F377240

General Info

Members Datasets Scaffolds Average Seq Length
270 195 270 107

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0164408|Ga0501042_0164408_1197_1574
Length 125
Sequence VGDKGHTRGRRIGLGKLDRVSYPLENALFQWEDGYRELQALRDPKARRLADRVVDAVREELRRRIGPTFGAAELAELYGRGTDWCQQIAIDVAPAVADPQTLADAAFWLYLRGATDFAGGKQLIV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 10.37
Rhizosphere 80.74
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000014 3300001977 Bacteria 16789
2 JGI24747J21853_1039567 3300001978 Bacteria 557
3 JGI24740J21852_10000990 3300001979 Bacteria 12697
4 JGI24748J21848_1001029 3300002074 Bacteria 3032
5 JGI24034J26672_10000856 3300002239 Bacteria 3955
6 rootH1_10118456 3300003316 Bacteria 1824
7 rootL2_10141448 3300003322 Bacteria 1937
8 JGI25404J52841_10013720 3300003659 Bacteria 1757
9 Ga0070683_100010256 3300005329 Bacteria 8051
10 Ga0070682_100316901 3300005337 Bacteria 1150
11 Ga0068868_100074696 3300005338 Bacteria 2708
12 Ga0070691_10000064 3300005341 Bacteria 29794
13 Ga0070691_10025761 3300005341 Bacteria 2740
14 Ga0070661_100000005 3300005344 Bacteria 220455
15 Ga0070661_100785314 3300005344 Bacteria 781
16 Ga0070668_100459498 3300005347 Bacteria 1096
17 Ga0070675_100005523 3300005354 Bacteria 9677
18 Ga0070674_100000006 3300005356 Bacteria 150063
19 Ga0070688_100002070 3300005365 Bacteria 10125
20 Ga0070688_100003416 3300005365 Bacteria 8157
21 Ga0070659_100016884 3300005366 Bacteria 5486
22 Ga0070667_100001507 3300005367 Bacteria 20839
23 Ga0070701_10112666 3300005438 Bacteria 1522
24 Ga0070700_100807460 3300005441 Bacteria 756
25 Ga0070685_10000021 3300005466 Bacteria 103600
26 Ga0070685_10000111 3300005466 Bacteria 52039
27 Ga0070684_100176812 3300005535 Bacteria 1940
28 Ga0070672_100000580 3300005543 Bacteria 21508
29 Ga0070686_100108345 3300005544 Unclassified 1888
30 Ga0070686_100543310 3300005544 Bacteria 908
31 Ga0070695_100051558 3300005545 Unclassified 2641
32 Ga0070665_100001200 3300005548 Bacteria 31604
33 Ga0070665_100045804 3300005548 Bacteria 4393
34 Ga0070665_100115833 3300005548 Bacteria 2683
35 Ga0070665_100729657 3300005548 Bacteria 1004
36 Ga0070665_101139921 3300005548 Bacteria 791
37 Ga0070704_100121392 3300005549 Bacteria 2008
38 Ga0068855_100083762 3300005563 Bacteria 3694
39 Ga0070664_100030206 3300005564 Bacteria 4521
40 Ga0068857_100020990 3300005577 Bacteria 5747
41 Ga0070702_100682007 3300005615 Unclassified 781
42 Ga0068852_100097436 3300005616 Bacteria 2646
43 Ga0068864_100000023 3300005618 Bacteria 257064
44 Ga0068866_10000731 3300005718 Bacteria 14876
45 Ga0068861_100240932 3300005719 Unclassified 1538
46 Ga0068861_101320534 3300005719 Bacteria 702
47 Ga0068861_102578398 3300005719 Bacteria 512
48 Ga0068863_100005063 3300005841 Bacteria 13003
49 Ga0068863_100157893 3300005841 Bacteria 2172
50 Ga0068858_100000033 3300005842 Bacteria 142748
51 Ga0068858_100183925 3300005842 Bacteria 1974
52 Ga0068858_100198869 3300005842 Bacteria 1895
53 Ga0068860_100884790 3300005843 Bacteria 909
54 Ga0068862_100000050 3300005844 Bacteria 145502
55 Ga0081540_1000106 3300005983 Bacteria 89767
56 Ga0081539_10000504 3300005985 Bacteria 81870
57 Ga0097621_101143066 3300006237 Bacteria 732
58 Ga0068871_100078013 3300006358 Bacteria 2738
59 Ga0075430_100378157 3300006846 Bacteria 1169
60 Ga0075433_10003789 3300006852 Bacteria 11715
61 Ga0105240_10226254 3300009093 Bacteria 2177
62 Ga0105245_10000365 3300009098 Bacteria 42328
63 Ga0105245_10006637 3300009098 Bacteria 10161
64 Ga0105247_10000105 3300009101 Bacteria 87578
65 Ga0105243_10090903 3300009148 Bacteria 2513
66 Ga0105243_10122286 3300009148 Unclassified 2196
67 Ga0105242_10000335 3300009176 Bacteria 37854
68 Ga0105242_10063493 3300009176 Bacteria 3041
69 Ga0105237_10086987 3300009545 Bacteria 3115
70 Ga0105237_10705647 3300009545 Bacteria 1015
71 Ga0105238_11057302 3300009551 Bacteria 834
72 Ga0105249_10008206 3300009553 Bacteria 9099
73 Ga0105249_10709567 3300009553 Unclassified 1066
74 Ga0105239_10053058 3300010375 Bacteria 4448
75 Ga0105239_10797747 3300010375 Bacteria 1082
76 Ga0157371_10007499 3300013102 Bacteria 8827
77 Ga0157370_10002070 3300013104 Bacteria 24567
78 Ga0157370_10328094 3300013104 Bacteria 1411
79 Ga0157369_10000130 3300013105 Bacteria 108193
80 Ga0157374_11529902 3300013296 Unclassified 691
81 Ga0157378_10061750 3300013297 Bacteria 3345
82 Ga0157378_10156216 3300013297 Bacteria 2130
83 Ga0163162_10463969 3300013306 Bacteria 1398
84 Ga0157375_11298523 3300013308 Bacteria 855
85 Ga0163163_11060140 3300014325 Bacteria 874
86 Ga0163163_11108602 3300014325 Bacteria 854
87 Ga0157380_10000028 3300014326 Bacteria 99836
88 Ga0157380_11303257 3300014326 Bacteria 774
89 Ga0157379_10232909 3300014968 Bacteria 1670
90 Ga0157379_10487580 3300014968 Bacteria 1141
91 Ga0157376_10626440 3300014969 Bacteria 1073
92 Ga0163161_10028415 3300017792 Bacteria 3972
93 Ga0163161_11646055 3300017792 Bacteria 567
94 Ga0207656_10007247 3300025321 Bacteria 4029
95 Ga0207642_10000203 3300025899 Bacteria 17481
96 Ga0207710_10000448 3300025900 Bacteria 26775
97 Ga0207680_10003287 3300025903 Bacteria 7616
98 Ga0207705_11432779 3300025909 Bacteria 524
99 Ga0207662_10559891 3300025918 Bacteria 792
100 Ga0207649_10000005 3300025920 Bacteria 356179
101 Ga0207650_10298620 3300025925 Bacteria 1315
102 Ga0207659_10000014 3300025926 Bacteria 168481
103 Ga0207687_10000011 3300025927 Bacteria 388349
104 Ga0207687_10005198 3300025927 Bacteria 8634
105 Ga0207644_10056111 3300025931 Unclassified 2842
106 Ga0207690_10041554 3300025932 Bacteria 3014
107 Ga0207686_10088392 3300025934 Bacteria 2040
108 Ga0207686_10090144 3300025934 Bacteria 2022
109 Ga0207709_10048996 3300025935 Bacteria 2576
110 Ga0207669_10000010 3300025937 Bacteria 150070
111 Ga0207704_10000045 3300025938 Bacteria 86589
112 Ga0207665_10021645 3300025939 Bacteria 4229
113 Ga0207691_10000429 3300025940 Bacteria 41790
114 Ga0207661_10000165 3300025944 Bacteria 43066
115 Ga0207679_10019148 3300025945 Bacteria 4595
116 Ga0207667_11562709 3300025949 Bacteria 629
117 Ga0207712_10004128 3300025961 Bacteria 9173
118 Ga0207668_10002386 3300025972 Bacteria 10977
119 Ga0207668_10377082 3300025972 Bacteria 1193
120 Ga0207658_10003653 3300025986 Bacteria 10855
121 Ga0207677_10159895 3300026023 Bacteria 1749
122 Ga0207703_10000126 3300026035 Bacteria 91860
123 Ga0207703_10105930 3300026035 Bacteria 2391
124 Ga0207703_10228786 3300026035 Bacteria 1666
125 Ga0207639_10064648 3300026041 Bacteria 2837
126 Ga0207708_10147231 3300026075 Bacteria 1851
127 Ga0207708_10189989 3300026075 Bacteria 1634
128 Ga0207702_10000865 3300026078 Bacteria 31579
129 Ga0207641_10004517 3300026088 Bacteria 12026
130 Ga0207641_10159395 3300026088 Bacteria 2050
131 Ga0207676_10000025 3300026095 Bacteria 261714
132 Ga0207674_10088722 3300026116 Bacteria 3085
133 Ga0207675_100198998 3300026118 Unclassified 1924
134 Ga0207683_10177766 3300026121 Bacteria 1929
135 Ga0207698_10000041 3300026142 Bacteria 97882
136 Ga0207698_10063185 3300026142 Bacteria 2896
137 Ga0207698_11510373 3300026142 Bacteria 687
138 Ga0268266_10000303 3300028379 Bacteria 78632
139 Ga0268266_10014991 3300028379 Bacteria 6654
140 Ga0268266_10086428 3300028379 Bacteria 2742
141 Ga0268266_10579209 3300028379 Bacteria 1077
142 Ga0268266_11005999 3300028379 Bacteria 807
143 Ga0268265_10002948 3300028380 Bacteria 12468
144 Ga0268264_10078535 3300028381 Bacteria 2814
145 Ga0268264_11146362 3300028381 Bacteria 786
146 Ga0265338_10562507 3300028800 Bacteria 797
147 Ga0307415_100001253 3300032126 Bacteria 11937
148 Ga0451807_0402315 3300041486 Bacteria 2461
149 Ga0451833_0381746 3300041491 Bacteria 918
150 Ga0451847_0450222 3300041503 Unclassified 572
151 Ga0451849_0466679 3300041505 Bacteria 942
152 Ga0451853_1953484 3300041512 Bacteria 2272
153 Ga0451853_2977364 3300041512 Bacteria 969
154 Ga0466963_0263736 3300044694 Unclassified 1209
155 Ga0466957_0000175 3300044842 Bacteria 28579
156 Ga0495629_0000055 3300046459 Bacteria 105268
157 Ga0495629_0009655 3300046459 Bacteria 7046
158 Ga0495638_0052911 3300046460 Bacteria 2528
159 Ga0495641_0013794 3300046461 Bacteria 4412
160 Ga0495641_0214201 3300046461 Bacteria 864
161 Ga0495653_0071253 3300046463 Bacteria 2599
162 Ga0495662_0025103 3300046476 Bacteria 2877
163 Ga0495594_0000007 3300046499 Bacteria 160047
164 Ga0495607_0543390 3300046501 Bacteria 511
165 Ga0495606_0000057 3300046507 Bacteria 197956
166 Ga0495618_0728730 3300046514 Bacteria 581
167 Ga0495620_0226691 3300046515 Unclassified 714
168 Ga0495628_0000061 3300046516 Bacteria 86531
169 Ga0495628_0251259 3300046516 Bacteria 1320
170 Ga0495630_0000025 3300046517 Bacteria 152364
171 Ga0495630_0224541 3300046517 Unclassified 1434
172 Ga0495644_0123549 3300046523 Bacteria 985
173 Ga0495652_0000003 3300046529 Bacteria 597094
174 Ga0495587_0001735 3300046536 Bacteria 14556
175 Ga0495587_0142722 3300046536 Unclassified 1366
176 Ga0495587_0743278 3300046536 Bacteria 537
177 Ga0495622_0000050 3300046557 Bacteria 106111
178 Ga0495667_0085179 3300046559 Bacteria 2051
179 Ga0495656_0002299 3300046615 Bacteria 6315
180 Ga0495634_0000296 3300046642 Bacteria 47756
181 Ga0495625_0000029 3300046660 Bacteria 244646
182 Ga0495635_1010820 3300046663 Unclassified 529
183 Ga0495588_0000243 3300046674 Bacteria 45920
184 Ga0495646_0408231 3300046680 Unclassified 705
185 Ga0495647_0005613 3300046681 Bacteria 4120
186 Ga0495658_0011556 3300046683 Bacteria 4445
187 Ga0495613_0000068 3300046689 Bacteria 101803
188 Ga0495613_0077128 3300046689 Bacteria 2425
189 Ga0495624_0000298 3300046690 Bacteria 39145
190 Ga0495600_0001659 3300046809 Bacteria 12411
191 Ga0495604_0000013 3300047317 Bacteria 234578
192 Ga0495604_0097412 3300047317 Bacteria 2169
193 Ga0495674_0000020 3300047319 Bacteria 178465
194 Ga0495676_0000729 3300047321 Bacteria 27371
195 Ga0495676_0101862 3300047321 Bacteria 2123
196 Ga0495680_0008842 3300047322 Bacteria 9112
197 Ga0495675_0661953 3300047444 Bacteria 587
198 Ga0495686_0065791 3300047472 Bacteria 2240
199 Ga0495602_0000009 3300048088 Bacteria 258991
200 Ga0495602_0000720 3300048088 Bacteria 31219
201 Ga0495602_0442821 3300048088 Bacteria 918
202 Ga0496100_0000012 3300048903 Bacteria 182426
203 Ga0496101_0000010 3300048904 Bacteria 281990
204 Ga0496103_0064022 3300048906 Bacteria 2291
205 Ga0496103_0258417 3300048906 Bacteria 1121
206 Ga0496103_0266193 3300048906 Bacteria 1103
207 Ga0496103_0968078 3300048906 Bacteria 531
208 Ga0496104_0000002 3300048907 Bacteria 686017
209 Ga0496105_0000001 3300048908 Bacteria 1328178
210 Ga0496106_0000017 3300048909 Bacteria 181561
211 Ga0496107_0000012 3300048910 Bacteria 181629
212 Ga0496107_0571476 3300048910 Bacteria 837
213 Ga0496108_0003785 3300048911 Bacteria 12109
214 Ga0496108_0030257 3300048911 Bacteria 4487
215 Ga0496108_0097915 3300048911 Bacteria 2499
216 Ga0496109_0000021 3300048912 Bacteria 189945
217 Ga0496109_0000039 3300048912 Bacteria 145769
218 Ga0496109_0626347 3300048912 Bacteria 1012
219 Ga0496110_0019743 3300048913 Bacteria 5678
220 Ga0496110_1161118 3300048913 Bacteria 681
221 Ga0496111_0240545 3300048914 Bacteria 1344
222 Ga0496113_0111893 3300048916 Bacteria 2126
223 Ga0496113_0300401 3300048916 Bacteria 1285
224 Ga0496113_0661470 3300048916 Bacteria 835
225 Ga0496114_0000003 3300048917 Bacteria 630981
226 Ga0496114_0599946 3300048917 Bacteria 971
227 Ga0496115_0000020 3300048918 Bacteria 171995
228 Ga0496115_0000036 3300048918 Bacteria 127774
229 Ga0496116_0001127 3300048919 Bacteria 31841
230 Ga0496117_0110939 3300048920 Bacteria 1709
231 Ga0496117_0538807 3300048920 Unclassified 558
232 Ga0496119_0001930 3300048922 Bacteria 23652
233 Ga0496119_0005650 3300048922 Bacteria 11872
234 Ga0496119_0053735 3300048922 Bacteria 2458
235 Ga0496120_0061637 3300048923 Unclassified 2092
236 Ga0496120_0082621 3300048923 Bacteria 1736
237 Ga0496121_0285288 3300048924 Bacteria 1127
238 Ga0496125_0475964 3300048928 Unclassified 709
239 Ga0496126_0228725 3300048929 Bacteria 1559
240 Ga0501039_0177073 3300049575 Bacteria 1677
241 Ga0501040_0802028 3300049576 Bacteria 681
242 Ga0501042_0061636 3300049578 Unclassified 2680
243 Ga0501042_0088023 3300049578 Bacteria 2228
244 Ga0501042_0164408 3300049578 Bacteria 1601
245 Ga0501047_0067878 3300049581 Bacteria 3435
246 Ga0501068_0050748 3300049584 Bacteria 2508
247 Ga0501070_0010598 3300049586 Bacteria 7791
248 Ga0501070_0427281 3300049586 Archaea 1070
249 Ga0501070_1149989 3300049586 Unclassified 597
250 Ga0501072_0024830 3300049588 Bacteria 4666
251 Ga0501072_0924295 3300049588 Unclassified 681
252 Ga0501076_0008550 3300049592 Bacteria 7507
253 Ga0501077_0125663 3300049593 Bacteria 1626
254 Ga0501080_1651760 3300049742 Unclassified 541
255 Ga0501081_0097099 3300049743 Bacteria 2079
256 Ga0501083_0007735 3300049744 Bacteria 7617
257 Ga0501044_0111512 3300049823 Bacteria 2743
258 nmdc:mga0qj67_130322_c1 3300050509 Bacteria 2037
259 nmdc:mga0a205_1659_c2 3300050515 Bacteria 16747
260 Ga0495601_0000036 3300053077 Bacteria 91625
261 Ga0495612_0000965 3300053078 Bacteria 11825
262 Ga0495655_0000004 3300053083 Bacteria 293683
263 Ga0495595_0067795 3300053084 Bacteria 1682
264 Ga0500641_0040812 3300053096 Bacteria 1875
265 Ga0500595_097817 3300053119 Bacteria 843
266 Ga0500595_153803 3300053119 Unclassified 642
267 Ga0500628_000004 3300053129 Bacteria 202098
268 Ga0500658_0293431 3300053134 Bacteria 747
269 Ga0500568_0132956 3300053139 Bacteria 924
270 Ga0501082_0944195 3300060353 Bacteria 754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0025103 Ga0495662_0025103_2431_2742 103
2 3300005337 Ga0070682_100316901 Ga0070682_1003169012 106
3 3300005441 Ga0070700_100807460 Ga0070700_1008074602 106
4 3300005719 Ga0068861_100240932 Ga0068861_1002409322 106
5 3300005719 Ga0068861_102578398 Ga0068861_1025783981 106
6 3300006237 Ga0097621_101143066 Ga0097621_1011430662 106
7 3300006358 Ga0068871_100078013 Ga0068871_1000780132 106
8 3300009553 Ga0105249_10709567 Ga0105249_107095672 106
9 3300013306 Ga0163162_10463969 Ga0163162_104639692 106
10 3300017792 Ga0163161_10028415 Ga0163161_100284152 106
11 3300025938 Ga0207704_10000045 Ga0207704_1000004516 106
12 3300026075 Ga0207708_10147231 Ga0207708_101472312 106
13 3300026118 Ga0207675_100198998 Ga0207675_1001989982 106
14 3300041503 Ga0451847_0450222 Ga0451847_0450222_163_483 106
15 3300041505 Ga0451849_0466679 Ga0451849_0466679_504_824 106
16 3300041512 Ga0451853_2977364 Ga0451853_2977364_536_856 106
17 3300048919 Ga0496116_0001127 Ga0496116_0001127_18773_19099 106
18 3300048920 Ga0496117_0110939 Ga0496117_0110939_979_1305 106
19 3300048922 Ga0496119_0001930 Ga0496119_0001930_10486_10812 106
20 3300048924 Ga0496121_0285288 Ga0496121_0285288_205_531 106
21 3300048928 Ga0496125_0475964 Ga0496125_0475964_245_571 106
22 3300048929 Ga0496126_0228725 Ga0496126_0228725_105_431 106
23 3300049578 Ga0501042_0164408 Ga0501042_0164408_1197_1574 106
24 3300049581 Ga0501047_0067878 Ga0501047_0067878_3065_3394 106
25 3300049588 Ga0501072_0924295 Ga0501072_0924295_79_399 106
26 3300049592 Ga0501076_0008550 Ga0501076_0008550_482_802 106
27 3300049742 Ga0501080_1651760 Ga0501080_1651760_123_449 106
28 3300053119 Ga0500595_097817 Ga0500595_097817_267_593 106
29 3300053119 Ga0500595_153803 Ga0500595_153803_110_436 106
30 3300053134 Ga0500658_0293431 Ga0500658_0293431_38_364 106
31 3300053139 Ga0500568_0132956 Ga0500568_0132956_10_336 106
32 3300001977 JGI24746J21847_1000014 JGI24746J21847_10000146 107
33 3300001978 JGI24747J21853_1039567 JGI24747J21853_10395671 107
34 3300001979 JGI24740J21852_10000990 JGI24740J21852_1000099011 107
35 3300002074 JGI24748J21848_1001029 JGI24748J21848_10010292 107
36 3300002239 JGI24034J26672_10000856 JGI24034J26672_100008562 107
37 3300003316 rootH1_10118456 rootH1_101184562 107
38 3300003322 rootL2_10141448 rootL2_101414482 107
39 3300003659 JGI25404J52841_10013720 JGI25404J52841_100137202 107
40 3300005329 Ga0070683_100010256 Ga0070683_1000102565 107
41 3300005338 Ga0068868_100074696 Ga0068868_1000746962 107
42 3300005341 Ga0070691_10000064 Ga0070691_1000006432 107
43 3300005341 Ga0070691_10025761 Ga0070691_100257612 107
44 3300005344 Ga0070661_100000005 Ga0070661_10000000569 107
45 3300005344 Ga0070661_100785314 Ga0070661_1007853142 107
46 3300005347 Ga0070668_100459498 Ga0070668_1004594982 107
47 3300005354 Ga0070675_100005523 Ga0070675_10000552313 107
48 3300005356 Ga0070674_100000006 Ga0070674_100000006100 107
49 3300005365 Ga0070688_100002070 Ga0070688_1000020705 107
50 3300005365 Ga0070688_100003416 Ga0070688_10000341611 107
51 3300005366 Ga0070659_100016884 Ga0070659_1000168844 107
52 3300005367 Ga0070667_100001507 Ga0070667_10000150710 107
53 3300005438 Ga0070701_10112666 Ga0070701_101126662 107
54 3300005466 Ga0070685_10000021 Ga0070685_100000216 107
55 3300005466 Ga0070685_10000111 Ga0070685_1000011150 107
56 3300005535 Ga0070684_100176812 Ga0070684_1001768122 107
57 3300005543 Ga0070672_100000580 Ga0070672_10000058019 107
58 3300005544 Ga0070686_100108345 Ga0070686_1001083453 107
59 3300005544 Ga0070686_100543310 Ga0070686_1005433102 107
60 3300005545 Ga0070695_100051558 Ga0070695_1000515582 107
61 3300005548 Ga0070665_100001200 Ga0070665_10000120021 107
62 3300005548 Ga0070665_100045804 Ga0070665_1000458044 107
63 3300005548 Ga0070665_100115833 Ga0070665_1001158334 107
64 3300005548 Ga0070665_100729657 Ga0070665_1007296572 107
65 3300005548 Ga0070665_101139921 Ga0070665_1011399212 107
66 3300005549 Ga0070704_100121392 Ga0070704_1001213922 107
67 3300005563 Ga0068855_100083762 Ga0068855_1000837622 107
68 3300005564 Ga0070664_100030206 Ga0070664_1000302062 107
69 3300005577 Ga0068857_100020990 Ga0068857_1000209905 107
70 3300005615 Ga0070702_100682007 Ga0070702_1006820072 107
71 3300005616 Ga0068852_100097436 Ga0068852_1000974365 107
72 3300005618 Ga0068864_100000023 Ga0068864_10000002374 107
73 3300005718 Ga0068866_10000731 Ga0068866_100007314 107
74 3300005719 Ga0068861_101320534 Ga0068861_1013205342 107
75 3300005841 Ga0068863_100005063 Ga0068863_1000050632 107
76 3300005841 Ga0068863_100157893 Ga0068863_1001578933 107
77 3300005842 Ga0068858_100000033 Ga0068858_100000033119 107
78 3300005842 Ga0068858_100183925 Ga0068858_1001839254 107
79 3300005842 Ga0068858_100198869 Ga0068858_1001988692 107
80 3300005843 Ga0068860_100884790 Ga0068860_1008847902 107
81 3300005844 Ga0068862_100000050 Ga0068862_1000000506 107
82 3300005983 Ga0081540_1000106 Ga0081540_100010664 107
83 3300005985 Ga0081539_10000504 Ga0081539_1000050487 107
84 3300006846 Ga0075430_100378157 Ga0075430_1003781573 107
85 3300006852 Ga0075433_10003789 Ga0075433_100037892 107
86 3300009093 Ga0105240_10226254 Ga0105240_102262542 107
87 3300009098 Ga0105245_10000365 Ga0105245_1000036538 107
88 3300009098 Ga0105245_10006637 Ga0105245_100066375 107
89 3300009101 Ga0105247_10000105 Ga0105247_1000010571 107
90 3300009148 Ga0105243_10090903 Ga0105243_100909032 107
91 3300009148 Ga0105243_10122286 Ga0105243_101222862 107
92 3300009176 Ga0105242_10000335 Ga0105242_100003359 107
93 3300009176 Ga0105242_10063493 Ga0105242_100634935 107
94 3300009545 Ga0105237_10086987 Ga0105237_100869872 107
95 3300009545 Ga0105237_10705647 Ga0105237_107056472 107
96 3300009551 Ga0105238_11057302 Ga0105238_110573022 107
97 3300009553 Ga0105249_10008206 Ga0105249_1000820610 107
98 3300010375 Ga0105239_10053058 Ga0105239_100530585 107
99 3300010375 Ga0105239_10797747 Ga0105239_107977472 107
100 3300013102 Ga0157371_10007499 Ga0157371_100074999 107
101 3300013104 Ga0157370_10002070 Ga0157370_1000207022 107
102 3300013104 Ga0157370_10328094 Ga0157370_103280942 107
103 3300013105 Ga0157369_10000130 Ga0157369_1000013074 107
104 3300013296 Ga0157374_11529902 Ga0157374_115299021 107
105 3300013297 Ga0157378_10061750 Ga0157378_100617502 107
106 3300013297 Ga0157378_10156216 Ga0157378_101562162 107
107 3300013308 Ga0157375_11298523 Ga0157375_112985232 107
108 3300014325 Ga0163163_11060140 Ga0163163_110601402 107
109 3300014325 Ga0163163_11108602 Ga0163163_111086021 107
110 3300014326 Ga0157380_10000028 Ga0157380_100000286 107
111 3300014326 Ga0157380_11303257 Ga0157380_113032572 107
112 3300014968 Ga0157379_10232909 Ga0157379_102329092 107
113 3300014968 Ga0157379_10487580 Ga0157379_104875802 107
114 3300014969 Ga0157376_10626440 Ga0157376_106264402 107
115 3300017792 Ga0163161_11646055 Ga0163161_116460552 107
116 3300025321 Ga0207656_10007247 Ga0207656_100072475 107
117 3300025899 Ga0207642_10000203 Ga0207642_1000020318 107
118 3300025900 Ga0207710_10000448 Ga0207710_1000044811 107
119 3300025903 Ga0207680_10003287 Ga0207680_100032872 107
120 3300025909 Ga0207705_11432779 Ga0207705_114327791 107
121 3300025918 Ga0207662_10559891 Ga0207662_105598911 107
122 3300025920 Ga0207649_10000005 Ga0207649_10000005213 107
123 3300025925 Ga0207650_10298620 Ga0207650_102986202 107
124 3300025926 Ga0207659_10000014 Ga0207659_1000001413 107
125 3300025927 Ga0207687_10000011 Ga0207687_1000001117 107
126 3300025927 Ga0207687_10005198 Ga0207687_100051984 107
127 3300025931 Ga0207644_10056111 Ga0207644_100561112 107
128 3300025932 Ga0207690_10041554 Ga0207690_100415545 107
129 3300025934 Ga0207686_10088392 Ga0207686_100883922 107
130 3300025934 Ga0207686_10090144 Ga0207686_100901442 107
131 3300025935 Ga0207709_10048996 Ga0207709_100489962 107
132 3300025937 Ga0207669_10000010 Ga0207669_1000001059 107
133 3300025939 Ga0207665_10021645 Ga0207665_100216454 107
134 3300025940 Ga0207691_10000429 Ga0207691_100004296 107
135 3300025944 Ga0207661_10000165 Ga0207661_100001656 107
136 3300025945 Ga0207679_10019148 Ga0207679_100191482 107
137 3300025949 Ga0207667_11562709 Ga0207667_115627092 107
138 3300025961 Ga0207712_10004128 Ga0207712_100041283 107
139 3300025972 Ga0207668_10002386 Ga0207668_100023867 107
140 3300025972 Ga0207668_10377082 Ga0207668_103770822 107
141 3300025986 Ga0207658_10003653 Ga0207658_100036534 107
142 3300026023 Ga0207677_10159895 Ga0207677_101598952 107
143 3300026035 Ga0207703_10000126 Ga0207703_1000012654 107
144 3300026035 Ga0207703_10105930 Ga0207703_101059304 107
145 3300026035 Ga0207703_10228786 Ga0207703_102287862 107
146 3300026041 Ga0207639_10064648 Ga0207639_100646482 107
147 3300026075 Ga0207708_10189989 Ga0207708_101899892 107
148 3300026078 Ga0207702_10000865 Ga0207702_100008652 107
149 3300026088 Ga0207641_10004517 Ga0207641_1000451712 107
150 3300026088 Ga0207641_10159395 Ga0207641_101593951 107
151 3300026095 Ga0207676_10000025 Ga0207676_10000025203 107
152 3300026116 Ga0207674_10088722 Ga0207674_100887222 107
153 3300026121 Ga0207683_10177766 Ga0207683_101777662 107
154 3300026142 Ga0207698_10000041 Ga0207698_10000041103 107
155 3300026142 Ga0207698_10063185 Ga0207698_100631852 107
156 3300026142 Ga0207698_11510373 Ga0207698_115103732 107
157 3300028379 Ga0268266_10000303 Ga0268266_1000030320 107
158 3300028379 Ga0268266_10014991 Ga0268266_100149913 107
159 3300028379 Ga0268266_10086428 Ga0268266_100864284 107
160 3300028379 Ga0268266_10579209 Ga0268266_105792092 107
161 3300028379 Ga0268266_11005999 Ga0268266_110059992 107
162 3300028380 Ga0268265_10002948 Ga0268265_100029482 107
163 3300028381 Ga0268264_10078535 Ga0268264_100785352 107
164 3300028381 Ga0268264_11146362 Ga0268264_111463622 107
165 3300028800 Ga0265338_10562507 Ga0265338_105625072 107
166 3300032126 Ga0307415_100001253 Ga0307415_1000012536 107
167 3300041486 Ga0451807_0402315 Ga0451807_0402315_1815_2138 107
168 3300041491 Ga0451833_0381746 Ga0451833_0381746_479_802 107
169 3300041512 Ga0451853_1953484 Ga0451853_1953484_1457_1780 107
170 3300044694 Ga0466963_0263736 Ga0466963_0263736_460_783 107
171 3300044842 Ga0466957_0000175 Ga0466957_0000175_18001_18324 107
172 3300046459 Ga0495629_0000055 Ga0495629_0000055_10246_10569 107
173 3300046459 Ga0495629_0009655 Ga0495629_0009655_1108_1431 107
174 3300046460 Ga0495638_0052911 Ga0495638_0052911_522_845 107
175 3300046461 Ga0495641_0013794 Ga0495641_0013794_1786_2109 107
176 3300046461 Ga0495641_0214201 Ga0495641_0214201_198_521 107
177 3300046463 Ga0495653_0071253 Ga0495653_0071253_1773_2096 107
178 3300046499 Ga0495594_0000007 Ga0495594_0000007_16750_17073 107
179 3300046501 Ga0495607_0543390 Ga0495607_0543390_29_352 107
180 3300046507 Ga0495606_0000057 Ga0495606_0000057_58210_58533 107
181 3300046514 Ga0495618_0728730 Ga0495618_0728730_97_420 107
182 3300046515 Ga0495620_0226691 Ga0495620_0226691_40_363 107
183 3300046516 Ga0495628_0000061 Ga0495628_0000061_54126_54449 107
184 3300046516 Ga0495628_0251259 Ga0495628_0251259_942_1265 107
185 3300046517 Ga0495630_0000025 Ga0495630_0000025_93322_93645 107
186 3300046517 Ga0495630_0224541 Ga0495630_0224541_559_882 107
187 3300046523 Ga0495644_0123549 Ga0495644_0123549_489_812 107
188 3300046529 Ga0495652_0000003 Ga0495652_0000003_151332_151655 107
189 3300046536 Ga0495587_0001735 Ga0495587_0001735_2540_2863 107
190 3300046536 Ga0495587_0142722 Ga0495587_0142722_314_637 107
191 3300046536 Ga0495587_0743278 Ga0495587_0743278_71_394 107
192 3300046557 Ga0495622_0000050 Ga0495622_0000050_64288_64611 107
193 3300046559 Ga0495667_0085179 Ga0495667_0085179_166_489 107
194 3300046615 Ga0495656_0002299 Ga0495656_0002299_4301_4624 107
195 3300046642 Ga0495634_0000296 Ga0495634_0000296_31979_32302 107
196 3300046660 Ga0495625_0000029 Ga0495625_0000029_138214_138537 107
197 3300046663 Ga0495635_1010820 Ga0495635_1010820_192_515 107
198 3300046674 Ga0495588_0000243 Ga0495588_0000243_8990_9313 107
199 3300046680 Ga0495646_0408231 Ga0495646_0408231_45_368 107
200 3300046681 Ga0495647_0005613 Ga0495647_0005613_1560_1883 107
201 3300046683 Ga0495658_0011556 Ga0495658_0011556_3963_4286 107
202 3300046689 Ga0495613_0000068 Ga0495613_0000068_86040_86363 107
203 3300046689 Ga0495613_0077128 Ga0495613_0077128_1251_1574 107
204 3300046690 Ga0495624_0000298 Ga0495624_0000298_29783_30106 107
205 3300046809 Ga0495600_0001659 Ga0495600_0001659_3269_3592 107
206 3300047317 Ga0495604_0000013 Ga0495604_0000013_6798_7121 107
207 3300047317 Ga0495604_0097412 Ga0495604_0097412_1002_1325 107
208 3300047319 Ga0495674_0000020 Ga0495674_0000020_61371_61694 107
209 3300047321 Ga0495676_0000729 Ga0495676_0000729_5317_5640 107
210 3300047321 Ga0495676_0101862 Ga0495676_0101862_672_995 107
211 3300047322 Ga0495680_0008842 Ga0495680_0008842_558_881 107
212 3300047444 Ga0495675_0661953 Ga0495675_0661953_84_407 107
213 3300047472 Ga0495686_0065791 Ga0495686_0065791_1181_1504 107
214 3300048088 Ga0495602_0000009 Ga0495602_0000009_12436_12759 107
215 3300048088 Ga0495602_0000720 Ga0495602_0000720_1579_1902 107
216 3300048088 Ga0495602_0442821 Ga0495602_0442821_133_456 107
217 3300048903 Ga0496100_0000012 Ga0496100_0000012_126164_126487 107
218 3300048904 Ga0496101_0000010 Ga0496101_0000010_155718_156041 107
219 3300048906 Ga0496103_0064022 Ga0496103_0064022_623_946 107
220 3300048906 Ga0496103_0258417 Ga0496103_0258417_270_593 107
221 3300048906 Ga0496103_0266193 Ga0496103_0266193_22_345 107
222 3300048906 Ga0496103_0968078 Ga0496103_0968078_97_420 107
223 3300048907 Ga0496104_0000002 Ga0496104_0000002_534350_534673 107
224 3300048908 Ga0496105_0000001 Ga0496105_0000001_793506_793829 107
225 3300048909 Ga0496106_0000017 Ga0496106_0000017_125876_126199 107
226 3300048910 Ga0496107_0000012 Ga0496107_0000012_55357_55680 107
227 3300048910 Ga0496107_0571476 Ga0496107_0571476_428_751 107
228 3300048911 Ga0496108_0003785 Ga0496108_0003785_747_1070 107
229 3300048911 Ga0496108_0030257 Ga0496108_0030257_1371_1694 107
230 3300048911 Ga0496108_0097915 Ga0496108_0097915_784_1125 107
231 3300048912 Ga0496109_0000021 Ga0496109_0000021_743_1066 107
232 3300048912 Ga0496109_0000039 Ga0496109_0000039_75134_75457 107
233 3300048912 Ga0496109_0626347 Ga0496109_0626347_125_448 107
234 3300048913 Ga0496110_0019743 Ga0496110_0019743_2960_3283 107
235 3300048913 Ga0496110_1161118 Ga0496110_1161118_305_628 107
236 3300048914 Ga0496111_0240545 Ga0496111_0240545_171_494 107
237 3300048916 Ga0496113_0111893 Ga0496113_0111893_117_458 107
238 3300048916 Ga0496113_0300401 Ga0496113_0300401_532_855 107
239 3300048916 Ga0496113_0661470 Ga0496113_0661470_205_528 107
240 3300048917 Ga0496114_0000003 Ga0496114_0000003_183314_183637 107
241 3300048917 Ga0496114_0599946 Ga0496114_0599946_598_921 107
242 3300048918 Ga0496115_0000020 Ga0496115_0000020_117455_117778 107
243 3300048918 Ga0496115_0000036 Ga0496115_0000036_86131_86454 107
244 3300048920 Ga0496117_0538807 Ga0496117_0538807_187_516 107
245 3300048922 Ga0496119_0005650 Ga0496119_0005650_5383_5706 107
246 3300048922 Ga0496119_0053735 Ga0496119_0053735_604_933 107
247 3300048923 Ga0496120_0061637 Ga0496120_0061637_244_573 107
248 3300048923 Ga0496120_0082621 Ga0496120_0082621_1208_1531 107
249 3300049575 Ga0501039_0177073 Ga0501039_0177073_817_1140 107
250 3300049576 Ga0501040_0802028 Ga0501040_0802028_320_643 107
251 3300049578 Ga0501042_0061636 Ga0501042_0061636_135_458 107
252 3300049578 Ga0501042_0088023 Ga0501042_0088023_1476_1799 107
253 3300049584 Ga0501068_0050748 Ga0501068_0050748_350_673 107
254 3300049586 Ga0501070_0010598 Ga0501070_0010598_2789_3112 107
255 3300049586 Ga0501070_0427281 Ga0501070_0427281_647_970 107
256 3300049586 Ga0501070_1149989 Ga0501070_1149989_201_524 107
257 3300049588 Ga0501072_0024830 Ga0501072_0024830_4266_4589 107
258 3300049593 Ga0501077_0125663 Ga0501077_0125663_544_867 107
259 3300049743 Ga0501081_0097099 Ga0501081_0097099_966_1307 107
260 3300049744 Ga0501083_0007735 Ga0501083_0007735_2309_2641 107
261 3300049823 Ga0501044_0111512 Ga0501044_0111512_2127_2459 107
262 3300050509 nmdc:mga0qj67_130322_c1 nmdc:mga0qj67_130322_c1_1560_1883 107
263 3300050515 nmdc:mga0a205_1659_c2 nmdc:mga0a205_1659_c2_13589_13912 107
264 3300053077 Ga0495601_0000036 Ga0495601_0000036_38885_39208 107
265 3300053078 Ga0495612_0000965 Ga0495612_0000965_3710_4033 107
266 3300053083 Ga0495655_0000004 Ga0495655_0000004_97529_97852 107
267 3300053084 Ga0495595_0067795 Ga0495595_0067795_465_788 107
268 3300053096 Ga0500641_0040812 Ga0500641_0040812_28_351 107
269 3300053129 Ga0500628_000004 Ga0500628_000004_5944_6267 107
270 3300060353 Ga0501082_0944195 Ga0501082_0944195_24_347 107

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.3684 5 97
1x90-assembly1.cif.gz_A crystal structure of mutant form b of a pectin methylesterase inhibitor from arabidopsis 0.3408 5 97
6azh-assembly1.cif.gz_B clostridium perfringens putative fatty acid metabolism regulator 0.333 5 97
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.3301 5 97
2px6-assembly1.cif.gz_A crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat 0.3253 31 99
ID Description Score Start End Superfamily
af_D4ABV2_65_150_3.30.430.20 Alpha Beta;2-Layer Sandwich;Killer Toxin P4; Chain A;Gnk2 domain, C-X8-C-X2-C motif 0.4033 6 83 3.30.430.20
1x8zC00 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3684 5 97 1.20.140.40
af_Q61301_150_261_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3613 6 97 1.20.120.230
af_A0A0R4IY81_185_276_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.3513 3 94 1.10.533.10
af_Q9C7Z2_46_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3448 5 97 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A538CLJ0-F1-model_v4 Uncharacterized protein 0.916 5 95
AF-A0A1M3BMH6-F1-model_v4 Uncharacterized protein 0.9083 1 103
AF-A0A6J4RKF7-F1-model_v4 TipAS antibiotic-recognition domain-containing protein 0.9072 4 98
AF-A0A7V9CR68-F1-model_v4 DUF501 domain-containing protein 0.8932 5 99
AF-A0A7W0NJP6-F1-model_v4 Uncharacterized protein 0.8845 5 99

Feature Viewer

pLDDT pTM Quality
89.49 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map