F377240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 195 | 270 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300049578|Ga0501042_0164408|Ga0501042_0164408_1197_1574 |
| Length | 125 |
| Sequence | VGDKGHTRGRRIGLGKLDRVSYPLENALFQWEDGYRELQALRDPKARRLADRVVDAVREELRRRIGPTFGAAELAELYGRGTDWCQQIAIDVAPAVADPQTLADAAFWLYLRGATDFAGGKQLIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 110 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 111 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 165 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 191 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 193 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0 |
| Rhizoplane | 10.37 |
| Rhizosphere | 80.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000014 | 3300001977 | Bacteria | 16789 |
| 2 | JGI24747J21853_1039567 | 3300001978 | Bacteria | 557 |
| 3 | JGI24740J21852_10000990 | 3300001979 | Bacteria | 12697 |
| 4 | JGI24748J21848_1001029 | 3300002074 | Bacteria | 3032 |
| 5 | JGI24034J26672_10000856 | 3300002239 | Bacteria | 3955 |
| 6 | rootH1_10118456 | 3300003316 | Bacteria | 1824 |
| 7 | rootL2_10141448 | 3300003322 | Bacteria | 1937 |
| 8 | JGI25404J52841_10013720 | 3300003659 | Bacteria | 1757 |
| 9 | Ga0070683_100010256 | 3300005329 | Bacteria | 8051 |
| 10 | Ga0070682_100316901 | 3300005337 | Bacteria | 1150 |
| 11 | Ga0068868_100074696 | 3300005338 | Bacteria | 2708 |
| 12 | Ga0070691_10000064 | 3300005341 | Bacteria | 29794 |
| 13 | Ga0070691_10025761 | 3300005341 | Bacteria | 2740 |
| 14 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 15 | Ga0070661_100785314 | 3300005344 | Bacteria | 781 |
| 16 | Ga0070668_100459498 | 3300005347 | Bacteria | 1096 |
| 17 | Ga0070675_100005523 | 3300005354 | Bacteria | 9677 |
| 18 | Ga0070674_100000006 | 3300005356 | Bacteria | 150063 |
| 19 | Ga0070688_100002070 | 3300005365 | Bacteria | 10125 |
| 20 | Ga0070688_100003416 | 3300005365 | Bacteria | 8157 |
| 21 | Ga0070659_100016884 | 3300005366 | Bacteria | 5486 |
| 22 | Ga0070667_100001507 | 3300005367 | Bacteria | 20839 |
| 23 | Ga0070701_10112666 | 3300005438 | Bacteria | 1522 |
| 24 | Ga0070700_100807460 | 3300005441 | Bacteria | 756 |
| 25 | Ga0070685_10000021 | 3300005466 | Bacteria | 103600 |
| 26 | Ga0070685_10000111 | 3300005466 | Bacteria | 52039 |
| 27 | Ga0070684_100176812 | 3300005535 | Bacteria | 1940 |
| 28 | Ga0070672_100000580 | 3300005543 | Bacteria | 21508 |
| 29 | Ga0070686_100108345 | 3300005544 | Unclassified | 1888 |
| 30 | Ga0070686_100543310 | 3300005544 | Bacteria | 908 |
| 31 | Ga0070695_100051558 | 3300005545 | Unclassified | 2641 |
| 32 | Ga0070665_100001200 | 3300005548 | Bacteria | 31604 |
| 33 | Ga0070665_100045804 | 3300005548 | Bacteria | 4393 |
| 34 | Ga0070665_100115833 | 3300005548 | Bacteria | 2683 |
| 35 | Ga0070665_100729657 | 3300005548 | Bacteria | 1004 |
| 36 | Ga0070665_101139921 | 3300005548 | Bacteria | 791 |
| 37 | Ga0070704_100121392 | 3300005549 | Bacteria | 2008 |
| 38 | Ga0068855_100083762 | 3300005563 | Bacteria | 3694 |
| 39 | Ga0070664_100030206 | 3300005564 | Bacteria | 4521 |
| 40 | Ga0068857_100020990 | 3300005577 | Bacteria | 5747 |
| 41 | Ga0070702_100682007 | 3300005615 | Unclassified | 781 |
| 42 | Ga0068852_100097436 | 3300005616 | Bacteria | 2646 |
| 43 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 44 | Ga0068866_10000731 | 3300005718 | Bacteria | 14876 |
| 45 | Ga0068861_100240932 | 3300005719 | Unclassified | 1538 |
| 46 | Ga0068861_101320534 | 3300005719 | Bacteria | 702 |
| 47 | Ga0068861_102578398 | 3300005719 | Bacteria | 512 |
| 48 | Ga0068863_100005063 | 3300005841 | Bacteria | 13003 |
| 49 | Ga0068863_100157893 | 3300005841 | Bacteria | 2172 |
| 50 | Ga0068858_100000033 | 3300005842 | Bacteria | 142748 |
| 51 | Ga0068858_100183925 | 3300005842 | Bacteria | 1974 |
| 52 | Ga0068858_100198869 | 3300005842 | Bacteria | 1895 |
| 53 | Ga0068860_100884790 | 3300005843 | Bacteria | 909 |
| 54 | Ga0068862_100000050 | 3300005844 | Bacteria | 145502 |
| 55 | Ga0081540_1000106 | 3300005983 | Bacteria | 89767 |
| 56 | Ga0081539_10000504 | 3300005985 | Bacteria | 81870 |
| 57 | Ga0097621_101143066 | 3300006237 | Bacteria | 732 |
| 58 | Ga0068871_100078013 | 3300006358 | Bacteria | 2738 |
| 59 | Ga0075430_100378157 | 3300006846 | Bacteria | 1169 |
| 60 | Ga0075433_10003789 | 3300006852 | Bacteria | 11715 |
| 61 | Ga0105240_10226254 | 3300009093 | Bacteria | 2177 |
| 62 | Ga0105245_10000365 | 3300009098 | Bacteria | 42328 |
| 63 | Ga0105245_10006637 | 3300009098 | Bacteria | 10161 |
| 64 | Ga0105247_10000105 | 3300009101 | Bacteria | 87578 |
| 65 | Ga0105243_10090903 | 3300009148 | Bacteria | 2513 |
| 66 | Ga0105243_10122286 | 3300009148 | Unclassified | 2196 |
| 67 | Ga0105242_10000335 | 3300009176 | Bacteria | 37854 |
| 68 | Ga0105242_10063493 | 3300009176 | Bacteria | 3041 |
| 69 | Ga0105237_10086987 | 3300009545 | Bacteria | 3115 |
| 70 | Ga0105237_10705647 | 3300009545 | Bacteria | 1015 |
| 71 | Ga0105238_11057302 | 3300009551 | Bacteria | 834 |
| 72 | Ga0105249_10008206 | 3300009553 | Bacteria | 9099 |
| 73 | Ga0105249_10709567 | 3300009553 | Unclassified | 1066 |
| 74 | Ga0105239_10053058 | 3300010375 | Bacteria | 4448 |
| 75 | Ga0105239_10797747 | 3300010375 | Bacteria | 1082 |
| 76 | Ga0157371_10007499 | 3300013102 | Bacteria | 8827 |
| 77 | Ga0157370_10002070 | 3300013104 | Bacteria | 24567 |
| 78 | Ga0157370_10328094 | 3300013104 | Bacteria | 1411 |
| 79 | Ga0157369_10000130 | 3300013105 | Bacteria | 108193 |
| 80 | Ga0157374_11529902 | 3300013296 | Unclassified | 691 |
| 81 | Ga0157378_10061750 | 3300013297 | Bacteria | 3345 |
| 82 | Ga0157378_10156216 | 3300013297 | Bacteria | 2130 |
| 83 | Ga0163162_10463969 | 3300013306 | Bacteria | 1398 |
| 84 | Ga0157375_11298523 | 3300013308 | Bacteria | 855 |
| 85 | Ga0163163_11060140 | 3300014325 | Bacteria | 874 |
| 86 | Ga0163163_11108602 | 3300014325 | Bacteria | 854 |
| 87 | Ga0157380_10000028 | 3300014326 | Bacteria | 99836 |
| 88 | Ga0157380_11303257 | 3300014326 | Bacteria | 774 |
| 89 | Ga0157379_10232909 | 3300014968 | Bacteria | 1670 |
| 90 | Ga0157379_10487580 | 3300014968 | Bacteria | 1141 |
| 91 | Ga0157376_10626440 | 3300014969 | Bacteria | 1073 |
| 92 | Ga0163161_10028415 | 3300017792 | Bacteria | 3972 |
| 93 | Ga0163161_11646055 | 3300017792 | Bacteria | 567 |
| 94 | Ga0207656_10007247 | 3300025321 | Bacteria | 4029 |
| 95 | Ga0207642_10000203 | 3300025899 | Bacteria | 17481 |
| 96 | Ga0207710_10000448 | 3300025900 | Bacteria | 26775 |
| 97 | Ga0207680_10003287 | 3300025903 | Bacteria | 7616 |
| 98 | Ga0207705_11432779 | 3300025909 | Bacteria | 524 |
| 99 | Ga0207662_10559891 | 3300025918 | Bacteria | 792 |
| 100 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 101 | Ga0207650_10298620 | 3300025925 | Bacteria | 1315 |
| 102 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 103 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 104 | Ga0207687_10005198 | 3300025927 | Bacteria | 8634 |
| 105 | Ga0207644_10056111 | 3300025931 | Unclassified | 2842 |
| 106 | Ga0207690_10041554 | 3300025932 | Bacteria | 3014 |
| 107 | Ga0207686_10088392 | 3300025934 | Bacteria | 2040 |
| 108 | Ga0207686_10090144 | 3300025934 | Bacteria | 2022 |
| 109 | Ga0207709_10048996 | 3300025935 | Bacteria | 2576 |
| 110 | Ga0207669_10000010 | 3300025937 | Bacteria | 150070 |
| 111 | Ga0207704_10000045 | 3300025938 | Bacteria | 86589 |
| 112 | Ga0207665_10021645 | 3300025939 | Bacteria | 4229 |
| 113 | Ga0207691_10000429 | 3300025940 | Bacteria | 41790 |
| 114 | Ga0207661_10000165 | 3300025944 | Bacteria | 43066 |
| 115 | Ga0207679_10019148 | 3300025945 | Bacteria | 4595 |
| 116 | Ga0207667_11562709 | 3300025949 | Bacteria | 629 |
| 117 | Ga0207712_10004128 | 3300025961 | Bacteria | 9173 |
| 118 | Ga0207668_10002386 | 3300025972 | Bacteria | 10977 |
| 119 | Ga0207668_10377082 | 3300025972 | Bacteria | 1193 |
| 120 | Ga0207658_10003653 | 3300025986 | Bacteria | 10855 |
| 121 | Ga0207677_10159895 | 3300026023 | Bacteria | 1749 |
| 122 | Ga0207703_10000126 | 3300026035 | Bacteria | 91860 |
| 123 | Ga0207703_10105930 | 3300026035 | Bacteria | 2391 |
| 124 | Ga0207703_10228786 | 3300026035 | Bacteria | 1666 |
| 125 | Ga0207639_10064648 | 3300026041 | Bacteria | 2837 |
| 126 | Ga0207708_10147231 | 3300026075 | Bacteria | 1851 |
| 127 | Ga0207708_10189989 | 3300026075 | Bacteria | 1634 |
| 128 | Ga0207702_10000865 | 3300026078 | Bacteria | 31579 |
| 129 | Ga0207641_10004517 | 3300026088 | Bacteria | 12026 |
| 130 | Ga0207641_10159395 | 3300026088 | Bacteria | 2050 |
| 131 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 132 | Ga0207674_10088722 | 3300026116 | Bacteria | 3085 |
| 133 | Ga0207675_100198998 | 3300026118 | Unclassified | 1924 |
| 134 | Ga0207683_10177766 | 3300026121 | Bacteria | 1929 |
| 135 | Ga0207698_10000041 | 3300026142 | Bacteria | 97882 |
| 136 | Ga0207698_10063185 | 3300026142 | Bacteria | 2896 |
| 137 | Ga0207698_11510373 | 3300026142 | Bacteria | 687 |
| 138 | Ga0268266_10000303 | 3300028379 | Bacteria | 78632 |
| 139 | Ga0268266_10014991 | 3300028379 | Bacteria | 6654 |
| 140 | Ga0268266_10086428 | 3300028379 | Bacteria | 2742 |
| 141 | Ga0268266_10579209 | 3300028379 | Bacteria | 1077 |
| 142 | Ga0268266_11005999 | 3300028379 | Bacteria | 807 |
| 143 | Ga0268265_10002948 | 3300028380 | Bacteria | 12468 |
| 144 | Ga0268264_10078535 | 3300028381 | Bacteria | 2814 |
| 145 | Ga0268264_11146362 | 3300028381 | Bacteria | 786 |
| 146 | Ga0265338_10562507 | 3300028800 | Bacteria | 797 |
| 147 | Ga0307415_100001253 | 3300032126 | Bacteria | 11937 |
| 148 | Ga0451807_0402315 | 3300041486 | Bacteria | 2461 |
| 149 | Ga0451833_0381746 | 3300041491 | Bacteria | 918 |
| 150 | Ga0451847_0450222 | 3300041503 | Unclassified | 572 |
| 151 | Ga0451849_0466679 | 3300041505 | Bacteria | 942 |
| 152 | Ga0451853_1953484 | 3300041512 | Bacteria | 2272 |
| 153 | Ga0451853_2977364 | 3300041512 | Bacteria | 969 |
| 154 | Ga0466963_0263736 | 3300044694 | Unclassified | 1209 |
| 155 | Ga0466957_0000175 | 3300044842 | Bacteria | 28579 |
| 156 | Ga0495629_0000055 | 3300046459 | Bacteria | 105268 |
| 157 | Ga0495629_0009655 | 3300046459 | Bacteria | 7046 |
| 158 | Ga0495638_0052911 | 3300046460 | Bacteria | 2528 |
| 159 | Ga0495641_0013794 | 3300046461 | Bacteria | 4412 |
| 160 | Ga0495641_0214201 | 3300046461 | Bacteria | 864 |
| 161 | Ga0495653_0071253 | 3300046463 | Bacteria | 2599 |
| 162 | Ga0495662_0025103 | 3300046476 | Bacteria | 2877 |
| 163 | Ga0495594_0000007 | 3300046499 | Bacteria | 160047 |
| 164 | Ga0495607_0543390 | 3300046501 | Bacteria | 511 |
| 165 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 166 | Ga0495618_0728730 | 3300046514 | Bacteria | 581 |
| 167 | Ga0495620_0226691 | 3300046515 | Unclassified | 714 |
| 168 | Ga0495628_0000061 | 3300046516 | Bacteria | 86531 |
| 169 | Ga0495628_0251259 | 3300046516 | Bacteria | 1320 |
| 170 | Ga0495630_0000025 | 3300046517 | Bacteria | 152364 |
| 171 | Ga0495630_0224541 | 3300046517 | Unclassified | 1434 |
| 172 | Ga0495644_0123549 | 3300046523 | Bacteria | 985 |
| 173 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 174 | Ga0495587_0001735 | 3300046536 | Bacteria | 14556 |
| 175 | Ga0495587_0142722 | 3300046536 | Unclassified | 1366 |
| 176 | Ga0495587_0743278 | 3300046536 | Bacteria | 537 |
| 177 | Ga0495622_0000050 | 3300046557 | Bacteria | 106111 |
| 178 | Ga0495667_0085179 | 3300046559 | Bacteria | 2051 |
| 179 | Ga0495656_0002299 | 3300046615 | Bacteria | 6315 |
| 180 | Ga0495634_0000296 | 3300046642 | Bacteria | 47756 |
| 181 | Ga0495625_0000029 | 3300046660 | Bacteria | 244646 |
| 182 | Ga0495635_1010820 | 3300046663 | Unclassified | 529 |
| 183 | Ga0495588_0000243 | 3300046674 | Bacteria | 45920 |
| 184 | Ga0495646_0408231 | 3300046680 | Unclassified | 705 |
| 185 | Ga0495647_0005613 | 3300046681 | Bacteria | 4120 |
| 186 | Ga0495658_0011556 | 3300046683 | Bacteria | 4445 |
| 187 | Ga0495613_0000068 | 3300046689 | Bacteria | 101803 |
| 188 | Ga0495613_0077128 | 3300046689 | Bacteria | 2425 |
| 189 | Ga0495624_0000298 | 3300046690 | Bacteria | 39145 |
| 190 | Ga0495600_0001659 | 3300046809 | Bacteria | 12411 |
| 191 | Ga0495604_0000013 | 3300047317 | Bacteria | 234578 |
| 192 | Ga0495604_0097412 | 3300047317 | Bacteria | 2169 |
| 193 | Ga0495674_0000020 | 3300047319 | Bacteria | 178465 |
| 194 | Ga0495676_0000729 | 3300047321 | Bacteria | 27371 |
| 195 | Ga0495676_0101862 | 3300047321 | Bacteria | 2123 |
| 196 | Ga0495680_0008842 | 3300047322 | Bacteria | 9112 |
| 197 | Ga0495675_0661953 | 3300047444 | Bacteria | 587 |
| 198 | Ga0495686_0065791 | 3300047472 | Bacteria | 2240 |
| 199 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 200 | Ga0495602_0000720 | 3300048088 | Bacteria | 31219 |
| 201 | Ga0495602_0442821 | 3300048088 | Bacteria | 918 |
| 202 | Ga0496100_0000012 | 3300048903 | Bacteria | 182426 |
| 203 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 204 | Ga0496103_0064022 | 3300048906 | Bacteria | 2291 |
| 205 | Ga0496103_0258417 | 3300048906 | Bacteria | 1121 |
| 206 | Ga0496103_0266193 | 3300048906 | Bacteria | 1103 |
| 207 | Ga0496103_0968078 | 3300048906 | Bacteria | 531 |
| 208 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 209 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 210 | Ga0496106_0000017 | 3300048909 | Bacteria | 181561 |
| 211 | Ga0496107_0000012 | 3300048910 | Bacteria | 181629 |
| 212 | Ga0496107_0571476 | 3300048910 | Bacteria | 837 |
| 213 | Ga0496108_0003785 | 3300048911 | Bacteria | 12109 |
| 214 | Ga0496108_0030257 | 3300048911 | Bacteria | 4487 |
| 215 | Ga0496108_0097915 | 3300048911 | Bacteria | 2499 |
| 216 | Ga0496109_0000021 | 3300048912 | Bacteria | 189945 |
| 217 | Ga0496109_0000039 | 3300048912 | Bacteria | 145769 |
| 218 | Ga0496109_0626347 | 3300048912 | Bacteria | 1012 |
| 219 | Ga0496110_0019743 | 3300048913 | Bacteria | 5678 |
| 220 | Ga0496110_1161118 | 3300048913 | Bacteria | 681 |
| 221 | Ga0496111_0240545 | 3300048914 | Bacteria | 1344 |
| 222 | Ga0496113_0111893 | 3300048916 | Bacteria | 2126 |
| 223 | Ga0496113_0300401 | 3300048916 | Bacteria | 1285 |
| 224 | Ga0496113_0661470 | 3300048916 | Bacteria | 835 |
| 225 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 226 | Ga0496114_0599946 | 3300048917 | Bacteria | 971 |
| 227 | Ga0496115_0000020 | 3300048918 | Bacteria | 171995 |
| 228 | Ga0496115_0000036 | 3300048918 | Bacteria | 127774 |
| 229 | Ga0496116_0001127 | 3300048919 | Bacteria | 31841 |
| 230 | Ga0496117_0110939 | 3300048920 | Bacteria | 1709 |
| 231 | Ga0496117_0538807 | 3300048920 | Unclassified | 558 |
| 232 | Ga0496119_0001930 | 3300048922 | Bacteria | 23652 |
| 233 | Ga0496119_0005650 | 3300048922 | Bacteria | 11872 |
| 234 | Ga0496119_0053735 | 3300048922 | Bacteria | 2458 |
| 235 | Ga0496120_0061637 | 3300048923 | Unclassified | 2092 |
| 236 | Ga0496120_0082621 | 3300048923 | Bacteria | 1736 |
| 237 | Ga0496121_0285288 | 3300048924 | Bacteria | 1127 |
| 238 | Ga0496125_0475964 | 3300048928 | Unclassified | 709 |
| 239 | Ga0496126_0228725 | 3300048929 | Bacteria | 1559 |
| 240 | Ga0501039_0177073 | 3300049575 | Bacteria | 1677 |
| 241 | Ga0501040_0802028 | 3300049576 | Bacteria | 681 |
| 242 | Ga0501042_0061636 | 3300049578 | Unclassified | 2680 |
| 243 | Ga0501042_0088023 | 3300049578 | Bacteria | 2228 |
| 244 | Ga0501042_0164408 | 3300049578 | Bacteria | 1601 |
| 245 | Ga0501047_0067878 | 3300049581 | Bacteria | 3435 |
| 246 | Ga0501068_0050748 | 3300049584 | Bacteria | 2508 |
| 247 | Ga0501070_0010598 | 3300049586 | Bacteria | 7791 |
| 248 | Ga0501070_0427281 | 3300049586 | Archaea | 1070 |
| 249 | Ga0501070_1149989 | 3300049586 | Unclassified | 597 |
| 250 | Ga0501072_0024830 | 3300049588 | Bacteria | 4666 |
| 251 | Ga0501072_0924295 | 3300049588 | Unclassified | 681 |
| 252 | Ga0501076_0008550 | 3300049592 | Bacteria | 7507 |
| 253 | Ga0501077_0125663 | 3300049593 | Bacteria | 1626 |
| 254 | Ga0501080_1651760 | 3300049742 | Unclassified | 541 |
| 255 | Ga0501081_0097099 | 3300049743 | Bacteria | 2079 |
| 256 | Ga0501083_0007735 | 3300049744 | Bacteria | 7617 |
| 257 | Ga0501044_0111512 | 3300049823 | Bacteria | 2743 |
| 258 | nmdc:mga0qj67_130322_c1 | 3300050509 | Bacteria | 2037 |
| 259 | nmdc:mga0a205_1659_c2 | 3300050515 | Bacteria | 16747 |
| 260 | Ga0495601_0000036 | 3300053077 | Bacteria | 91625 |
| 261 | Ga0495612_0000965 | 3300053078 | Bacteria | 11825 |
| 262 | Ga0495655_0000004 | 3300053083 | Bacteria | 293683 |
| 263 | Ga0495595_0067795 | 3300053084 | Bacteria | 1682 |
| 264 | Ga0500641_0040812 | 3300053096 | Bacteria | 1875 |
| 265 | Ga0500595_097817 | 3300053119 | Bacteria | 843 |
| 266 | Ga0500595_153803 | 3300053119 | Unclassified | 642 |
| 267 | Ga0500628_000004 | 3300053129 | Bacteria | 202098 |
| 268 | Ga0500658_0293431 | 3300053134 | Bacteria | 747 |
| 269 | Ga0500568_0132956 | 3300053139 | Bacteria | 924 |
| 270 | Ga0501082_0944195 | 3300060353 | Bacteria | 754 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046476 | Ga0495662_0025103 | Ga0495662_0025103_2431_2742 | 103 |
| 2 | 3300005337 | Ga0070682_100316901 | Ga0070682_1003169012 | 106 |
| 3 | 3300005441 | Ga0070700_100807460 | Ga0070700_1008074602 | 106 |
| 4 | 3300005719 | Ga0068861_100240932 | Ga0068861_1002409322 | 106 |
| 5 | 3300005719 | Ga0068861_102578398 | Ga0068861_1025783981 | 106 |
| 6 | 3300006237 | Ga0097621_101143066 | Ga0097621_1011430662 | 106 |
| 7 | 3300006358 | Ga0068871_100078013 | Ga0068871_1000780132 | 106 |
| 8 | 3300009553 | Ga0105249_10709567 | Ga0105249_107095672 | 106 |
| 9 | 3300013306 | Ga0163162_10463969 | Ga0163162_104639692 | 106 |
| 10 | 3300017792 | Ga0163161_10028415 | Ga0163161_100284152 | 106 |
| 11 | 3300025938 | Ga0207704_10000045 | Ga0207704_1000004516 | 106 |
| 12 | 3300026075 | Ga0207708_10147231 | Ga0207708_101472312 | 106 |
| 13 | 3300026118 | Ga0207675_100198998 | Ga0207675_1001989982 | 106 |
| 14 | 3300041503 | Ga0451847_0450222 | Ga0451847_0450222_163_483 | 106 |
| 15 | 3300041505 | Ga0451849_0466679 | Ga0451849_0466679_504_824 | 106 |
| 16 | 3300041512 | Ga0451853_2977364 | Ga0451853_2977364_536_856 | 106 |
| 17 | 3300048919 | Ga0496116_0001127 | Ga0496116_0001127_18773_19099 | 106 |
| 18 | 3300048920 | Ga0496117_0110939 | Ga0496117_0110939_979_1305 | 106 |
| 19 | 3300048922 | Ga0496119_0001930 | Ga0496119_0001930_10486_10812 | 106 |
| 20 | 3300048924 | Ga0496121_0285288 | Ga0496121_0285288_205_531 | 106 |
| 21 | 3300048928 | Ga0496125_0475964 | Ga0496125_0475964_245_571 | 106 |
| 22 | 3300048929 | Ga0496126_0228725 | Ga0496126_0228725_105_431 | 106 |
| 23 | 3300049578 | Ga0501042_0164408 | Ga0501042_0164408_1197_1574 | 106 |
| 24 | 3300049581 | Ga0501047_0067878 | Ga0501047_0067878_3065_3394 | 106 |
| 25 | 3300049588 | Ga0501072_0924295 | Ga0501072_0924295_79_399 | 106 |
| 26 | 3300049592 | Ga0501076_0008550 | Ga0501076_0008550_482_802 | 106 |
| 27 | 3300049742 | Ga0501080_1651760 | Ga0501080_1651760_123_449 | 106 |
| 28 | 3300053119 | Ga0500595_097817 | Ga0500595_097817_267_593 | 106 |
| 29 | 3300053119 | Ga0500595_153803 | Ga0500595_153803_110_436 | 106 |
| 30 | 3300053134 | Ga0500658_0293431 | Ga0500658_0293431_38_364 | 106 |
| 31 | 3300053139 | Ga0500568_0132956 | Ga0500568_0132956_10_336 | 106 |
| 32 | 3300001977 | JGI24746J21847_1000014 | JGI24746J21847_10000146 | 107 |
| 33 | 3300001978 | JGI24747J21853_1039567 | JGI24747J21853_10395671 | 107 |
| 34 | 3300001979 | JGI24740J21852_10000990 | JGI24740J21852_1000099011 | 107 |
| 35 | 3300002074 | JGI24748J21848_1001029 | JGI24748J21848_10010292 | 107 |
| 36 | 3300002239 | JGI24034J26672_10000856 | JGI24034J26672_100008562 | 107 |
| 37 | 3300003316 | rootH1_10118456 | rootH1_101184562 | 107 |
| 38 | 3300003322 | rootL2_10141448 | rootL2_101414482 | 107 |
| 39 | 3300003659 | JGI25404J52841_10013720 | JGI25404J52841_100137202 | 107 |
| 40 | 3300005329 | Ga0070683_100010256 | Ga0070683_1000102565 | 107 |
| 41 | 3300005338 | Ga0068868_100074696 | Ga0068868_1000746962 | 107 |
| 42 | 3300005341 | Ga0070691_10000064 | Ga0070691_1000006432 | 107 |
| 43 | 3300005341 | Ga0070691_10025761 | Ga0070691_100257612 | 107 |
| 44 | 3300005344 | Ga0070661_100000005 | Ga0070661_10000000569 | 107 |
| 45 | 3300005344 | Ga0070661_100785314 | Ga0070661_1007853142 | 107 |
| 46 | 3300005347 | Ga0070668_100459498 | Ga0070668_1004594982 | 107 |
| 47 | 3300005354 | Ga0070675_100005523 | Ga0070675_10000552313 | 107 |
| 48 | 3300005356 | Ga0070674_100000006 | Ga0070674_100000006100 | 107 |
| 49 | 3300005365 | Ga0070688_100002070 | Ga0070688_1000020705 | 107 |
| 50 | 3300005365 | Ga0070688_100003416 | Ga0070688_10000341611 | 107 |
| 51 | 3300005366 | Ga0070659_100016884 | Ga0070659_1000168844 | 107 |
| 52 | 3300005367 | Ga0070667_100001507 | Ga0070667_10000150710 | 107 |
| 53 | 3300005438 | Ga0070701_10112666 | Ga0070701_101126662 | 107 |
| 54 | 3300005466 | Ga0070685_10000021 | Ga0070685_100000216 | 107 |
| 55 | 3300005466 | Ga0070685_10000111 | Ga0070685_1000011150 | 107 |
| 56 | 3300005535 | Ga0070684_100176812 | Ga0070684_1001768122 | 107 |
| 57 | 3300005543 | Ga0070672_100000580 | Ga0070672_10000058019 | 107 |
| 58 | 3300005544 | Ga0070686_100108345 | Ga0070686_1001083453 | 107 |
| 59 | 3300005544 | Ga0070686_100543310 | Ga0070686_1005433102 | 107 |
| 60 | 3300005545 | Ga0070695_100051558 | Ga0070695_1000515582 | 107 |
| 61 | 3300005548 | Ga0070665_100001200 | Ga0070665_10000120021 | 107 |
| 62 | 3300005548 | Ga0070665_100045804 | Ga0070665_1000458044 | 107 |
| 63 | 3300005548 | Ga0070665_100115833 | Ga0070665_1001158334 | 107 |
| 64 | 3300005548 | Ga0070665_100729657 | Ga0070665_1007296572 | 107 |
| 65 | 3300005548 | Ga0070665_101139921 | Ga0070665_1011399212 | 107 |
| 66 | 3300005549 | Ga0070704_100121392 | Ga0070704_1001213922 | 107 |
| 67 | 3300005563 | Ga0068855_100083762 | Ga0068855_1000837622 | 107 |
| 68 | 3300005564 | Ga0070664_100030206 | Ga0070664_1000302062 | 107 |
| 69 | 3300005577 | Ga0068857_100020990 | Ga0068857_1000209905 | 107 |
| 70 | 3300005615 | Ga0070702_100682007 | Ga0070702_1006820072 | 107 |
| 71 | 3300005616 | Ga0068852_100097436 | Ga0068852_1000974365 | 107 |
| 72 | 3300005618 | Ga0068864_100000023 | Ga0068864_10000002374 | 107 |
| 73 | 3300005718 | Ga0068866_10000731 | Ga0068866_100007314 | 107 |
| 74 | 3300005719 | Ga0068861_101320534 | Ga0068861_1013205342 | 107 |
| 75 | 3300005841 | Ga0068863_100005063 | Ga0068863_1000050632 | 107 |
| 76 | 3300005841 | Ga0068863_100157893 | Ga0068863_1001578933 | 107 |
| 77 | 3300005842 | Ga0068858_100000033 | Ga0068858_100000033119 | 107 |
| 78 | 3300005842 | Ga0068858_100183925 | Ga0068858_1001839254 | 107 |
| 79 | 3300005842 | Ga0068858_100198869 | Ga0068858_1001988692 | 107 |
| 80 | 3300005843 | Ga0068860_100884790 | Ga0068860_1008847902 | 107 |
| 81 | 3300005844 | Ga0068862_100000050 | Ga0068862_1000000506 | 107 |
| 82 | 3300005983 | Ga0081540_1000106 | Ga0081540_100010664 | 107 |
| 83 | 3300005985 | Ga0081539_10000504 | Ga0081539_1000050487 | 107 |
| 84 | 3300006846 | Ga0075430_100378157 | Ga0075430_1003781573 | 107 |
| 85 | 3300006852 | Ga0075433_10003789 | Ga0075433_100037892 | 107 |
| 86 | 3300009093 | Ga0105240_10226254 | Ga0105240_102262542 | 107 |
| 87 | 3300009098 | Ga0105245_10000365 | Ga0105245_1000036538 | 107 |
| 88 | 3300009098 | Ga0105245_10006637 | Ga0105245_100066375 | 107 |
| 89 | 3300009101 | Ga0105247_10000105 | Ga0105247_1000010571 | 107 |
| 90 | 3300009148 | Ga0105243_10090903 | Ga0105243_100909032 | 107 |
| 91 | 3300009148 | Ga0105243_10122286 | Ga0105243_101222862 | 107 |
| 92 | 3300009176 | Ga0105242_10000335 | Ga0105242_100003359 | 107 |
| 93 | 3300009176 | Ga0105242_10063493 | Ga0105242_100634935 | 107 |
| 94 | 3300009545 | Ga0105237_10086987 | Ga0105237_100869872 | 107 |
| 95 | 3300009545 | Ga0105237_10705647 | Ga0105237_107056472 | 107 |
| 96 | 3300009551 | Ga0105238_11057302 | Ga0105238_110573022 | 107 |
| 97 | 3300009553 | Ga0105249_10008206 | Ga0105249_1000820610 | 107 |
| 98 | 3300010375 | Ga0105239_10053058 | Ga0105239_100530585 | 107 |
| 99 | 3300010375 | Ga0105239_10797747 | Ga0105239_107977472 | 107 |
| 100 | 3300013102 | Ga0157371_10007499 | Ga0157371_100074999 | 107 |
| 101 | 3300013104 | Ga0157370_10002070 | Ga0157370_1000207022 | 107 |
| 102 | 3300013104 | Ga0157370_10328094 | Ga0157370_103280942 | 107 |
| 103 | 3300013105 | Ga0157369_10000130 | Ga0157369_1000013074 | 107 |
| 104 | 3300013296 | Ga0157374_11529902 | Ga0157374_115299021 | 107 |
| 105 | 3300013297 | Ga0157378_10061750 | Ga0157378_100617502 | 107 |
| 106 | 3300013297 | Ga0157378_10156216 | Ga0157378_101562162 | 107 |
| 107 | 3300013308 | Ga0157375_11298523 | Ga0157375_112985232 | 107 |
| 108 | 3300014325 | Ga0163163_11060140 | Ga0163163_110601402 | 107 |
| 109 | 3300014325 | Ga0163163_11108602 | Ga0163163_111086021 | 107 |
| 110 | 3300014326 | Ga0157380_10000028 | Ga0157380_100000286 | 107 |
| 111 | 3300014326 | Ga0157380_11303257 | Ga0157380_113032572 | 107 |
| 112 | 3300014968 | Ga0157379_10232909 | Ga0157379_102329092 | 107 |
| 113 | 3300014968 | Ga0157379_10487580 | Ga0157379_104875802 | 107 |
| 114 | 3300014969 | Ga0157376_10626440 | Ga0157376_106264402 | 107 |
| 115 | 3300017792 | Ga0163161_11646055 | Ga0163161_116460552 | 107 |
| 116 | 3300025321 | Ga0207656_10007247 | Ga0207656_100072475 | 107 |
| 117 | 3300025899 | Ga0207642_10000203 | Ga0207642_1000020318 | 107 |
| 118 | 3300025900 | Ga0207710_10000448 | Ga0207710_1000044811 | 107 |
| 119 | 3300025903 | Ga0207680_10003287 | Ga0207680_100032872 | 107 |
| 120 | 3300025909 | Ga0207705_11432779 | Ga0207705_114327791 | 107 |
| 121 | 3300025918 | Ga0207662_10559891 | Ga0207662_105598911 | 107 |
| 122 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005213 | 107 |
| 123 | 3300025925 | Ga0207650_10298620 | Ga0207650_102986202 | 107 |
| 124 | 3300025926 | Ga0207659_10000014 | Ga0207659_1000001413 | 107 |
| 125 | 3300025927 | Ga0207687_10000011 | Ga0207687_1000001117 | 107 |
| 126 | 3300025927 | Ga0207687_10005198 | Ga0207687_100051984 | 107 |
| 127 | 3300025931 | Ga0207644_10056111 | Ga0207644_100561112 | 107 |
| 128 | 3300025932 | Ga0207690_10041554 | Ga0207690_100415545 | 107 |
| 129 | 3300025934 | Ga0207686_10088392 | Ga0207686_100883922 | 107 |
| 130 | 3300025934 | Ga0207686_10090144 | Ga0207686_100901442 | 107 |
| 131 | 3300025935 | Ga0207709_10048996 | Ga0207709_100489962 | 107 |
| 132 | 3300025937 | Ga0207669_10000010 | Ga0207669_1000001059 | 107 |
| 133 | 3300025939 | Ga0207665_10021645 | Ga0207665_100216454 | 107 |
| 134 | 3300025940 | Ga0207691_10000429 | Ga0207691_100004296 | 107 |
| 135 | 3300025944 | Ga0207661_10000165 | Ga0207661_100001656 | 107 |
| 136 | 3300025945 | Ga0207679_10019148 | Ga0207679_100191482 | 107 |
| 137 | 3300025949 | Ga0207667_11562709 | Ga0207667_115627092 | 107 |
| 138 | 3300025961 | Ga0207712_10004128 | Ga0207712_100041283 | 107 |
| 139 | 3300025972 | Ga0207668_10002386 | Ga0207668_100023867 | 107 |
| 140 | 3300025972 | Ga0207668_10377082 | Ga0207668_103770822 | 107 |
| 141 | 3300025986 | Ga0207658_10003653 | Ga0207658_100036534 | 107 |
| 142 | 3300026023 | Ga0207677_10159895 | Ga0207677_101598952 | 107 |
| 143 | 3300026035 | Ga0207703_10000126 | Ga0207703_1000012654 | 107 |
| 144 | 3300026035 | Ga0207703_10105930 | Ga0207703_101059304 | 107 |
| 145 | 3300026035 | Ga0207703_10228786 | Ga0207703_102287862 | 107 |
| 146 | 3300026041 | Ga0207639_10064648 | Ga0207639_100646482 | 107 |
| 147 | 3300026075 | Ga0207708_10189989 | Ga0207708_101899892 | 107 |
| 148 | 3300026078 | Ga0207702_10000865 | Ga0207702_100008652 | 107 |
| 149 | 3300026088 | Ga0207641_10004517 | Ga0207641_1000451712 | 107 |
| 150 | 3300026088 | Ga0207641_10159395 | Ga0207641_101593951 | 107 |
| 151 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025203 | 107 |
| 152 | 3300026116 | Ga0207674_10088722 | Ga0207674_100887222 | 107 |
| 153 | 3300026121 | Ga0207683_10177766 | Ga0207683_101777662 | 107 |
| 154 | 3300026142 | Ga0207698_10000041 | Ga0207698_10000041103 | 107 |
| 155 | 3300026142 | Ga0207698_10063185 | Ga0207698_100631852 | 107 |
| 156 | 3300026142 | Ga0207698_11510373 | Ga0207698_115103732 | 107 |
| 157 | 3300028379 | Ga0268266_10000303 | Ga0268266_1000030320 | 107 |
| 158 | 3300028379 | Ga0268266_10014991 | Ga0268266_100149913 | 107 |
| 159 | 3300028379 | Ga0268266_10086428 | Ga0268266_100864284 | 107 |
| 160 | 3300028379 | Ga0268266_10579209 | Ga0268266_105792092 | 107 |
| 161 | 3300028379 | Ga0268266_11005999 | Ga0268266_110059992 | 107 |
| 162 | 3300028380 | Ga0268265_10002948 | Ga0268265_100029482 | 107 |
| 163 | 3300028381 | Ga0268264_10078535 | Ga0268264_100785352 | 107 |
| 164 | 3300028381 | Ga0268264_11146362 | Ga0268264_111463622 | 107 |
| 165 | 3300028800 | Ga0265338_10562507 | Ga0265338_105625072 | 107 |
| 166 | 3300032126 | Ga0307415_100001253 | Ga0307415_1000012536 | 107 |
| 167 | 3300041486 | Ga0451807_0402315 | Ga0451807_0402315_1815_2138 | 107 |
| 168 | 3300041491 | Ga0451833_0381746 | Ga0451833_0381746_479_802 | 107 |
| 169 | 3300041512 | Ga0451853_1953484 | Ga0451853_1953484_1457_1780 | 107 |
| 170 | 3300044694 | Ga0466963_0263736 | Ga0466963_0263736_460_783 | 107 |
| 171 | 3300044842 | Ga0466957_0000175 | Ga0466957_0000175_18001_18324 | 107 |
| 172 | 3300046459 | Ga0495629_0000055 | Ga0495629_0000055_10246_10569 | 107 |
| 173 | 3300046459 | Ga0495629_0009655 | Ga0495629_0009655_1108_1431 | 107 |
| 174 | 3300046460 | Ga0495638_0052911 | Ga0495638_0052911_522_845 | 107 |
| 175 | 3300046461 | Ga0495641_0013794 | Ga0495641_0013794_1786_2109 | 107 |
| 176 | 3300046461 | Ga0495641_0214201 | Ga0495641_0214201_198_521 | 107 |
| 177 | 3300046463 | Ga0495653_0071253 | Ga0495653_0071253_1773_2096 | 107 |
| 178 | 3300046499 | Ga0495594_0000007 | Ga0495594_0000007_16750_17073 | 107 |
| 179 | 3300046501 | Ga0495607_0543390 | Ga0495607_0543390_29_352 | 107 |
| 180 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_58210_58533 | 107 |
| 181 | 3300046514 | Ga0495618_0728730 | Ga0495618_0728730_97_420 | 107 |
| 182 | 3300046515 | Ga0495620_0226691 | Ga0495620_0226691_40_363 | 107 |
| 183 | 3300046516 | Ga0495628_0000061 | Ga0495628_0000061_54126_54449 | 107 |
| 184 | 3300046516 | Ga0495628_0251259 | Ga0495628_0251259_942_1265 | 107 |
| 185 | 3300046517 | Ga0495630_0000025 | Ga0495630_0000025_93322_93645 | 107 |
| 186 | 3300046517 | Ga0495630_0224541 | Ga0495630_0224541_559_882 | 107 |
| 187 | 3300046523 | Ga0495644_0123549 | Ga0495644_0123549_489_812 | 107 |
| 188 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_151332_151655 | 107 |
| 189 | 3300046536 | Ga0495587_0001735 | Ga0495587_0001735_2540_2863 | 107 |
| 190 | 3300046536 | Ga0495587_0142722 | Ga0495587_0142722_314_637 | 107 |
| 191 | 3300046536 | Ga0495587_0743278 | Ga0495587_0743278_71_394 | 107 |
| 192 | 3300046557 | Ga0495622_0000050 | Ga0495622_0000050_64288_64611 | 107 |
| 193 | 3300046559 | Ga0495667_0085179 | Ga0495667_0085179_166_489 | 107 |
| 194 | 3300046615 | Ga0495656_0002299 | Ga0495656_0002299_4301_4624 | 107 |
| 195 | 3300046642 | Ga0495634_0000296 | Ga0495634_0000296_31979_32302 | 107 |
| 196 | 3300046660 | Ga0495625_0000029 | Ga0495625_0000029_138214_138537 | 107 |
| 197 | 3300046663 | Ga0495635_1010820 | Ga0495635_1010820_192_515 | 107 |
| 198 | 3300046674 | Ga0495588_0000243 | Ga0495588_0000243_8990_9313 | 107 |
| 199 | 3300046680 | Ga0495646_0408231 | Ga0495646_0408231_45_368 | 107 |
| 200 | 3300046681 | Ga0495647_0005613 | Ga0495647_0005613_1560_1883 | 107 |
| 201 | 3300046683 | Ga0495658_0011556 | Ga0495658_0011556_3963_4286 | 107 |
| 202 | 3300046689 | Ga0495613_0000068 | Ga0495613_0000068_86040_86363 | 107 |
| 203 | 3300046689 | Ga0495613_0077128 | Ga0495613_0077128_1251_1574 | 107 |
| 204 | 3300046690 | Ga0495624_0000298 | Ga0495624_0000298_29783_30106 | 107 |
| 205 | 3300046809 | Ga0495600_0001659 | Ga0495600_0001659_3269_3592 | 107 |
| 206 | 3300047317 | Ga0495604_0000013 | Ga0495604_0000013_6798_7121 | 107 |
| 207 | 3300047317 | Ga0495604_0097412 | Ga0495604_0097412_1002_1325 | 107 |
| 208 | 3300047319 | Ga0495674_0000020 | Ga0495674_0000020_61371_61694 | 107 |
| 209 | 3300047321 | Ga0495676_0000729 | Ga0495676_0000729_5317_5640 | 107 |
| 210 | 3300047321 | Ga0495676_0101862 | Ga0495676_0101862_672_995 | 107 |
| 211 | 3300047322 | Ga0495680_0008842 | Ga0495680_0008842_558_881 | 107 |
| 212 | 3300047444 | Ga0495675_0661953 | Ga0495675_0661953_84_407 | 107 |
| 213 | 3300047472 | Ga0495686_0065791 | Ga0495686_0065791_1181_1504 | 107 |
| 214 | 3300048088 | Ga0495602_0000009 | Ga0495602_0000009_12436_12759 | 107 |
| 215 | 3300048088 | Ga0495602_0000720 | Ga0495602_0000720_1579_1902 | 107 |
| 216 | 3300048088 | Ga0495602_0442821 | Ga0495602_0442821_133_456 | 107 |
| 217 | 3300048903 | Ga0496100_0000012 | Ga0496100_0000012_126164_126487 | 107 |
| 218 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_155718_156041 | 107 |
| 219 | 3300048906 | Ga0496103_0064022 | Ga0496103_0064022_623_946 | 107 |
| 220 | 3300048906 | Ga0496103_0258417 | Ga0496103_0258417_270_593 | 107 |
| 221 | 3300048906 | Ga0496103_0266193 | Ga0496103_0266193_22_345 | 107 |
| 222 | 3300048906 | Ga0496103_0968078 | Ga0496103_0968078_97_420 | 107 |
| 223 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_534350_534673 | 107 |
| 224 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_793506_793829 | 107 |
| 225 | 3300048909 | Ga0496106_0000017 | Ga0496106_0000017_125876_126199 | 107 |
| 226 | 3300048910 | Ga0496107_0000012 | Ga0496107_0000012_55357_55680 | 107 |
| 227 | 3300048910 | Ga0496107_0571476 | Ga0496107_0571476_428_751 | 107 |
| 228 | 3300048911 | Ga0496108_0003785 | Ga0496108_0003785_747_1070 | 107 |
| 229 | 3300048911 | Ga0496108_0030257 | Ga0496108_0030257_1371_1694 | 107 |
| 230 | 3300048911 | Ga0496108_0097915 | Ga0496108_0097915_784_1125 | 107 |
| 231 | 3300048912 | Ga0496109_0000021 | Ga0496109_0000021_743_1066 | 107 |
| 232 | 3300048912 | Ga0496109_0000039 | Ga0496109_0000039_75134_75457 | 107 |
| 233 | 3300048912 | Ga0496109_0626347 | Ga0496109_0626347_125_448 | 107 |
| 234 | 3300048913 | Ga0496110_0019743 | Ga0496110_0019743_2960_3283 | 107 |
| 235 | 3300048913 | Ga0496110_1161118 | Ga0496110_1161118_305_628 | 107 |
| 236 | 3300048914 | Ga0496111_0240545 | Ga0496111_0240545_171_494 | 107 |
| 237 | 3300048916 | Ga0496113_0111893 | Ga0496113_0111893_117_458 | 107 |
| 238 | 3300048916 | Ga0496113_0300401 | Ga0496113_0300401_532_855 | 107 |
| 239 | 3300048916 | Ga0496113_0661470 | Ga0496113_0661470_205_528 | 107 |
| 240 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_183314_183637 | 107 |
| 241 | 3300048917 | Ga0496114_0599946 | Ga0496114_0599946_598_921 | 107 |
| 242 | 3300048918 | Ga0496115_0000020 | Ga0496115_0000020_117455_117778 | 107 |
| 243 | 3300048918 | Ga0496115_0000036 | Ga0496115_0000036_86131_86454 | 107 |
| 244 | 3300048920 | Ga0496117_0538807 | Ga0496117_0538807_187_516 | 107 |
| 245 | 3300048922 | Ga0496119_0005650 | Ga0496119_0005650_5383_5706 | 107 |
| 246 | 3300048922 | Ga0496119_0053735 | Ga0496119_0053735_604_933 | 107 |
| 247 | 3300048923 | Ga0496120_0061637 | Ga0496120_0061637_244_573 | 107 |
| 248 | 3300048923 | Ga0496120_0082621 | Ga0496120_0082621_1208_1531 | 107 |
| 249 | 3300049575 | Ga0501039_0177073 | Ga0501039_0177073_817_1140 | 107 |
| 250 | 3300049576 | Ga0501040_0802028 | Ga0501040_0802028_320_643 | 107 |
| 251 | 3300049578 | Ga0501042_0061636 | Ga0501042_0061636_135_458 | 107 |
| 252 | 3300049578 | Ga0501042_0088023 | Ga0501042_0088023_1476_1799 | 107 |
| 253 | 3300049584 | Ga0501068_0050748 | Ga0501068_0050748_350_673 | 107 |
| 254 | 3300049586 | Ga0501070_0010598 | Ga0501070_0010598_2789_3112 | 107 |
| 255 | 3300049586 | Ga0501070_0427281 | Ga0501070_0427281_647_970 | 107 |
| 256 | 3300049586 | Ga0501070_1149989 | Ga0501070_1149989_201_524 | 107 |
| 257 | 3300049588 | Ga0501072_0024830 | Ga0501072_0024830_4266_4589 | 107 |
| 258 | 3300049593 | Ga0501077_0125663 | Ga0501077_0125663_544_867 | 107 |
| 259 | 3300049743 | Ga0501081_0097099 | Ga0501081_0097099_966_1307 | 107 |
| 260 | 3300049744 | Ga0501083_0007735 | Ga0501083_0007735_2309_2641 | 107 |
| 261 | 3300049823 | Ga0501044_0111512 | Ga0501044_0111512_2127_2459 | 107 |
| 262 | 3300050509 | nmdc:mga0qj67_130322_c1 | nmdc:mga0qj67_130322_c1_1560_1883 | 107 |
| 263 | 3300050515 | nmdc:mga0a205_1659_c2 | nmdc:mga0a205_1659_c2_13589_13912 | 107 |
| 264 | 3300053077 | Ga0495601_0000036 | Ga0495601_0000036_38885_39208 | 107 |
| 265 | 3300053078 | Ga0495612_0000965 | Ga0495612_0000965_3710_4033 | 107 |
| 266 | 3300053083 | Ga0495655_0000004 | Ga0495655_0000004_97529_97852 | 107 |
| 267 | 3300053084 | Ga0495595_0067795 | Ga0495595_0067795_465_788 | 107 |
| 268 | 3300053096 | Ga0500641_0040812 | Ga0500641_0040812_28_351 | 107 |
| 269 | 3300053129 | Ga0500628_000004 | Ga0500628_000004_5944_6267 | 107 |
| 270 | 3300060353 | Ga0501082_0944195 | Ga0501082_0944195_24_347 | 107 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1x8z-assembly2.cif.gz_C | crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana | 0.3684 | 5 | 97 |
| 1x90-assembly1.cif.gz_A | crystal structure of mutant form b of a pectin methylesterase inhibitor from arabidopsis | 0.3408 | 5 | 97 |
| 6azh-assembly1.cif.gz_B | clostridium perfringens putative fatty acid metabolism regulator | 0.333 | 5 | 97 |
| 1x8z-assembly2.cif.gz_C | crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana | 0.3301 | 5 | 97 |
| 2px6-assembly1.cif.gz_A | crystal structure of the thioesterase domain of human fatty acid synthase inhibited by orlistat | 0.3253 | 31 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D4ABV2_65_150_3.30.430.20 | Alpha Beta;2-Layer Sandwich;Killer Toxin P4; Chain A;Gnk2 domain, C-X8-C-X2-C motif | 0.4033 | 6 | 83 | 3.30.430.20 |
| 1x8zC00 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.3684 | 5 | 97 | 1.20.140.40 |
| af_Q61301_150_261_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.3613 | 6 | 97 | 1.20.120.230 |
| af_A0A0R4IY81_185_276_1.10.533.10 | Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas | 0.3513 | 3 | 94 | 1.10.533.10 |
| af_Q9C7Z2_46_177_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.3448 | 5 | 97 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538CLJ0-F1-model_v4 | Uncharacterized protein | 0.916 | 5 | 95 |
|
| AF-A0A1M3BMH6-F1-model_v4 | Uncharacterized protein | 0.9083 | 1 | 103 |
|
| AF-A0A6J4RKF7-F1-model_v4 | TipAS antibiotic-recognition domain-containing protein | 0.9072 | 4 | 98 |
|
| AF-A0A7V9CR68-F1-model_v4 | DUF501 domain-containing protein | 0.8932 | 5 | 99 |
|
| AF-A0A7W0NJP6-F1-model_v4 | Uncharacterized protein | 0.8845 | 5 | 99 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar