863 | 3300005563 | Bacteria | 14992 |
| 31 | Ga0068855_100029796 | 3300005563 | Bacteria | 6526 |
| 32 | Ga0070664_100019441 | 3300005564 | Bacteria | 5588 |
| 33 | Ga0068857_100002056 | 3300005577 | Bacteria | 16345 |
| 34 | Ga0068854_100020468 | 3300005578 | Bacteria | 4477 |
| 35 | Ga0068852_100009163 | 3300005616 | Bacteria | 7332 |
| 36 | Ga0068859_100000030 | 3300005617 | Bacteria | 175435 |
| 37 | Ga0068859_100017421 | 3300005617 | Bacteria | 7220 |
| 38 | Ga0068864_100179300 | 3300005618 | Bacteria | 1936 |
| 39 | Ga0068861_100036846 | 3300005719 | Bacteria | 3633 |
| 40 | Ga0068863_100017101 | 3300005841 | Bacteria | 6957 |
| 41 | Ga0068863_100040603 | 3300005841 | Bacteria | 4424 |
| 42 | Ga0068858_100015096 | 3300005842 | Bacteria | 7264 |
| 43 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 44 | Ga0068860_100003675 | 3300005843 | Bacteria | 15789 |
| 45 | Ga0075366_10000514 | 3300006195 | Bacteria | 17870 |
| 46 | Ga0097621_100003096 | 3300006237 | Bacteria | 11411 |
| 47 | Ga0097621_100087570 | 3300006237 | Bacteria | 2601 |
| 48 | Ga0097621_100185204 | 3300006237 | Bacteria | 1801 |
| 49 | Ga0068871_100136294 | 3300006358 | Bacteria | 2085 |
| 50 | Ga0075430_100069833 | 3300006846 | Bacteria | 2946 |
| 51 | Ga0097620_100000030 | 3300006931 | Bacteria | 175435 |
| 52 | Ga0097620_100017421 | 3300006931 | Bacteria | 7220 |
| 53 | Ga0105240_10000095 | 3300009093 | Bacteria | 180935 |
| 54 | Ga0105240_10000155 | 3300009093 | Bacteria | 140485 |
| 55 | Ga0105240_10023766 | 3300009093 | Bacteria | 8097 |
| 56 | Ga0105247_10020790 | 3300009101 | Bacteria | 3947 |
| 57 | Ga0114129_10004260 | 3300009147 | Bacteria | 20220 |
| 58 | Ga0105241_10011235 | 3300009174 | Bacteria | 6565 |
| 59 | Ga0105242_10000764 | 3300009176 | Bacteria | 25007 |
| 60 | Ga0105242_10048378 | 3300009176 | Bacteria | 3456 |
| 61 | Ga0105248_10254746 | 3300009177 | Bacteria | 1975 |
| 62 | Ga0105237_10000061 | 3300009545 | Bacteria | 146107 |
| 63 | Ga0105237_10004448 | 3300009545 | Bacteria | 16226 |
| 64 | Ga0105237_10005050 | 3300009545 | Bacteria | 15013 |
| 65 | Ga0105237_10008035 | 3300009545 | Bacteria | 11477 |
| 66 | Ga0105237_10009012 | 3300009545 | Bacteria | 10728 |
| 67 | Ga0105237_10018746 | 3300009545 | Bacteria | 7156 |
| 68 | Ga0105238_10003635 | 3300009551 | Bacteria | 15374 |
| 69 | Ga0105238_10106491 | 3300009551 | Bacteria | 2785 |
| 70 | Ga0105249_10000878 | 3300009553 | Bacteria | 26707 |
| 71 | Ga0105249_10069121 | 3300009553 | Bacteria | 3259 |
| 72 | Ga0105239_10000083 | 3300010375 | Bacteria | 132046 |
| 73 | Ga0105239_10001893 | 3300010375 | Bacteria | 27361 |
| 74 | Ga0105239_10012672 | 3300010375 | Bacteria | 9381 |
| 75 | Ga0105239_10013276 | 3300010375 | Bacteria | 9154 |
| 76 | Ga0105239_10097021 | 3300010375 | Bacteria | 3257 |
| 77 | Ga0105246_10010380 | 3300011119 | Bacteria | 5761 |
| 78 | Ga0157371_10000617 | 3300013102 | Bacteria | 42318 |
| 79 | Ga0157371_10001565 | 3300013102 | Bacteria | 23529 |
| 80 | Ga0157371_10015737 | 3300013102 | Bacteria | 5662 |
| 81 | Ga0157370_10049975 | 3300013104 | Bacteria | 3998 |
| 82 | Ga0157369_10000439 | 3300013105 | Bacteria | 55404 |
| 83 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 84 | Ga0157378_10040268 | 3300013297 | Bacteria | 4143 |
| 85 | Ga0163162_10000348 | 3300013306 | Bacteria | 42027 |
| 86 | Ga0163162_10000476 | 3300013306 | Bacteria | 37123 |
| 87 | Ga0163162_10001042 | 3300013306 | Bacteria | 25777 |
| 88 | Ga0157372_10000087 | 3300013307 | Bacteria | 95840 |
| 89 | Ga0157372_10000483 | 3300013307 | Bacteria | 44004 |
| 90 | Ga0157372_10030628 | 3300013307 | Bacteria | 5887 |
| 91 | Ga0157375_10133357 | 3300013308 | Bacteria | 2605 |
| 92 | Ga0163163_10084356 | 3300014325 | Bacteria | 3183 |
| 93 | Ga0157377_10007253 | 3300014745 | Bacteria | 5343 |
| 94 | Ga0157379_10058292 | 3300014968 | Bacteria | 3452 |
| 95 | Ga0157376_10000351 | 3300014969 | Bacteria | 30762 |
| 96 | Ga0157376_10002527 | 3300014969 | Bacteria | 12400 |
| 97 | Ga0157376_10013959 | 3300014969 | Bacteria | 6010 |
| 98 | Ga0163161_10005800 | 3300017792 | Bacteria | 8563 |
| 99 | Ga0163161_10008811 | 3300017792 | Bacteria | 6975 |
| 100 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 101 | Ga0209646_1003977 | 3300025246 | Bacteria | 2788 |
| 102 | Ga0209026_1000258 | 3300025250 | Bacteria | 65976 |
| 103 | Ga0209233_1000659 | 3300025261 | Bacteria | 16690 |
| 104 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 105 | Ga0209564_1001966 | 3300025295 | Bacteria | 18095 |
| 106 | Ga0209564_1003438 | 3300025295 | Bacteria | 10834 |
| 107 | Ga0209758_1003644 | 3300025297 | Bacteria | 13740 |
| 108 | Ga0209758_1004920 | 3300025297 | Bacteria | 10738 |
| 109 | Ga0209758_1008987 | 3300025297 | Bacteria | 6319 |
| 110 | Ga0209050_1000308 | 3300025298 | Bacteria | 99516 |
| 111 | Ga0209050_1020811 | 3300025298 | Bacteria | 2422 |
| 112 | Ga0207426_1000175 | 3300025302 | Bacteria | 160332 |
| 113 | Ga0207426_1000243 | 3300025302 | Bacteria | 122575 |
| 114 | Ga0207426_1008024 | 3300025302 | Bacteria | 4331 |
| 115 | Ga0207426_1016505 | 3300025302 | Bacteria | 2650 |
| 116 | Ga0209257_1001059 | 3300025304 | Bacteria | 36382 |
| 117 | Ga0207680_10000415 | 3300025903 | Bacteria | 20318 |
| 118 | Ga0207647_10000043 | 3300025904 | Bacteria | 91109 |
| 119 | Ga0207647_10002370 | 3300025904 | Bacteria | 14319 |
| 120 | Ga0207645_10033905 | 3300025907 | Bacteria | 3281 |
| 121 | Ga0207645_10048137 | 3300025907 | Bacteria | 2722 |
| 122 | Ga0207654_10042288 | 3300025911 | Bacteria | 2578 |
| 123 | Ga0207654_10092498 | 3300025911 | Bacteria | 1847 |
| 124 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 125 | Ga0207695_10000165 | 3300025913 | Bacteria | 195908 |
| 126 | Ga0207695_10056367 | 3300025913 | Bacteria | 4089 |
| 127 | Ga0207671_10000542 | 3300025914 | Bacteria | 50975 |
| 128 | Ga0207671_10000874 | 3300025914 | Bacteria | 38160 |
| 129 | Ga0207671_10003416 | 3300025914 | Bacteria | 15871 |
| 130 | Ga0207671_10007785 | 3300025914 | Bacteria | 9225 |
| 131 | Ga0207671_10054222 | 3300025914 | Bacteria | 2971 |
| 132 | Ga0207671_10066904 | 3300025914 | Bacteria | 2675 |
| 133 | Ga0207662_10009588 | 3300025918 | Bacteria | 5334 |
| 134 | Ga0207694_10070031 | 3300025924 | Bacteria | 2740 |
| 135 | Ga0207650_10030120 | 3300025925 | Bacteria | 3906 |
| 136 | Ga0207644_10043958 | 3300025931 | Bacteria | 3172 |
| 137 | Ga0207690_10000244 | 3300025932 | Bacteria | 39487 |
| 138 | Ga0207690_10002837 | 3300025932 | Bacteria | 10451 |
| 139 | Ga0207690_10065736 | 3300025932 | Bacteria | 2481 |
| 140 | Ga0207686_10000843 | 3300025934 | Bacteria | 18616 |
| 141 | Ga0207670_10007777 | 3300025936 | Bacteria | 6013 |
| 142 | Ga0207704_10100225 | 3300025938 | Bacteria | 1929 |
| 143 | Ga0207689_10002909 | 3300025942 | Bacteria | 15810 |
| 144 | Ga0207667_10004106 | 3300025949 | Bacteria | 17891 |
| 145 | Ga0207712_10000496 | 3300025961 | Bacteria | 32480 |
| 146 | Ga0207712_10040178 | 3300025961 | Bacteria | 3209 |
| 147 | Ga0207712_10086722 | 3300025961 | Bacteria | 2294 |
| 148 | Ga0207668_10139698 | 3300025972 | Bacteria | 1861 |
| 149 | Ga0207640_10014717 | 3300025981 | Bacteria | 4510 |
| 150 | Ga0207702_10174414 | 3300026078 | Bacteria | 1974 |
| 151 | Ga0207641_10000013 | 3300026088 | Bacteria | 341378 |
| 152 | Ga0207641_10005131 | 3300026088 | Bacteria | 11217 |
| 153 | Ga0207641_10115413 | 3300026088 | Bacteria | 2387 |
| 154 | Ga0207648_10001512 | 3300026089 | Bacteria | 25627 |
| 155 | Ga0207648_10086104 | 3300026089 | Bacteria | 2741 |
| 156 | Ga0207648_10153303 | 3300026089 | Bacteria | 2034 |
| 157 | Ga0207676_10060105 | 3300026095 | Bacteria | 3004 |
| 158 | Ga0207676_10070601 | 3300026095 | Bacteria | 2801 |
| 159 | Ga0207674_10007940 | 3300026116 | Bacteria | 12318 |
| 160 | Ga0207674_10153732 | 3300026116 | Unclassified | 2257 |
| 161 | Ga0207675_100023437 | 3300026118 | Bacteria | 5741 |
| 162 | Ga0207675_100029815 | 3300026118 | Bacteria | 5079 |
| 163 | Ga0207683_10150155 | 3300026121 | Bacteria | 2103 |
| 164 | Ga0207683_10240903 | 3300026121 | Bacteria | 1650 |
| 165 | Ga0207698_10001975 | 3300026142 | Bacteria | 12069 |
| 166 | Ga0207698_10087493 | 3300026142 | Bacteria | 2538 |
| 167 | Ga0268266_10000060 | 3300028379 | Bacteria | 269063 |
| 168 | Ga0268264_10000175 | 3300028381 | Bacteria | 136178 |
| 169 | Ga0268264_10002768 | 3300028381 | Bacteria | 15293 |
| 170 | Ga0268264_10073510 | 3300028381 | Bacteria | 2902 |
| 171 | Ga0307517_10000129 | 3300028786 | Bacteria | 114359 |
| 172 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 173 | Ga0307515_10000016 | 3300028794 | Bacteria | 554870 |
| 174 | Ga0307515_10001828 | 3300028794 | Bacteria | 47434 |
| 175 | Ga0307513_10023098 | 3300031456 | Bacteria | 7278 |
| 176 | Ga0307509_10042880 | 3300031507 | Bacteria | 4899 |
| 177 | Ga0307509_10100581 | 3300031507 | Bacteria | 2929 |
| 178 | Ga0307508_10001155 | 3300031616 | Bacteria | 30353 |
| 179 | Ga0307514_10164196 | 3300031649 | Bacteria | 1464 |
| 180 | Ga0307507_10071272 | 3300033179 | Bacteria | 3144 |
| 181 | Ga0307510_10000107 | 3300033180 | Bacteria | 65945 |
| 182 | Ga0395899_0000204 | 3300037312 | Bacteria | 87147 |
| 183 | Ga0436365_1576427 | 3300039437 | Bacteria | 11885 |
| 184 | Ga0451853_3423511 | 3300041512 | Bacteria | 2433 |
| 185 | Ga0439462_0028735 | 3300042015 | Bacteria | 1470 |
| 186 | Ga0451577_0002794 | 3300042876 | Bacteria | 20144 |
| 187 | Ga0451577_0009418 | 3300042876 | Bacteria | 9413 |
| 188 | Ga0466969_0000151 | 3300044656 | Bacteria | 37632 |
| 189 | Ga0466972_0000007 | 3300044658 | Bacteria | 277010 |
| 190 | Ga0466972_0000024 | 3300044658 | Bacteria | 187985 |
| 191 | Ga0466972_0012755 | 3300044658 | Bacteria | 4219 |
| 192 | Ga0466972_0017413 | 3300044658 | Bacteria | 3597 |
| 193 | Ga0453683_0000015 | 3300044673 | Bacteria | 346024 |
| 194 | Ga0453683_0001066 | 3300044673 | Bacteria | 25472 |
| 195 | Ga0453683_0055339 | 3300044673 | Bacteria | 2483 |
| 196 | Ga0466966_0000113 | 3300044684 | Bacteria | 49984 |
| 197 | Ga0466966_0036002 | 3300044684 | Bacteria | 3197 |
| 198 | Ga0453684_0000651 | 3300044712 | Bacteria | 125123 |
| 199 | Ga0453684_0001742 | 3300044712 | Bacteria | 58225 |
| 200 | Ga0453684_0084910 | 3300044712 | Bacteria | 3936 |
| 201 | Ga0466970_0000827 | 3300044765 | Bacteria | 14871 |
| 202 | Ga0466957_0001218 | 3300044842 | Bacteria | 13420 |
| 203 | Ga0466957_0006376 | 3300044842 | Bacteria | 6659 |
| 204 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 205 | Ga0466959_0087907 | 3300045049 | Bacteria | 2235 |
| 206 | Ga0451576_0000080 | 3300045051 | Bacteria | 242782 |
| 207 | Ga0451576_0001351 | 3300045051 | Bacteria | 42332 |
| 208 | Ga0451576_0001982 | 3300045051 | Bacteria | 32524 |
| 209 | Ga0451576_0002811 | 3300045051 | Bacteria | 25096 |
| 210 | Ga0466958_0019565 | 3300045836 | Bacteria | 3943 |
| 211 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 212 | Ga0495638_0026453 | 3300046460 | Bacteria | 3760 |
| 213 | Ga0495585_0019814 | 3300046492 | Bacteria | 3874 |
| 214 | Ga0495606_0003277 | 3300046507 | Bacteria | 17347 |
| 215 | Ga0495648_0001625 | 3300046524 | Bacteria | 21826 |
| 216 | Ga0495648_0006172 | 3300046524 | Bacteria | 9818 |
| 217 | Ga0495609_0007731 | 3300046538 | Bacteria | 5328 |
| 218 | Ga0495622_0034305 | 3300046557 | Bacteria | 2367 |
| 219 | Ga0495668_0000127 | 3300046616 | Bacteria | 114097 |
| 220 | Ga0495611_0000025 | 3300046648 | Bacteria | 118583 |
| 221 | Ga0495625_0000175 | 3300046660 | Bacteria | 99386 |
| 222 | Ga0495625_0000993 | 3300046660 | Bacteria | 37558 |
| 223 | Ga0495625_0035019 | 3300046660 | Bacteria | 3703 |
| 224 | Ga0495625_0051777 | 3300046660 | Bacteria | 2942 |
| 225 | Ga0495625_0089767 | 3300046660 | Bacteria | 2127 |
| 226 | Ga0495674_0045325 | 3300047319 | Bacteria | 3905 |
| 227 | Ga0495683_0011355 | 3300047323 | Bacteria | 4690 |
| 228 | Ga0495686_0012399 | 3300047472 | Bacteria | 5963 |
| 229 | Ga0495686_0055024 | 3300047472 | Bacteria | 2490 |
| 230 | Ga0501298_005377 | 3300049521 | Bacteria | 2053 |
| 231 | Ga0501047_0163994 | 3300049581 | Bacteria | 2093 |
| 232 | Ga0501198_000398 | 3300049649 | Bacteria | 5392 |
| 233 | Ga0501207_000246 | 3300049654 | Bacteria | 5538 |
| 234 | Ga0501224_001231 | 3300049664 | Bacteria | 3364 |
| 235 | Ga0501243_000477 | 3300049675 | Bacteria | 5319 |
| 236 | Ga0501247_000162 | 3300049677 | Bacteria | 4132 |
| 237 | Ga0501221_001150 | 3300049704 | Bacteria | 4364 |
| 238 | Ga0501225_0002509 | 3300049705 | Bacteria | 5680 |
| 239 | Ga0501225_0003561 | 3300049705 | Bacteria | 4697 |
| 240 | Ga0501234_001486 | 3300049707 | Bacteria | 3688 |
| 241 | Ga0501264_000022 | 3300049761 | Bacteria | 24436 |
| 242 | Ga0501044_0046134 | 3300049823 | Bacteria | 4513 |
| 243 | nmdc:mga0k408_570_c1 | 3300050493 | Bacteria | 20339 |
| 244 | nmdc:mga05p37_2426_c2 | 3300050507 | Bacteria | 15408 |
| 245 | Ga0500635_0000519 | 3300053080 | Bacteria | 10598 |
| 246 | Ga0500578_0000457 | 3300053086 | Bacteria | 49613 |
| 247 | Ga0500646_0001774 | 3300053090 | Bacteria | 5681 |
| 248 | Ga0500583_0000028 | 3300053092 | Bacteria | 108276 |
| 249 | Ga0500583_0030523 | 3300053092 | Bacteria | 2362 |
| 250 | Ga0500583_0053056 | 3300053092 | Unclassified | 1889 |
| 251 | Ga0500618_000036 | 3300053125 | Bacteria | 118803 |
| 252 | Ga0500652_007386 | 3300053131 | Bacteria | 3597 |
| 253 | Ga0500568_0001696 | 3300053139 | Bacteria | 13743 |
| 254 | Ga0500588_0004714 | 3300053146 | Bacteria | 2972 |
| 255 | Ga0500616_0018756 | 3300053153 | Bacteria | 3909 |
| 256 | Ga0500622_0000004 | 3300053156 | Bacteria | 557587 |
| 257 | Ga0500622_0028499 | 3300053156 | Unclassified | 2940 |
| 258 | Ga0500622_0091016 | 3300053156 | Bacteria | 1514 |
| 259 | Ga0500611_000066 | 3300053727 | Bacteria | 42948 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025913 | Ga0207695_10056367 | Ga0207695_100563672 | 390 |
| 2 | 3300013308 | Ga0157375_10133357 | Ga0157375_101333571 | 418 |
| 3 | 3300053156 | Ga0500622_0091016 | Ga0500622_0091016_28_1338 | 418 |
| 4 | 3300005355 | Ga0070671_100060243 | Ga0070671_1000602432 | 420 |
| 5 | 3300005544 | Ga0070686_100111083 | Ga0070686_1001110831 | 420 |
| 6 | 3300006237 | Ga0097621_100185204 | Ga0097621_1001852041 | 420 |
| 7 | 3300025907 | Ga0207645_10033905 | Ga0207645_100339052 | 420 |
| 8 | 3300025918 | Ga0207662_10009588 | Ga0207662_100095884 | 420 |
| 9 | 3300025931 | Ga0207644_10043958 | Ga0207644_100439582 | 420 |
| 10 | 3300026089 | Ga0207648_10086104 | Ga0207648_100861042 | 420 |
| 11 | 3300026121 | Ga0207683_10150155 | Ga0207683_101501552 | 420 |
| 12 | 3300046660 | Ga0495625_0035019 | Ga0495625_0035019_1963_3390 | 424 |
| 13 | 3300005288 | Ga0065714_10015648 | Ga0065714_100156482 | 426 |
| 14 | 3300046660 | Ga0495625_0051777 | Ga0495625_0051777_41_1468 | 426 |
| 15 | 3300005353 | Ga0070669_100177578 | Ga0070669_1001775781 | 427 |
| 16 | 3300009551 | Ga0105238_10106491 | Ga0105238_101064912 | 428 |
| 17 | 3300025924 | Ga0207694_10070031 | Ga0207694_100700312 | 428 |
| 18 | 3300042015 | Ga0439462_0028735 | Ga0439462_0028735_13_1341 | 428 |
| 19 | 3300010375 | Ga0105239_10012672 | Ga0105239_100126723 | 429 |
| 20 | 3300031456 | Ga0307513_10023098 | Ga0307513_100230982 | 429 |
| 21 | 3300044842 | Ga0466957_0001218 | Ga0466957_0001218_3858_5285 | 429 |
| 22 | 3300009093 | Ga0105240_10000155 | Ga0105240_1000015527 | 430 |
| 23 | 3300025913 | Ga0207695_10000043 | Ga0207695_1000004343 | 430 |
| 24 | 3300046660 | Ga0495625_0089767 | Ga0495625_0089767_491_1918 | 431 |
| 25 | 3300049675 | Ga0501243_000477 | Ga0501243_000477_1624_2940 | 431 |
| 26 | 3300053153 | Ga0500616_0018756 | Ga0500616_0018756_1369_2751 | 431 |
| 27 | 3300009551 | Ga0105238_10003635 | Ga0105238_100036352 | 433 |
| 28 | 3300025911 | Ga0207654_10042288 | Ga0207654_100422882 | 433 |
| 29 | 3300026078 | Ga0207702_10174414 | Ga0207702_101744142 | 433 |
| 30 | 3300044658 | Ga0466972_0012755 | Ga0466972_0012755_1551_2915 | 433 |
| 31 | 3300053727 | Ga0500611_000066 | Ga0500611_000066_26867_28291 | 433 |
| 32 | 3300006195 | Ga0075366_10000514 | Ga0075366_1000051410 | 436 |
| 33 | 3300028786 | Ga0307517_10000129 | Ga0307517_1000012965 | 436 |
| 34 | 3300042876 | Ga0451577_0002794 | Ga0451577_0002794_1947_3380 | 436 |
| 35 | 3300044712 | Ga0453684_0000651 | Ga0453684_0000651_70166_71599 | 436 |
| 36 | 3300045051 | Ga0451576_0000080 | Ga0451576_0000080_89214_90647 | 436 |
| 37 | 3300046660 | Ga0495625_0000993 | Ga0495625_0000993_4973_6400 | 436 |
| 38 | 3300050493 | nmdc:mga0k408_570_c1 | nmdc:mga0k408_570_c1_3479_4906 | 436 |
| 39 | 3300046460 | Ga0495638_0026453 | Ga0495638_0026453_1561_2934 | 437 |
| 40 | 3300046524 | Ga0495648_0001625 | Ga0495648_0001625_17622_18995 | 437 |
| 41 | 3300053092 | Ga0500583_0053056 | Ga0500583_0053056_330_1703 | 437 |
| 42 | 3300053156 | Ga0500622_0028499 | Ga0500622_0028499_212_1585 | 437 |
| 43 | 3300002067 | JGI24735J21928_10003467 | JGI24735J21928_100034672 | 439 |
| 44 | 3300005366 | Ga0070659_100009717 | Ga0070659_1000097173 | 439 |
| 45 | 3300005577 | Ga0068857_100002056 | Ga0068857_1000020564 | 439 |
| 46 | 3300013102 | Ga0157371_10000617 | Ga0157371_100006178 | 439 |
| 47 | 3300013104 | Ga0157370_10049975 | Ga0157370_100499752 | 439 |
| 48 | 3300013307 | Ga0157372_10000483 | Ga0157372_100004834 | 439 |
| 49 | 3300025261 | Ga0209233_1000659 | Ga0209233_100065910 | 439 |
| 50 | 3300025904 | Ga0207647_10000043 | Ga0207647_100000433 | 439 |
| 51 | 3300025932 | Ga0207690_10002837 | Ga0207690_100028375 | 439 |
| 52 | 3300026116 | Ga0207674_10007940 | Ga0207674_100079407 | 439 |
| 53 | 3300046492 | Ga0495585_0019814 | Ga0495585_0019814_535_1962 | 441 |
| 54 | 3300046524 | Ga0495648_0006172 | Ga0495648_0006172_3302_4729 | 441 |
| 55 | 3300046538 | Ga0495609_0007731 | Ga0495609_0007731_288_1715 | 441 |
| 56 | 3300046557 | Ga0495622_0034305 | Ga0495622_0034305_776_2203 | 441 |
| 57 | 3300046616 | Ga0495668_0000127 | Ga0495668_0000127_10901_12328 | 441 |
| 58 | 3300046660 | Ga0495625_0000175 | Ga0495625_0000175_30460_31887 | 441 |
| 59 | 3300053125 | Ga0500618_000036 | Ga0500618_000036_70616_72043 | 441 |
| 60 | 3300009545 | Ga0105237_10000061 | Ga0105237_1000006161 | 442 |
| 61 | 3300025914 | Ga0207671_10003416 | Ga0207671_100034161 | 442 |
| 62 | 3300033180 | Ga0307510_10000107 | Ga0307510_1000010736 | 442 |
| 63 | 3300047323 | Ga0495683_0011355 | Ga0495683_0011355_1891_3318 | 442 |
| 64 | 3300009545 | Ga0105237_10005050 | Ga0105237_100050504 | 443 |
| 65 | 3300010375 | Ga0105239_10097021 | Ga0105239_100970213 | 443 |
| 66 | 3300013102 | Ga0157371_10001565 | Ga0157371_1000156514 | 443 |
| 67 | 3300005366 | Ga0070659_100000436 | Ga0070659_10000043616 | 444 |
| 68 | 3300005616 | Ga0068852_100009163 | Ga0068852_1000091633 | 444 |
| 69 | 3300025904 | Ga0207647_10002370 | Ga0207647_100023704 | 444 |
| 70 | 3300025932 | Ga0207690_10065736 | Ga0207690_100657362 | 444 |
| 71 | 3300026142 | Ga0207698_10001975 | Ga0207698_100019753 | 444 |
| 72 | 3300031507 | Ga0307509_10100581 | Ga0307509_101005812 | 444 |
| 73 | 3300026121 | Ga0207683_10240903 | Ga0207683_102409031 | 445 |
| 74 | 3300044673 | Ga0453683_0055339 | Ga0453683_0055339_660_2036 | 445 |
| 75 | 3300045051 | Ga0451576_0002811 | Ga0451576_0002811_4457_5833 | 445 |
| 76 | 3300046648 | Ga0495611_0000025 | Ga0495611_0000025_95535_96914 | 445 |
| 77 | 3300049823 | Ga0501044_0046134 | Ga0501044_0046134_2721_4121 | 445 |
| 78 | 3300003320 | rootH2_10042475 | rootH2_100424754 | 446 |
| 79 | 3300013297 | Ga0157378_10040268 | Ga0157378_100402683 | 446 |
| 80 | 3300014745 | Ga0157377_10007253 | Ga0157377_100072533 | 446 |
| 81 | 3300031616 | Ga0307508_10001155 | Ga0307508_1000115514 | 446 |
| 82 | 3300041512 | Ga0451853_3423511 | Ga0451853_3423511_563_1999 | 446 |
| 83 | 3300013105 | Ga0157369_10000439 | Ga0157369_1000043910 | 447 |
| 84 | 3300028794 | Ga0307515_10000016 | Ga0307515_10000016448 | 447 |
| 85 | 3300031649 | Ga0307514_10164196 | Ga0307514_101641961 | 447 |
| 86 | 3300053131 | Ga0500652_007386 | Ga0500652_007386_1309_2733 | 447 |
| 87 | 3300028794 | Ga0307515_10001828 | Ga0307515_1000182818 | 448 |
| 88 | 3300053090 | Ga0500646_0001774 | Ga0500646_0001774_792_2231 | 448 |
| 89 | iso_pu_bacteria | 2896109856 | 2896111000 | 448 |
| 90 | 3300005617 | Ga0068859_100017421 | Ga0068859_1000174214 | 449 |
| 91 | 3300006931 | Ga0097620_100017421 | Ga0097620_1000174214 | 449 |
| 92 | 3300010375 | Ga0105239_10013276 | Ga0105239_100132762 | 449 |
| 93 | 3300013296 | Ga0157374_10000003 | Ga0157374_10000003469 | 449 |
| 94 | 3300014969 | Ga0157376_10000351 | Ga0157376_100003513 | 449 |
| 95 | 3300025250 | Ga0209026_1000258 | Ga0209026_100025857 | 449 |
| 96 | 3300025972 | Ga0207668_10139698 | Ga0207668_101396981 | 449 |
| 97 | 3300044656 | Ga0466969_0000151 | Ga0466969_0000151_9802_11220 | 449 |
| 98 | 3300044684 | Ga0466966_0000113 | Ga0466966_0000113_16027_17445 | 449 |
| 99 | 3300045049 | Ga0466959_0000015 | Ga0466959_0000015_22840_24258 | 449 |
| 100 | 3300005331 | Ga0070670_100163457 | Ga0070670_1001634572 | 450 |
| 101 | 3300009147 | Ga0114129_10004260 | Ga0114129_1000426017 | 450 |
| 102 | 3300044684 | Ga0466966_0036002 | Ga0466966_0036002_404_1825 | 450 |
| 103 | 3300045049 | Ga0466959_0087907 | Ga0466959_0087907_426_1847 | 450 |
| 104 | 3300045836 | Ga0466958_0019565 | Ga0466958_0019565_2012_3433 | 450 |
| 105 | 3300050507 | nmdc:mga05p37_2426_c2 | nmdc:mga05p37_2426_c2_11078_12508 | 450 |
| 106 | 3300005459 | Ga0068867_100048745 | Ga0068867_1000487452 | 451 |
| 107 | 3300005578 | Ga0068854_100020468 | Ga0068854_1000204682 | 451 |
| 108 | 3300009176 | Ga0105242_10048378 | Ga0105242_100483782 | 451 |
| 109 | 3300009545 | Ga0105237_10004448 | Ga0105237_100044489 | 451 |
| 110 | 3300025907 | Ga0207645_10048137 | Ga0207645_100481371 | 451 |
| 111 | 3300025914 | Ga0207671_10000542 | Ga0207671_1000054261 | 451 |
| 112 | 3300025914 | Ga0207671_10000874 | Ga0207671_1000087423 | 451 |
| 113 | 3300025981 | Ga0207640_10014717 | Ga0207640_100147172 | 451 |
| 114 | 3300026089 | Ga0207648_10001512 | Ga0207648_100015123 | 451 |
| 115 | 3300026116 | Ga0207674_10153732 | Ga0207674_101537321 | 451 |
| 116 | 3300049705 | Ga0501225_0003561 | Ga0501225_0003561_78_1499 | 451 |
| 117 | 3300049707 | Ga0501234_001486 | Ga0501234_001486_1028_2455 | 451 |
| 118 | iso_pu_bacteria | 2883068021 | 2883068539 | 451 |
| 119 | iso_pu_bacteria | 2884791551 | 2884797520 | 451 |
| 120 | iso_pu_bacteria | 2929177148 | 2929183405 | 451 |
| 121 | iso_pu_bacteria | 2945977869 | 2945979365 | 451 |
| 122 | iso_pu_bacteria | 2946013367 | 2946014764 | 451 |
| 123 | 3300003323 | rootH1_10039754 | rootH1_100397541 | 452 |
| 124 | 3300005563 | Ga0068855_100029796 | Ga0068855_1000297962 | 452 |
| 125 | 3300009093 | Ga0105240_10023766 | Ga0105240_100237662 | 452 |
| 126 | 3300009545 | Ga0105237_10009012 | Ga0105237_100090128 | 452 |
| 127 | 3300010375 | Ga0105239_10000083 | Ga0105239_1000008345 | 452 |
| 128 | 3300025914 | Ga0207671_10066904 | Ga0207671_100669042 | 452 |
| 129 | 3300053092 | Ga0500583_0000028 | Ga0500583_0000028_10681_12120 | 452 |
| 130 | iso_pu_bacteria | 2738541278 | 2738724356 | 452 |
| 131 | iso_pu_bacteria | 2818991460 | 2819677602 | 452 |
| 132 | 3300003322 | rootL2_10215643 | rootL2_102156432 | 453 |
| 133 | 3300005356 | Ga0070674_100012119 | Ga0070674_1000121191 | 453 |
| 134 | 3300047319 | Ga0495674_0045325 | Ga0495674_0045325_1651_3057 | 453 |
| 135 | iso_pu_bacteria | 2919437846 | 2919438826 | 453 |
| 136 | iso_pu_bacteria | 2929921140 | 2929924651 | 453 |
| 137 | iso_pu_bacteria | 8003151029 | 8003157086 | 453 |
| 138 | 3300005262 | Ga0065165_1026187 | Ga0065165_10261872 | 454 |
| 139 | 3300009093 | Ga0105240_10000095 | Ga0105240_1000009532 | 454 |
| 140 | 3300014325 | Ga0163163_10084356 | Ga0163163_100843561 | 454 |
| 141 | 3300025302 | Ga0207426_1000175 | Ga0207426_100017563 | 454 |
| 142 | 3300025913 | Ga0207695_10000165 | Ga0207695_1000016548 | 454 |
| 143 | 3300044673 | Ga0453683_0000015 | Ga0453683_0000015_50992_52422 | 454 |
| 144 | 3300044712 | Ga0453684_0084910 | Ga0453684_0084910_897_2333 | 454 |
| 145 | 3300046507 | Ga0495606_0003277 | Ga0495606_0003277_4585_6030 | 454 |
| 146 | 3300053092 | Ga0500583_0030523 | Ga0500583_0030523_701_2143 | 454 |
| 147 | 3300005290 | Ga0065712_10000474 | Ga0065712_1000047411 | 455 |
| 148 | 3300005719 | Ga0068861_100036846 | Ga0068861_1000368462 | 455 |
| 149 | 3300009177 | Ga0105248_10254746 | Ga0105248_102547462 | 455 |
| 150 | 3300009553 | Ga0105249_10000878 | Ga0105249_1000087820 | 455 |
| 151 | 3300017792 | Ga0163161_10005800 | Ga0163161_100058004 | 455 |
| 152 | 3300025246 | Ga0209646_1003977 | Ga0209646_10039773 | 455 |
| 153 | 3300025302 | Ga0207426_1000243 | Ga0207426_100024340 | 455 |
| 154 | 3300025936 | Ga0207670_10007777 | Ga0207670_100077772 | 455 |
| 155 | 3300025961 | Ga0207712_10000496 | Ga0207712_1000049622 | 455 |
| 156 | 3300026118 | Ga0207675_100029815 | Ga0207675_1000298153 | 455 |
| 157 | 3300028381 | Ga0268264_10073510 | Ga0268264_100735102 | 455 |
| 158 | 3300053146 | Ga0500588_0004714 | Ga0500588_0004714_819_2198 | 455 |
| 159 | 3300003323 | rootH1_10079307 | rootH1_100793075 | 456 |
| 160 | 3300005335 | Ga0070666_10000728 | Ga0070666_1000072810 | 456 |
| 161 | 3300005347 | Ga0070668_100066349 | Ga0070668_1000663492 | 456 |
| 162 | 3300005441 | Ga0070700_100041098 | Ga0070700_1000410982 | 456 |
| 163 | 3300005548 | Ga0070665_100000093 | Ga0070665_10000009386 | 456 |
| 164 | 3300005617 | Ga0068859_100000030 | Ga0068859_10000003037 | 456 |
| 165 | 3300005618 | Ga0068864_100179300 | Ga0068864_1001793002 | 456 |
| 166 | 3300005841 | Ga0068863_100017101 | Ga0068863_1000171013 | 456 |
| 167 | 3300005841 | Ga0068863_100040603 | Ga0068863_1000406032 | 456 |
| 168 | 3300005842 | Ga0068858_100015096 | Ga0068858_1000150964 | 456 |
| 169 | 3300005843 | Ga0068860_100000006 | Ga0068860_100000006237 | 456 |
| 170 | 3300005843 | Ga0068860_100003675 | Ga0068860_1000036755 | 456 |
| 171 | 3300006237 | Ga0097621_100003096 | Ga0097621_1000030963 | 456 |
| 172 | 3300006237 | Ga0097621_100087570 | Ga0097621_1000875701 | 456 |
| 173 | 3300006358 | Ga0068871_100136294 | Ga0068871_1001362942 | 456 |
| 174 | 3300006846 | Ga0075430_100069833 | Ga0075430_1000698331 | 456 |
| 175 | 3300006931 | Ga0097620_100000030 | Ga0097620_100000030108 | 456 |
| 176 | 3300009101 | Ga0105247_10020790 | Ga0105247_100207902 | 456 |
| 177 | 3300009174 | Ga0105241_10011235 | Ga0105241_100112353 | 456 |
| 178 | 3300009176 | Ga0105242_10000764 | Ga0105242_1000076410 | 456 |
| 179 | 3300009545 | Ga0105237_10008035 | Ga0105237_100080357 | 456 |
| 180 | 3300009553 | Ga0105249_10069121 | Ga0105249_100691211 | 456 |
| 181 | 3300011119 | Ga0105246_10010380 | Ga0105246_100103802 | 456 |
| 182 | 3300013306 | Ga0163162_10000348 | Ga0163162_1000034819 | 456 |
| 183 | 3300013306 | Ga0163162_10000476 | Ga0163162_1000047616 | 456 |
| 184 | 3300013306 | Ga0163162_10001042 | Ga0163162_100010422 | 456 |
| 185 | 3300014968 | Ga0157379_10058292 | Ga0157379_100582921 | 456 |
| 186 | 3300014969 | Ga0157376_10002527 | Ga0157376_100025276 | 456 |
| 187 | 3300014969 | Ga0157376_10013959 | Ga0157376_100139592 | 456 |
| 188 | 3300017792 | Ga0163161_10008811 | Ga0163161_100088113 | 456 |
| 189 | 3300025297 | Ga0209758_1008987 | Ga0209758_10089872 | 456 |
| 190 | 3300025298 | Ga0209050_1020811 | Ga0209050_10208113 | 456 |
| 191 | 3300025903 | Ga0207680_10000415 | Ga0207680_1000041510 | 456 |
| 192 | 3300025911 | Ga0207654_10092498 | Ga0207654_100924981 | 456 |
| 193 | 3300025914 | Ga0207671_10007785 | Ga0207671_100077852 | 456 |
| 194 | 3300025934 | Ga0207686_10000843 | Ga0207686_100008438 | 456 |
| 195 | 3300025938 | Ga0207704_10100225 | Ga0207704_101002251 | 456 |
| 196 | 3300025942 | Ga0207689_10002909 | Ga0207689_100029099 | 456 |
| 197 | 3300025961 | Ga0207712_10040178 | Ga0207712_100401783 | 456 |
| 198 | 3300025961 | Ga0207712_10086722 | Ga0207712_100867223 | 456 |
| 199 | 3300026088 | Ga0207641_10000013 | Ga0207641_1000001363 | 456 |
| 200 | 3300026088 | Ga0207641_10005131 | Ga0207641_100051316 | 456 |
| 201 | 3300026088 | Ga0207641_10115413 | Ga0207641_101154132 | 456 |
| 202 | 3300026089 | Ga0207648_10153303 | Ga0207648_101533032 | 456 |
| 203 | 3300026095 | Ga0207676_10060105 | Ga0207676_100601052 | 456 |
| 204 | 3300026095 | Ga0207676_10070601 | Ga0207676_100706012 | 456 |
| 205 | 3300026118 | Ga0207675_100023437 | Ga0207675_1000234374 | 456 |
| 206 | 3300028379 | Ga0268266_10000060 | Ga0268266_1000006012 | 456 |
| 207 | 3300028381 | Ga0268264_10000175 | Ga0268264_1000017517 | 456 |
| 208 | 3300028381 | Ga0268264_10002768 | Ga0268264_100027687 | 456 |
| 209 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012999 | 456 |
| 210 | 3300031507 | Ga0307509_10042880 | Ga0307509_100428802 | 456 |
| 211 | 3300033179 | Ga0307507_10071272 | Ga0307507_100712721 | 456 |
| 212 | 3300039437 | Ga0436365_1576427 | Ga0436365_1576427_7503_8924 | 456 |
| 213 | 3300042876 | Ga0451577_0009418 | Ga0451577_0009418_6735_8111 | 456 |
| 214 | 3300044658 | Ga0466972_0000007 | Ga0466972_0000007_221741_223177 | 456 |
| 215 | 3300044658 | Ga0466972_0000024 | Ga0466972_0000024_3901_5283 | 456 |
| 216 | 3300044658 | Ga0466972_0017413 | Ga0466972_0017413_247_1686 | 456 |
| 217 | 3300044673 | Ga0453683_0001066 | Ga0453683_0001066_4925_6301 | 456 |
| 218 | 3300044765 | Ga0466970_0000827 | Ga0466970_0000827_4239_5621 | 456 |
| 219 | 3300045051 | Ga0451576_0001982 | Ga0451576_0001982_26168_27544 | 456 |
| 220 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_869459_870883 | 456 |
| 221 | 3300047472 | Ga0495686_0012399 | Ga0495686_0012399_1590_3014 | 456 |
| 222 | 3300047472 | Ga0495686_0055024 | Ga0495686_0055024_680_2104 | 456 |
| 223 | 3300049677 | Ga0501247_000162 | Ga0501247_000162_2631_4058 | 456 |
| 224 | 3300049761 | Ga0501264_000022 | Ga0501264_000022_19398_20825 | 456 |
| 225 | 3300053086 | Ga0500578_0000457 | Ga0500578_0000457_20295_21716 | 456 |
| 226 | 3300053139 | Ga0500568_0001696 | Ga0500568_0001696_11062_12495 | 456 |
| 227 | 3300053156 | Ga0500622_0000004 | Ga0500622_0000004_94297_95724 | 456 |
| 228 | 3300001979 | JGI24740J21852_10003055 | JGI24740J21852_100030556 | 457 |
| 229 | 3300002738 | JGI25154J39366_1000031 | JGI25154J39366_1000031137 | 457 |
| 230 | 3300003322 | rootL2_10075662 | rootL2_100756623 | 457 |
| 231 | 3300003790 | Ga0055528_1000180 | Ga0055528_100018011 | 457 |
| 232 | 3300004625 | Ga0055543_1003696 | Ga0055543_10036962 | 457 |
| 233 | 3300005262 | Ga0065165_1000019 | Ga0065165_1000019160 | 457 |
| 234 | 3300005339 | Ga0070660_100057122 | Ga0070660_1000571222 | 457 |
| 235 | 3300005354 | Ga0070675_100201867 | Ga0070675_1002018671 | 457 |
| 236 | 3300005366 | Ga0070659_100003226 | Ga0070659_1000032263 | 457 |
| 237 | 3300005563 | Ga0068855_100005863 | Ga0068855_1000058639 | 457 |
| 238 | 3300005564 | Ga0070664_100019441 | Ga0070664_1000194415 | 457 |
| 239 | 3300009545 | Ga0105237_10018746 | Ga0105237_100187464 | 457 |
| 240 | 3300010375 | Ga0105239_10001893 | Ga0105239_100018933 | 457 |
| 241 | 3300013102 | Ga0157371_10015737 | Ga0157371_100157374 | 457 |
| 242 | 3300013307 | Ga0157372_10000087 | Ga0157372_1000008749 | 457 |
| 243 | 3300013307 | Ga0157372_10030628 | Ga0157372_100306282 | 457 |
| 244 | 3300025246 | Ga0209646_1000009 | Ga0209646_1000009409 | 457 |
| 245 | 3300025273 | Ga0209673_1000042 | Ga0209673_100004273 | 457 |
| 246 | 3300025295 | Ga0209564_1001966 | Ga0209564_10019666 | 457 |
| 247 | 3300025295 | Ga0209564_1003438 | Ga0209564_10034383 | 457 |
| 248 | 3300025297 | Ga0209758_1003644 | Ga0209758_10036449 | 457 |
| 249 | 3300025297 | Ga0209758_1004920 | Ga0209758_10049206 | 457 |
| 250 | 3300025298 | Ga0209050_1000308 | Ga0209050_100030845 | 457 |
| 251 | 3300025302 | Ga0207426_1008024 | Ga0207426_10080242 | 457 |
| 252 | 3300025302 | Ga0207426_1016505 | Ga0207426_10165051 | 457 |
| 253 | 3300025304 | Ga0209257_1001059 | Ga0209257_100105934 | 457 |
| 254 | 3300025914 | Ga0207671_10054222 | Ga0207671_100542222 | 457 |
| 255 | 3300025925 | Ga0207650_10030120 | Ga0207650_100301203 | 457 |
| 256 | 3300025932 | Ga0207690_10000244 | Ga0207690_1000024425 | 457 |
| 257 | 3300025949 | Ga0207667_10004106 | Ga0207667_100041063 | 457 |
| 258 | 3300026142 | Ga0207698_10087493 | Ga0207698_100874932 | 457 |
| 259 | 3300037312 | Ga0395899_0000204 | Ga0395899_0000204_79579_81078 | 457 |
| 260 | 3300044712 | Ga0453684_0001742 | Ga0453684_0001742_41665_43098 | 457 |
| 261 | 3300044842 | Ga0466957_0006376 | Ga0466957_0006376_1903_3348 | 457 |
| 262 | 3300045051 | Ga0451576_0001351 | Ga0451576_0001351_2565_3998 | 457 |
| 263 | 3300049521 | Ga0501298_005377 | Ga0501298_005377_480_1904 | 457 |
| 264 | 3300049581 | Ga0501047_0163994 | Ga0501047_0163994_269_1879 | 457 |
| 265 | 3300049649 | Ga0501198_000398 | Ga0501198_000398_1206_2630 | 457 |
| 266 | 3300049654 | Ga0501207_000246 | Ga0501207_000246_3792_5237 | 457 |
| 267 | 3300049664 | Ga0501224_001231 | Ga0501224_001231_830_2275 | 457 |
| 268 | 3300049704 | Ga0501221_001150 | Ga0501221_001150_2790_4235 | 457 |
| 269 | 3300049705 | Ga0501225_0002509 | Ga0501225_0002509_2653_4077 | 457 |
| 270 | 3300053080 | Ga0500635_0000519 | Ga0500635_0000519_7165_8547 | 457 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o18-assembly2.cif.gz_B-2 | unliganded alpha-l-fucosidase alfc from lactobacillus casei | 0.8883 | 29 | 361 |
| 6o1c-assembly2.cif.gz_B | alpha-l-fucosidase alfc d200a mutant in complex with 4-nitrophenyl-a-l-fucopyranoside substrate | 0.8842 | 29 | 360 |
| 6o18-assembly2.cif.gz_D-2 | unliganded alpha-l-fucosidase alfc from lactobacillus casei | 0.8824 | 28 | 360 |
| 6o1a-assembly2.cif.gz_D-2 | alpha-l-fucosidase alfc from lactobacillus casei in complex with alpha-l-fucose product | 0.8823 | 29 | 360 |
| 6o1c-assembly2.cif.gz_H | alpha-l-fucosidase alfc d200a mutant in complex with 4-nitrophenyl-a-l-fucopyranoside substrate | 0.8818 | 32 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6gn6F01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8592 | 29 | 364 | 3.20.20.80 |
| 6gn6F01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8541 | 29 | 364 | 3.20.20.80 |
| 2wvsA02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8491 | 365 | 457 | 2.60.40.1180 |
| 2wvsA02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8407 | 365 | 457 | 2.60.40.1180 |
| 4wskC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8182 | 29 | 374 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V3I701-F1-model_v4 | Alpha-L-fucosidase | 0.987 | 27 | 160 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A849H7M8-F1-model_v4 | Alpha-L-fucosidase | 0.9868 | 27 | 145 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A0S8H5L3-F1-model_v4 | DUF5077 domain-containing protein | 0.9814 | 204 | 457 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A7M3NX74-F1-model_v4 | Alpha-L-fucosidase | 0.9801 | 33 | 152 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A660V4G3-F1-model_v4 | Alpha-L-fucosidase | 0.9754 | 24 | 457 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar