F377239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 205 | 270 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300049578|Ga0501042_0063622|Ga0501042_0063622_176_769 |
| Length | 197 |
| Sequence | MSEADAKSAREIRTWRSAMSYNLDQFISDCRTILARDPGPSGREEVRVRLERLLGEPEFLRAYCGDDAPQGLKVLYEDPQLGFQVLAHINDKARVSPPHDHGASWAIYGQATKYTEMTEWERVDTGTGGKAELRPTTKYRLMPGQAGIYQDGKIHSIDYPDHARFIRVTGTNLDKINRVRFDLKTGEVHQMTPQQAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 75 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 132 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 139 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 140 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 141 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 189 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 190 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 191 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 193 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 194 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 195 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 204 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.63 |
| Nodule | 0 |
| Rhizoplane | 8.89 |
| Rhizosphere | 80 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10001140 | 3300003659 | Bacteria | 4501 |
| 2 | Ga0065712_10017769 | 3300005290 | Bacteria | 1916 |
| 3 | Ga0065712_10294905 | 3300005290 | Bacteria | 870 |
| 4 | Ga0065715_10007628 | 3300005293 | Bacteria | 3623 |
| 5 | Ga0070670_100296960 | 3300005331 | Bacteria | 1412 |
| 6 | Ga0070680_100178333 | 3300005336 | Bacteria | 1789 |
| 7 | Ga0070682_100281780 | 3300005337 | Bacteria | 1212 |
| 8 | Ga0068868_100148055 | 3300005338 | Bacteria | 1932 |
| 9 | Ga0070687_100476671 | 3300005343 | Unclassified | 835 |
| 10 | Ga0070669_100031726 | 3300005353 | Bacteria | 3817 |
| 11 | Ga0070669_100547044 | 3300005353 | Bacteria | 965 |
| 12 | Ga0070675_100586034 | 3300005354 | Bacteria | 1011 |
| 13 | Ga0070675_100599787 | 3300005354 | Bacteria | 999 |
| 14 | Ga0070671_100150239 | 3300005355 | Bacteria | 1967 |
| 15 | Ga0070671_100265844 | 3300005355 | Unclassified | 1458 |
| 16 | Ga0070673_100571718 | 3300005364 | Bacteria | 1028 |
| 17 | Ga0070688_100811009 | 3300005365 | Bacteria | 733 |
| 18 | Ga0070667_100366944 | 3300005367 | Unclassified | 1306 |
| 19 | Ga0070709_10181681 | 3300005434 | Bacteria | 1478 |
| 20 | Ga0070714_100175942 | 3300005435 | Bacteria | 1944 |
| 21 | Ga0070710_10124116 | 3300005437 | Bacteria | 1567 |
| 22 | Ga0070678_100007224 | 3300005456 | Bacteria | 6573 |
| 23 | Ga0070681_10085751 | 3300005458 | Bacteria | 3102 |
| 24 | Ga0070681_10662511 | 3300005458 | Bacteria | 959 |
| 25 | Ga0068867_100017007 | 3300005459 | Bacteria | 5167 |
| 26 | Ga0070685_10113708 | 3300005466 | Bacteria | 1672 |
| 27 | Ga0070679_100039626 | 3300005530 | Bacteria | 4682 |
| 28 | Ga0070684_100211452 | 3300005535 | Bacteria | 1768 |
| 29 | Ga0068853_100026786 | 3300005539 | Bacteria | 4843 |
| 30 | Ga0070672_100015478 | 3300005543 | Bacteria | 5433 |
| 31 | Ga0070686_100578731 | 3300005544 | Unclassified | 882 |
| 32 | Ga0068857_100258586 | 3300005577 | Bacteria | 1597 |
| 33 | Ga0068857_100872706 | 3300005577 | Bacteria | 862 |
| 34 | Ga0068854_100857457 | 3300005578 | Bacteria | 796 |
| 35 | Ga0068859_100905709 | 3300005617 | Unclassified | 966 |
| 36 | Ga0068866_10014875 | 3300005718 | Bacteria | 3445 |
| 37 | Ga0068861_100081305 | 3300005719 | Bacteria | 2537 |
| 38 | Ga0068861_100089161 | 3300005719 | Bacteria | 2431 |
| 39 | Ga0068861_101135198 | 3300005719 | Bacteria | 753 |
| 40 | Ga0068870_10167171 | 3300005840 | Bacteria | 1309 |
| 41 | Ga0068863_100120480 | 3300005841 | Bacteria | 2501 |
| 42 | Ga0068858_100136452 | 3300005842 | Bacteria | 2302 |
| 43 | Ga0068860_100273656 | 3300005843 | Bacteria | 1649 |
| 44 | Ga0068862_100130355 | 3300005844 | Bacteria | 2223 |
| 45 | Ga0081538_10016815 | 3300005981 | Bacteria | 5585 |
| 46 | Ga0081540_1000241 | 3300005983 | Bacteria | 57441 |
| 47 | Ga0075365_10540080 | 3300006038 | Bacteria | 824 |
| 48 | Ga0075363_100119344 | 3300006048 | Bacteria | 1471 |
| 49 | Ga0075364_10012827 | 3300006051 | Bacteria | 5140 |
| 50 | Ga0075364_10550682 | 3300006051 | Bacteria | 788 |
| 51 | Ga0070715_10528633 | 3300006163 | Bacteria | 680 |
| 52 | Ga0070712_100100947 | 3300006175 | Bacteria | 2133 |
| 53 | Ga0075362_10005694 | 3300006177 | Bacteria | 4584 |
| 54 | Ga0075362_10136983 | 3300006177 | Bacteria | 1168 |
| 55 | Ga0075367_10065052 | 3300006178 | Bacteria | 2183 |
| 56 | Ga0075369_10020166 | 3300006186 | Bacteria | 2729 |
| 57 | Ga0075369_10303344 | 3300006186 | Bacteria | 746 |
| 58 | Ga0075366_10051578 | 3300006195 | Bacteria | 2444 |
| 59 | Ga0097621_100220410 | 3300006237 | Bacteria | 1653 |
| 60 | Ga0075430_100274628 | 3300006846 | Bacteria | 1395 |
| 61 | Ga0075431_100131175 | 3300006847 | Bacteria | 2584 |
| 62 | Ga0075429_100318773 | 3300006880 | Bacteria | 1361 |
| 63 | Ga0075429_100691432 | 3300006880 | Unclassified | 894 |
| 64 | Ga0075429_101226315 | 3300006880 | Bacteria | 655 |
| 65 | Ga0068865_100252418 | 3300006881 | Bacteria | 1393 |
| 66 | Ga0068865_100308985 | 3300006881 | Bacteria | 1268 |
| 67 | Ga0097620_100905741 | 3300006931 | Unclassified | 966 |
| 68 | Ga0105240_10146384 | 3300009093 | Bacteria | 2818 |
| 69 | Ga0105240_10435386 | 3300009093 | Bacteria | 1470 |
| 70 | Ga0111539_10059579 | 3300009094 | Bacteria | 4526 |
| 71 | Ga0111539_11058820 | 3300009094 | Bacteria | 943 |
| 72 | Ga0111539_11421005 | 3300009094 | Bacteria | 805 |
| 73 | Ga0105247_10668798 | 3300009101 | Bacteria | 778 |
| 74 | Ga0114129_10085099 | 3300009147 | Bacteria | 4387 |
| 75 | Ga0114129_10760278 | 3300009147 | Bacteria | 1240 |
| 76 | Ga0105243_10362199 | 3300009148 | Unclassified | 1335 |
| 77 | Ga0105242_11305027 | 3300009176 | Unclassified | 750 |
| 78 | Ga0105248_10912162 | 3300009177 | Bacteria | 992 |
| 79 | Ga0105238_10041687 | 3300009551 | Bacteria | 4650 |
| 80 | Ga0105238_11274510 | 3300009551 | Bacteria | 760 |
| 81 | Ga0105249_10837821 | 3300009553 | Bacteria | 985 |
| 82 | Ga0105249_11060200 | 3300009553 | Bacteria | 880 |
| 83 | Ga0105246_10129909 | 3300011119 | Bacteria | 1880 |
| 84 | Ga0157370_10600571 | 3300013104 | Bacteria | 1008 |
| 85 | Ga0157369_10870417 | 3300013105 | Bacteria | 924 |
| 86 | Ga0157374_10246882 | 3300013296 | Bacteria | 1756 |
| 87 | Ga0157378_10734562 | 3300013297 | Bacteria | 1009 |
| 88 | Ga0163162_11329820 | 3300013306 | Bacteria | 817 |
| 89 | Ga0157372_10155889 | 3300013307 | Bacteria | 2638 |
| 90 | Ga0157372_10241314 | 3300013307 | Bacteria | 2097 |
| 91 | Ga0163163_10370451 | 3300014325 | Bacteria | 1489 |
| 92 | Ga0163163_10526905 | 3300014325 | Bacteria | 1244 |
| 93 | Ga0163163_10894705 | 3300014325 | Unclassified | 951 |
| 94 | Ga0157379_10749493 | 3300014968 | Bacteria | 919 |
| 95 | Ga0157376_10066163 | 3300014969 | Bacteria | 3054 |
| 96 | Ga0163161_10399403 | 3300017792 | Bacteria | 1102 |
| 97 | Ga0213871_10085106 | 3300021441 | Unclassified | 910 |
| 98 | Ga0228598_1046958 | 3300024227 | Unclassified | 855 |
| 99 | Ga0207642_10118712 | 3300025899 | Bacteria | 1360 |
| 100 | Ga0207645_10731267 | 3300025907 | Bacteria | 673 |
| 101 | Ga0207643_10421450 | 3300025908 | Bacteria | 846 |
| 102 | Ga0207654_10221499 | 3300025911 | Bacteria | 1255 |
| 103 | Ga0207654_10267280 | 3300025911 | Bacteria | 1152 |
| 104 | Ga0207695_10375637 | 3300025913 | Bacteria | 1307 |
| 105 | Ga0207671_10194710 | 3300025914 | Bacteria | 1581 |
| 106 | Ga0207693_10437638 | 3300025915 | Bacteria | 1022 |
| 107 | Ga0207693_10559866 | 3300025915 | Bacteria | 891 |
| 108 | Ga0207663_10537526 | 3300025916 | Bacteria | 912 |
| 109 | Ga0207660_10242469 | 3300025917 | Bacteria | 1420 |
| 110 | Ga0207652_10154311 | 3300025921 | Bacteria | 2057 |
| 111 | Ga0207652_10406955 | 3300025921 | Bacteria | 1228 |
| 112 | Ga0207681_10120646 | 3300025923 | Bacteria | 1922 |
| 113 | Ga0207681_10189124 | 3300025923 | Bacteria | 1574 |
| 114 | Ga0207681_10351961 | 3300025923 | Bacteria | 1179 |
| 115 | Ga0207650_10079311 | 3300025925 | Bacteria | 2486 |
| 116 | Ga0207687_10114799 | 3300025927 | Bacteria | 2005 |
| 117 | Ga0207664_10088284 | 3300025929 | Bacteria | 2537 |
| 118 | Ga0207644_10445495 | 3300025931 | Unclassified | 1063 |
| 119 | Ga0207644_10990262 | 3300025931 | Bacteria | 705 |
| 120 | Ga0207709_10040791 | 3300025935 | Bacteria | 2781 |
| 121 | Ga0207669_10002702 | 3300025937 | Bacteria | 7590 |
| 122 | Ga0207704_10176536 | 3300025938 | Bacteria | 1539 |
| 123 | Ga0207704_10220841 | 3300025938 | Bacteria | 1402 |
| 124 | Ga0207691_10009871 | 3300025940 | Bacteria | 9164 |
| 125 | Ga0207711_11226639 | 3300025941 | Unclassified | 692 |
| 126 | Ga0207689_10063391 | 3300025942 | Bacteria | 3041 |
| 127 | Ga0207679_10494655 | 3300025945 | Bacteria | 1090 |
| 128 | Ga0207679_11104432 | 3300025945 | Bacteria | 728 |
| 129 | Ga0207668_10121479 | 3300025972 | Bacteria | 1979 |
| 130 | Ga0207640_10789482 | 3300025981 | Bacteria | 822 |
| 131 | Ga0207677_10151266 | 3300026023 | Bacteria | 1791 |
| 132 | Ga0207703_10262101 | 3300026035 | Bacteria | 1563 |
| 133 | Ga0207639_10487384 | 3300026041 | Bacteria | 1124 |
| 134 | Ga0207639_10805373 | 3300026041 | Bacteria | 875 |
| 135 | Ga0207708_10519176 | 3300026075 | Bacteria | 1001 |
| 136 | Ga0207708_10605412 | 3300026075 | Bacteria | 929 |
| 137 | Ga0207702_10417300 | 3300026078 | Bacteria | 1297 |
| 138 | Ga0207641_10196495 | 3300026088 | Bacteria | 1857 |
| 139 | Ga0207648_10014812 | 3300026089 | Bacteria | 7194 |
| 140 | Ga0207648_10287374 | 3300026089 | Bacteria | 1472 |
| 141 | Ga0207676_10210501 | 3300026095 | Bacteria | 1724 |
| 142 | Ga0207674_10252939 | 3300026116 | Bacteria | 1709 |
| 143 | Ga0207675_100166407 | 3300026118 | Bacteria | 2106 |
| 144 | Ga0207675_100644867 | 3300026118 | Bacteria | 1065 |
| 145 | Ga0207683_10012003 | 3300026121 | Bacteria | 7395 |
| 146 | Ga0209984_1002948 | 3300027424 | Bacteria | 1925 |
| 147 | Ga0209995_1006953 | 3300027471 | Bacteria | 1825 |
| 148 | Ga0209968_1007146 | 3300027526 | Bacteria | 1687 |
| 149 | Ga0209813_10038072 | 3300027866 | Bacteria | 1452 |
| 150 | Ga0209974_10071699 | 3300027876 | Bacteria | 1182 |
| 151 | Ga0209974_10128884 | 3300027876 | Unclassified | 901 |
| 152 | Ga0207428_10015406 | 3300027907 | Bacteria | 6614 |
| 153 | Ga0268265_10283091 | 3300028380 | Bacteria | 1484 |
| 154 | Ga0268264_10228169 | 3300028381 | Unclassified | 1718 |
| 155 | Ga0268264_10792822 | 3300028381 | Bacteria | 946 |
| 156 | Ga0265328_10220353 | 3300031239 | Bacteria | 723 |
| 157 | Ga0265325_10004069 | 3300031241 | Bacteria | 9318 |
| 158 | Ga0265340_10040064 | 3300031247 | Bacteria | 2308 |
| 159 | Ga0265339_10078909 | 3300031249 | Bacteria | 1742 |
| 160 | Ga0265331_10126313 | 3300031250 | Bacteria | 1168 |
| 161 | Ga0265313_10120126 | 3300031595 | Unclassified | 1147 |
| 162 | Ga0265313_10271785 | 3300031595 | Bacteria | 687 |
| 163 | Ga0316579_10001369 | 3300031691 | Bacteria | 8834 |
| 164 | Ga0316579_10147777 | 3300031691 | Bacteria | 1133 |
| 165 | Ga0265314_10250372 | 3300031711 | Bacteria | 1017 |
| 166 | Ga0307409_101684933 | 3300031995 | Bacteria | 663 |
| 167 | Ga0373943_0031117 | 3300035170 | Unclassified | 2530 |
| 168 | Ga0373946_0017646 | 3300035171 | Unclassified | 2733 |
| 169 | Ga0373935_0082943 | 3300035692 | Unclassified | 2086 |
| 170 | Ga0373927_0052220 | 3300035695 | Unclassified | 2644 |
| 171 | Ga0373947_0172418 | 3300035725 | Bacteria | 1404 |
| 172 | Ga0373947_0177570 | 3300035725 | Bacteria | 1385 |
| 173 | Ga0373925_0083171 | 3300037068 | Unclassified | 2437 |
| 174 | Ga0316581_0001549 | 3300037588 | Bacteria | 5219 |
| 175 | Ga0436364_1550340 | 3300037853 | Bacteria | 1466 |
| 176 | Ga0436365_1322681 | 3300039437 | Bacteria | 2151 |
| 177 | Ga0436365_1355856 | 3300039437 | Bacteria | 710 |
| 178 | Ga0436360_0214377 | 3300039438 | Bacteria | 1433 |
| 179 | Ga0439453_0028742 | 3300041408 | Bacteria | 1043 |
| 180 | Ga0439461_0017770 | 3300041410 | Bacteria | 1386 |
| 181 | Ga0451847_0444539 | 3300041503 | Bacteria | 759 |
| 182 | Ga0439460_0021184 | 3300042461 | Bacteria | 1774 |
| 183 | Ga0466959_0645188 | 3300045049 | Bacteria | 711 |
| 184 | Ga0466967_0344864 | 3300045976 | Bacteria | 1441 |
| 185 | Ga0495641_0291724 | 3300046461 | Bacteria | 735 |
| 186 | Ga0495580_0176250 | 3300046472 | Unclassified | 1477 |
| 187 | Ga0495605_0086738 | 3300046474 | Bacteria | 1456 |
| 188 | Ga0495640_0559041 | 3300046533 | Bacteria | 693 |
| 189 | Ga0495598_0229923 | 3300046537 | Bacteria | 680 |
| 190 | Ga0495656_0092402 | 3300046615 | Bacteria | 1386 |
| 191 | Ga0495658_0127282 | 3300046683 | Unclassified | 1547 |
| 192 | Ga0495613_0124923 | 3300046689 | Unclassified | 1846 |
| 193 | Ga0495636_0173857 | 3300047318 | Bacteria | 975 |
| 194 | Ga0495614_0050374 | 3300048089 | Unclassified | 1784 |
| 195 | Ga0495615_0012552 | 3300048090 | Bacteria | 1749 |
| 196 | Ga0496100_0014209 | 3300048903 | Bacteria | 4616 |
| 197 | Ga0496101_0002302 | 3300048904 | Bacteria | 11681 |
| 198 | Ga0496102_0015422 | 3300048905 | Bacteria | 6656 |
| 199 | Ga0496103_0004970 | 3300048906 | Bacteria | 8024 |
| 200 | Ga0496104_0001459 | 3300048907 | Bacteria | 20443 |
| 201 | Ga0496104_0037372 | 3300048907 | Bacteria | 4541 |
| 202 | Ga0496105_0020603 | 3300048908 | Bacteria | 5330 |
| 203 | Ga0496106_0025029 | 3300048909 | Bacteria | 4440 |
| 204 | Ga0496107_0009730 | 3300048910 | Bacteria | 6667 |
| 205 | Ga0496108_0004926 | 3300048911 | Bacteria | 10785 |
| 206 | Ga0496108_0008116 | 3300048911 | Bacteria | 8514 |
| 207 | Ga0496109_0005534 | 3300048912 | Bacteria | 10581 |
| 208 | Ga0496109_0042653 | 3300048912 | Bacteria | 4110 |
| 209 | Ga0496110_0008208 | 3300048913 | Bacteria | 8392 |
| 210 | Ga0496110_0113550 | 3300048913 | Bacteria | 2436 |
| 211 | Ga0496111_0000245 | 3300048914 | Bacteria | 26053 |
| 212 | Ga0496111_0019852 | 3300048914 | Bacteria | 4672 |
| 213 | Ga0496112_0010464 | 3300048915 | Bacteria | 8414 |
| 214 | Ga0496112_0017506 | 3300048915 | Bacteria | 6734 |
| 215 | Ga0496112_1003103 | 3300048915 | Bacteria | 755 |
| 216 | Ga0496113_0114303 | 3300048916 | Bacteria | 2104 |
| 217 | Ga0496115_0039458 | 3300048918 | Bacteria | 3750 |
| 218 | Ga0496115_0046599 | 3300048918 | Bacteria | 3466 |
| 219 | Ga0496115_0152893 | 3300048918 | Bacteria | 1906 |
| 220 | Ga0501032_0236341 | 3300049569 | Bacteria | 1188 |
| 221 | Ga0501038_0411953 | 3300049574 | Unclassified | 1044 |
| 222 | Ga0501039_0314259 | 3300049575 | Bacteria | 1232 |
| 223 | Ga0501042_0063622 | 3300049578 | Bacteria | 2637 |
| 224 | Ga0501046_0145571 | 3300049580 | Unclassified | 1790 |
| 225 | Ga0501047_0270101 | 3300049581 | Unclassified | 1547 |
| 226 | Ga0501071_0145952 | 3300049587 | Bacteria | 1764 |
| 227 | Ga0501072_0001086 | 3300049588 | Bacteria | 20188 |
| 228 | Ga0501072_0376289 | 3300049588 | Bacteria | 1127 |
| 229 | Ga0501073_0136678 | 3300049589 | Unclassified | 1699 |
| 230 | Ga0501073_0448842 | 3300049589 | Bacteria | 891 |
| 231 | Ga0501074_0463878 | 3300049590 | Bacteria | 898 |
| 232 | Ga0501075_0348763 | 3300049591 | Bacteria | 1128 |
| 233 | Ga0501076_0245013 | 3300049592 | Bacteria | 1466 |
| 234 | Ga0501076_0649432 | 3300049592 | Bacteria | 871 |
| 235 | Ga0501077_0022623 | 3300049593 | Bacteria | 3982 |
| 236 | Ga0501077_0274293 | 3300049593 | Bacteria | 1073 |
| 237 | Ga0501080_0297331 | 3300049742 | Bacteria | 1465 |
| 238 | Ga0501083_0276413 | 3300049744 | Bacteria | 1092 |
| 239 | Ga0501083_0498574 | 3300049744 | Unclassified | 793 |
| 240 | Ga0501035_0101560 | 3300049822 | Bacteria | 2524 |
| 241 | Ga0501035_0404563 | 3300049822 | Bacteria | 1135 |
| 242 | Ga0501044_0060454 | 3300049823 | Bacteria | 3879 |
| 243 | Ga0501044_0204621 | 3300049823 | Bacteria | 1931 |
| 244 | Ga0501045_0258528 | 3300049824 | Bacteria | 1296 |
| 245 | nmdc:mga03683_118748_c1 | 3300050489 | Bacteria | 1174 |
| 246 | nmdc:mga03n38_70064_c1 | 3300050490 | Bacteria | 1621 |
| 247 | nmdc:mga00v17_249544_c1 | 3300050491 | Bacteria | 1151 |
| 248 | nmdc:mga00v17_707029_c1 | 3300050491 | Bacteria | 646 |
| 249 | nmdc:mga0yw44_345971_c1 | 3300050492 | Bacteria | 1000 |
| 250 | nmdc:mga0k408_112215_c1 | 3300050493 | Bacteria | 1612 |
| 251 | nmdc:mga0k408_64906_c1 | 3300050493 | Bacteria | 2125 |
| 252 | nmdc:mga06z11_287034_c1 | 3300050494 | Unclassified | 976 |
| 253 | nmdc:mga06z11_449466_c1 | 3300050494 | Bacteria | 778 |
| 254 | nmdc:mga06z11_77877_c1 | 3300050494 | Bacteria | 1771 |
| 255 | nmdc:mga04h51_175996_c1 | 3300050495 | Bacteria | 831 |
| 256 | nmdc:mga07m45_51613_c1 | 3300050496 | Bacteria | 2319 |
| 257 | nmdc:mga05p37_132231_c1 | 3300050507 | Bacteria | 3061 |
| 258 | nmdc:mga05p37_72561_c1 | 3300050507 | Bacteria | 4236 |
| 259 | nmdc:mga09592_295280_c1 | 3300050508 | Bacteria | 1405 |
| 260 | nmdc:mga0qj67_47612_c1 | 3300050509 | Bacteria | 3387 |
| 261 | nmdc:mga06r32_1027002_c1 | 3300050510 | Unclassified | 776 |
| 262 | nmdc:mga08y16_18814_c1 | 3300050511 | Bacteria | 7277 |
| 263 | nmdc:mga08y16_655755_c1 | 3300050511 | Bacteria | 1053 |
| 264 | Ga0500597_023022 | 3300053120 | Bacteria | 2486 |
| 265 | Ga0500658_0122217 | 3300053134 | Bacteria | 1155 |
| 266 | Ga0500604_0101088 | 3300053151 | Bacteria | 951 |
| 267 | Ga0501084_0099280 | 3300054114 | Bacteria | 2445 |
| 268 | Ga0501082_0000306 | 3300060353 | Bacteria | 43493 |
| 269 | Ga0501082_0116154 | 3300060353 | Bacteria | 2318 |
| 270 | Ga0501082_0259325 | 3300060353 | Unclassified | 1512 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10287374 | Ga0207648_102873742 | 156 |
| 2 | 3300041503 | Ga0451847_0444539 | Ga0451847_0444539_161_697 | 163 |
| 3 | 3300050494 | nmdc:mga06z11_449466_c1 | nmdc:mga06z11_449466_c1_12_503 | 163 |
| 4 | 3300024227 | Ga0228598_1046958 | Ga0228598_10469581 | 176 |
| 5 | 3300005290 | Ga0065712_10017769 | Ga0065712_100177692 | 178 |
| 6 | 3300005290 | Ga0065712_10294905 | Ga0065712_102949052 | 178 |
| 7 | 3300005293 | Ga0065715_10007628 | Ga0065715_100076283 | 178 |
| 8 | 3300005331 | Ga0070670_100296960 | Ga0070670_1002969602 | 178 |
| 9 | 3300005337 | Ga0070682_100281780 | Ga0070682_1002817801 | 178 |
| 10 | 3300005338 | Ga0068868_100148055 | Ga0068868_1001480552 | 178 |
| 11 | 3300005353 | Ga0070669_100031726 | Ga0070669_1000317263 | 178 |
| 12 | 3300005353 | Ga0070669_100547044 | Ga0070669_1005470442 | 178 |
| 13 | 3300005354 | Ga0070675_100586034 | Ga0070675_1005860342 | 178 |
| 14 | 3300005354 | Ga0070675_100599787 | Ga0070675_1005997871 | 178 |
| 15 | 3300005355 | Ga0070671_100150239 | Ga0070671_1001502392 | 178 |
| 16 | 3300005364 | Ga0070673_100571718 | Ga0070673_1005717181 | 178 |
| 17 | 3300005365 | Ga0070688_100811009 | Ga0070688_1008110091 | 178 |
| 18 | 3300005367 | Ga0070667_100366944 | Ga0070667_1003669441 | 178 |
| 19 | 3300005456 | Ga0070678_100007224 | Ga0070678_1000072245 | 178 |
| 20 | 3300005459 | Ga0068867_100017007 | Ga0068867_1000170073 | 178 |
| 21 | 3300005466 | Ga0070685_10113708 | Ga0070685_101137082 | 178 |
| 22 | 3300005539 | Ga0068853_100026786 | Ga0068853_1000267862 | 178 |
| 23 | 3300005543 | Ga0070672_100015478 | Ga0070672_1000154784 | 178 |
| 24 | 3300005544 | Ga0070686_100578731 | Ga0070686_1005787312 | 178 |
| 25 | 3300005577 | Ga0068857_100258586 | Ga0068857_1002585862 | 178 |
| 26 | 3300005577 | Ga0068857_100872706 | Ga0068857_1008727061 | 178 |
| 27 | 3300005617 | Ga0068859_100905709 | Ga0068859_1009057092 | 178 |
| 28 | 3300005718 | Ga0068866_10014875 | Ga0068866_100148752 | 178 |
| 29 | 3300005719 | Ga0068861_100081305 | Ga0068861_1000813052 | 178 |
| 30 | 3300005719 | Ga0068861_100089161 | Ga0068861_1000891612 | 178 |
| 31 | 3300005719 | Ga0068861_101135198 | Ga0068861_1011351981 | 178 |
| 32 | 3300005840 | Ga0068870_10167171 | Ga0068870_101671712 | 178 |
| 33 | 3300005841 | Ga0068863_100120480 | Ga0068863_1001204802 | 178 |
| 34 | 3300005842 | Ga0068858_100136452 | Ga0068858_1001364522 | 178 |
| 35 | 3300005843 | Ga0068860_100273656 | Ga0068860_1002736562 | 178 |
| 36 | 3300005844 | Ga0068862_100130355 | Ga0068862_1001303552 | 178 |
| 37 | 3300006048 | Ga0075363_100119344 | Ga0075363_1001193441 | 178 |
| 38 | 3300006051 | Ga0075364_10012827 | Ga0075364_100128272 | 178 |
| 39 | 3300006177 | Ga0075362_10005694 | Ga0075362_100056945 | 178 |
| 40 | 3300006177 | Ga0075362_10136983 | Ga0075362_101369832 | 178 |
| 41 | 3300006178 | Ga0075367_10065052 | Ga0075367_100650522 | 178 |
| 42 | 3300006186 | Ga0075369_10303344 | Ga0075369_103033442 | 178 |
| 43 | 3300006195 | Ga0075366_10051578 | Ga0075366_100515781 | 178 |
| 44 | 3300006237 | Ga0097621_100220410 | Ga0097621_1002204102 | 178 |
| 45 | 3300006881 | Ga0068865_100252418 | Ga0068865_1002524182 | 178 |
| 46 | 3300006881 | Ga0068865_100308985 | Ga0068865_1003089851 | 178 |
| 47 | 3300006931 | Ga0097620_100905741 | Ga0097620_1009057412 | 178 |
| 48 | 3300009093 | Ga0105240_10435386 | Ga0105240_104353862 | 178 |
| 49 | 3300009094 | Ga0111539_10059579 | Ga0111539_100595794 | 178 |
| 50 | 3300009094 | Ga0111539_11058820 | Ga0111539_110588201 | 178 |
| 51 | 3300009101 | Ga0105247_10668798 | Ga0105247_106687981 | 178 |
| 52 | 3300009148 | Ga0105243_10362199 | Ga0105243_103621992 | 178 |
| 53 | 3300009176 | Ga0105242_11305027 | Ga0105242_113050271 | 178 |
| 54 | 3300009177 | Ga0105248_10912162 | Ga0105248_109121622 | 178 |
| 55 | 3300009551 | Ga0105238_10041687 | Ga0105238_100416872 | 178 |
| 56 | 3300009553 | Ga0105249_10837821 | Ga0105249_108378212 | 178 |
| 57 | 3300009553 | Ga0105249_11060200 | Ga0105249_110602002 | 178 |
| 58 | 3300011119 | Ga0105246_10129909 | Ga0105246_101299092 | 178 |
| 59 | 3300013296 | Ga0157374_10246882 | Ga0157374_102468822 | 178 |
| 60 | 3300013297 | Ga0157378_10734562 | Ga0157378_107345622 | 178 |
| 61 | 3300013306 | Ga0163162_11329820 | Ga0163162_113298201 | 178 |
| 62 | 3300013307 | Ga0157372_10155889 | Ga0157372_101558891 | 178 |
| 63 | 3300014325 | Ga0163163_10370451 | Ga0163163_103704512 | 178 |
| 64 | 3300014325 | Ga0163163_10526905 | Ga0163163_105269052 | 178 |
| 65 | 3300014325 | Ga0163163_10894705 | Ga0163163_108947051 | 178 |
| 66 | 3300014968 | Ga0157379_10749493 | Ga0157379_107494931 | 178 |
| 67 | 3300014969 | Ga0157376_10066163 | Ga0157376_100661633 | 178 |
| 68 | 3300017792 | Ga0163161_10399403 | Ga0163161_103994032 | 178 |
| 69 | 3300021441 | Ga0213871_10085106 | Ga0213871_100851062 | 178 |
| 70 | 3300025899 | Ga0207642_10118712 | Ga0207642_101187121 | 178 |
| 71 | 3300025907 | Ga0207645_10731267 | Ga0207645_107312671 | 178 |
| 72 | 3300025908 | Ga0207643_10421450 | Ga0207643_104214501 | 178 |
| 73 | 3300025911 | Ga0207654_10267280 | Ga0207654_102672802 | 178 |
| 74 | 3300025913 | Ga0207695_10375637 | Ga0207695_103756372 | 178 |
| 75 | 3300025914 | Ga0207671_10194710 | Ga0207671_101947102 | 178 |
| 76 | 3300025923 | Ga0207681_10120646 | Ga0207681_101206462 | 178 |
| 77 | 3300025923 | Ga0207681_10189124 | Ga0207681_101891242 | 178 |
| 78 | 3300025923 | Ga0207681_10351961 | Ga0207681_103519612 | 178 |
| 79 | 3300025925 | Ga0207650_10079311 | Ga0207650_100793112 | 178 |
| 80 | 3300025927 | Ga0207687_10114799 | Ga0207687_101147992 | 178 |
| 81 | 3300025931 | Ga0207644_10990262 | Ga0207644_109902622 | 178 |
| 82 | 3300025935 | Ga0207709_10040791 | Ga0207709_100407912 | 178 |
| 83 | 3300025937 | Ga0207669_10002702 | Ga0207669_100027023 | 178 |
| 84 | 3300025938 | Ga0207704_10176536 | Ga0207704_101765362 | 178 |
| 85 | 3300025938 | Ga0207704_10220841 | Ga0207704_102208412 | 178 |
| 86 | 3300025940 | Ga0207691_10009871 | Ga0207691_100098714 | 178 |
| 87 | 3300025941 | Ga0207711_11226639 | Ga0207711_112266392 | 178 |
| 88 | 3300025942 | Ga0207689_10063391 | Ga0207689_100633912 | 178 |
| 89 | 3300025945 | Ga0207679_10494655 | Ga0207679_104946551 | 178 |
| 90 | 3300025945 | Ga0207679_11104432 | Ga0207679_111044322 | 178 |
| 91 | 3300025972 | Ga0207668_10121479 | Ga0207668_101214792 | 178 |
| 92 | 3300026023 | Ga0207677_10151266 | Ga0207677_101512662 | 178 |
| 93 | 3300026035 | Ga0207703_10262101 | Ga0207703_102621012 | 178 |
| 94 | 3300026041 | Ga0207639_10487384 | Ga0207639_104873842 | 178 |
| 95 | 3300026075 | Ga0207708_10519176 | Ga0207708_105191762 | 178 |
| 96 | 3300026075 | Ga0207708_10605412 | Ga0207708_106054121 | 178 |
| 97 | 3300026088 | Ga0207641_10196495 | Ga0207641_101964952 | 178 |
| 98 | 3300026089 | Ga0207648_10014812 | Ga0207648_100148124 | 178 |
| 99 | 3300026095 | Ga0207676_10210501 | Ga0207676_102105012 | 178 |
| 100 | 3300026116 | Ga0207674_10252939 | Ga0207674_102529392 | 178 |
| 101 | 3300026118 | Ga0207675_100166407 | Ga0207675_1001664072 | 178 |
| 102 | 3300026118 | Ga0207675_100644867 | Ga0207675_1006448672 | 178 |
| 103 | 3300026121 | Ga0207683_10012003 | Ga0207683_100120033 | 178 |
| 104 | 3300027876 | Ga0209974_10128884 | Ga0209974_101288841 | 178 |
| 105 | 3300027907 | Ga0207428_10015406 | Ga0207428_100154067 | 178 |
| 106 | 3300028380 | Ga0268265_10283091 | Ga0268265_102830912 | 178 |
| 107 | 3300028381 | Ga0268264_10228169 | Ga0268264_102281692 | 178 |
| 108 | 3300028381 | Ga0268264_10792822 | Ga0268264_107928222 | 178 |
| 109 | 3300031239 | Ga0265328_10220353 | Ga0265328_102203531 | 178 |
| 110 | 3300031247 | Ga0265340_10040064 | Ga0265340_100400642 | 178 |
| 111 | 3300031249 | Ga0265339_10078909 | Ga0265339_100789092 | 178 |
| 112 | 3300031250 | Ga0265331_10126313 | Ga0265331_101263132 | 178 |
| 113 | 3300031711 | Ga0265314_10250372 | Ga0265314_102503722 | 178 |
| 114 | 3300039437 | Ga0436365_1322681 | Ga0436365_1322681_1492_2028 | 178 |
| 115 | 3300039437 | Ga0436365_1355856 | Ga0436365_1355856_79_615 | 178 |
| 116 | 3300041408 | Ga0439453_0028742 | Ga0439453_0028742_47_583 | 178 |
| 117 | 3300041410 | Ga0439461_0017770 | Ga0439461_0017770_589_1125 | 178 |
| 118 | 3300042461 | Ga0439460_0021184 | Ga0439460_0021184_789_1325 | 178 |
| 119 | 3300046474 | Ga0495605_0086738 | Ga0495605_0086738_27_563 | 178 |
| 120 | 3300046537 | Ga0495598_0229923 | Ga0495598_0229923_29_565 | 178 |
| 121 | 3300046615 | Ga0495656_0092402 | Ga0495656_0092402_314_850 | 178 |
| 122 | 3300047318 | Ga0495636_0173857 | Ga0495636_0173857_186_722 | 178 |
| 123 | 3300048090 | Ga0495615_0012552 | Ga0495615_0012552_363_899 | 178 |
| 124 | 3300048918 | Ga0496115_0152893 | Ga0496115_0152893_312_848 | 178 |
| 125 | 3300049588 | Ga0501072_0001086 | Ga0501072_0001086_5222_5758 | 178 |
| 126 | 3300049591 | Ga0501075_0348763 | Ga0501075_0348763_452_988 | 178 |
| 127 | 3300049593 | Ga0501077_0274293 | Ga0501077_0274293_325_861 | 178 |
| 128 | 3300049744 | Ga0501083_0276413 | Ga0501083_0276413_51_587 | 178 |
| 129 | 3300050489 | nmdc:mga03683_118748_c1 | nmdc:mga03683_118748_c1_167_703 | 178 |
| 130 | 3300050490 | nmdc:mga03n38_70064_c1 | nmdc:mga03n38_70064_c1_884_1420 | 178 |
| 131 | 3300050491 | nmdc:mga00v17_249544_c1 | nmdc:mga00v17_249544_c1_198_734 | 178 |
| 132 | 3300050493 | nmdc:mga0k408_64906_c1 | nmdc:mga0k408_64906_c1_1248_1784 | 178 |
| 133 | 3300050494 | nmdc:mga06z11_77877_c1 | nmdc:mga06z11_77877_c1_754_1290 | 178 |
| 134 | 3300050496 | nmdc:mga07m45_51613_c1 | nmdc:mga07m45_51613_c1_295_831 | 178 |
| 135 | 3300050510 | nmdc:mga06r32_1027002_c1 | nmdc:mga06r32_1027002_c1_72_608 | 178 |
| 136 | 3300050511 | nmdc:mga08y16_18814_c1 | nmdc:mga08y16_18814_c1_2423_2959 | 178 |
| 137 | 3300050511 | nmdc:mga08y16_655755_c1 | nmdc:mga08y16_655755_c1_18_554 | 178 |
| 138 | 3300060353 | Ga0501082_0000306 | Ga0501082_0000306_21489_22025 | 178 |
| 139 | 3300005336 | Ga0070680_100178333 | Ga0070680_1001783332 | 179 |
| 140 | 3300005458 | Ga0070681_10662511 | Ga0070681_106625112 | 179 |
| 141 | 3300005530 | Ga0070679_100039626 | Ga0070679_1000396265 | 179 |
| 142 | 3300005981 | Ga0081538_10016815 | Ga0081538_100168152 | 179 |
| 143 | 3300006163 | Ga0070715_10528633 | Ga0070715_105286331 | 179 |
| 144 | 3300006846 | Ga0075430_100274628 | Ga0075430_1002746282 | 179 |
| 145 | 3300006847 | Ga0075431_100131175 | Ga0075431_1001311752 | 179 |
| 146 | 3300006880 | Ga0075429_100318773 | Ga0075429_1003187732 | 179 |
| 147 | 3300006880 | Ga0075429_100691432 | Ga0075429_1006914321 | 179 |
| 148 | 3300009094 | Ga0111539_11421005 | Ga0111539_114210052 | 179 |
| 149 | 3300025921 | Ga0207652_10154311 | Ga0207652_101543112 | 179 |
| 150 | 3300025929 | Ga0207664_10088284 | Ga0207664_100882842 | 179 |
| 151 | 3300031595 | Ga0265313_10271785 | Ga0265313_102717851 | 179 |
| 152 | 3300035725 | Ga0373947_0177570 | Ga0373947_0177570_328_867 | 179 |
| 153 | 3300039438 | Ga0436360_0214377 | Ga0436360_0214377_789_1328 | 179 |
| 154 | 3300049578 | Ga0501042_0063622 | Ga0501042_0063622_176_769 | 179 |
| 155 | 3300049580 | Ga0501046_0145571 | Ga0501046_0145571_578_1117 | 179 |
| 156 | 3300049581 | Ga0501047_0270101 | Ga0501047_0270101_226_765 | 179 |
| 157 | 3300049588 | Ga0501072_0376289 | Ga0501072_0376289_482_1021 | 179 |
| 158 | 3300049589 | Ga0501073_0448842 | Ga0501073_0448842_331_870 | 179 |
| 159 | 3300049744 | Ga0501083_0498574 | Ga0501083_0498574_45_584 | 179 |
| 160 | 3300049822 | Ga0501035_0404563 | Ga0501035_0404563_346_885 | 179 |
| 161 | 3300049823 | Ga0501044_0060454 | Ga0501044_0060454_204_743 | 179 |
| 162 | 3300049823 | Ga0501044_0204621 | Ga0501044_0204621_349_888 | 179 |
| 163 | 3300050508 | nmdc:mga09592_295280_c1 | nmdc:mga09592_295280_c1_689_1228 | 179 |
| 164 | 3300050509 | nmdc:mga0qj67_47612_c1 | nmdc:mga0qj67_47612_c1_1664_2203 | 179 |
| 165 | 3300054114 | Ga0501084_0099280 | Ga0501084_0099280_1696_2289 | 179 |
| 166 | 3300003659 | JGI25404J52841_10001140 | JGI25404J52841_100011403 | 180 |
| 167 | 3300005343 | Ga0070687_100476671 | Ga0070687_1004766711 | 180 |
| 168 | 3300005355 | Ga0070671_100265844 | Ga0070671_1002658442 | 180 |
| 169 | 3300005434 | Ga0070709_10181681 | Ga0070709_101816812 | 180 |
| 170 | 3300005435 | Ga0070714_100175942 | Ga0070714_1001759421 | 180 |
| 171 | 3300005437 | Ga0070710_10124116 | Ga0070710_101241162 | 180 |
| 172 | 3300005458 | Ga0070681_10085751 | Ga0070681_100857512 | 180 |
| 173 | 3300005535 | Ga0070684_100211452 | Ga0070684_1002114522 | 180 |
| 174 | 3300005578 | Ga0068854_100857457 | Ga0068854_1008574572 | 180 |
| 175 | 3300005983 | Ga0081540_1000241 | Ga0081540_100024154 | 180 |
| 176 | 3300006038 | Ga0075365_10540080 | Ga0075365_105400801 | 180 |
| 177 | 3300006051 | Ga0075364_10550682 | Ga0075364_105506822 | 180 |
| 178 | 3300006175 | Ga0070712_100100947 | Ga0070712_1001009472 | 180 |
| 179 | 3300006186 | Ga0075369_10020166 | Ga0075369_100201662 | 180 |
| 180 | 3300006880 | Ga0075429_101226315 | Ga0075429_1012263151 | 180 |
| 181 | 3300009093 | Ga0105240_10146384 | Ga0105240_101463843 | 180 |
| 182 | 3300009147 | Ga0114129_10085099 | Ga0114129_100850995 | 180 |
| 183 | 3300009147 | Ga0114129_10760278 | Ga0114129_107602781 | 180 |
| 184 | 3300009551 | Ga0105238_11274510 | Ga0105238_112745101 | 180 |
| 185 | 3300013104 | Ga0157370_10600571 | Ga0157370_106005711 | 180 |
| 186 | 3300013105 | Ga0157369_10870417 | Ga0157369_108704172 | 180 |
| 187 | 3300013307 | Ga0157372_10241314 | Ga0157372_102413142 | 180 |
| 188 | 3300025911 | Ga0207654_10221499 | Ga0207654_102214992 | 180 |
| 189 | 3300025915 | Ga0207693_10437638 | Ga0207693_104376382 | 180 |
| 190 | 3300025915 | Ga0207693_10559866 | Ga0207693_105598661 | 180 |
| 191 | 3300025916 | Ga0207663_10537526 | Ga0207663_105375261 | 180 |
| 192 | 3300025917 | Ga0207660_10242469 | Ga0207660_102424692 | 180 |
| 193 | 3300025921 | Ga0207652_10406955 | Ga0207652_104069552 | 180 |
| 194 | 3300025931 | Ga0207644_10445495 | Ga0207644_104454952 | 180 |
| 195 | 3300025981 | Ga0207640_10789482 | Ga0207640_107894822 | 180 |
| 196 | 3300026041 | Ga0207639_10805373 | Ga0207639_108053731 | 180 |
| 197 | 3300026078 | Ga0207702_10417300 | Ga0207702_104173001 | 180 |
| 198 | 3300027424 | Ga0209984_1002948 | Ga0209984_10029484 | 180 |
| 199 | 3300027471 | Ga0209995_1006953 | Ga0209995_10069533 | 180 |
| 200 | 3300027526 | Ga0209968_1007146 | Ga0209968_10071463 | 180 |
| 201 | 3300027866 | Ga0209813_10038072 | Ga0209813_100380722 | 180 |
| 202 | 3300027876 | Ga0209974_10071699 | Ga0209974_100716992 | 180 |
| 203 | 3300031241 | Ga0265325_10004069 | Ga0265325_100040696 | 180 |
| 204 | 3300031595 | Ga0265313_10120126 | Ga0265313_101201261 | 180 |
| 205 | 3300031691 | Ga0316579_10001369 | Ga0316579_100013697 | 180 |
| 206 | 3300031691 | Ga0316579_10147777 | Ga0316579_101477771 | 180 |
| 207 | 3300031995 | Ga0307409_101684933 | Ga0307409_1016849331 | 180 |
| 208 | 3300035170 | Ga0373943_0031117 | Ga0373943_0031117_212_754 | 180 |
| 209 | 3300035171 | Ga0373946_0017646 | Ga0373946_0017646_431_973 | 180 |
| 210 | 3300035692 | Ga0373935_0082943 | Ga0373935_0082943_203_745 | 180 |
| 211 | 3300035695 | Ga0373927_0052220 | Ga0373927_0052220_255_797 | 180 |
| 212 | 3300035725 | Ga0373947_0172418 | Ga0373947_0172418_283_825 | 180 |
| 213 | 3300037068 | Ga0373925_0083171 | Ga0373925_0083171_237_779 | 180 |
| 214 | 3300037588 | Ga0316581_0001549 | Ga0316581_0001549_3187_3729 | 180 |
| 215 | 3300037853 | Ga0436364_1550340 | Ga0436364_1550340_83_625 | 180 |
| 216 | 3300045049 | Ga0466959_0645188 | Ga0466959_0645188_113_655 | 180 |
| 217 | 3300045976 | Ga0466967_0344864 | Ga0466967_0344864_336_878 | 180 |
| 218 | 3300046461 | Ga0495641_0291724 | Ga0495641_0291724_118_660 | 180 |
| 219 | 3300046472 | Ga0495580_0176250 | Ga0495580_0176250_893_1435 | 180 |
| 220 | 3300046533 | Ga0495640_0559041 | Ga0495640_0559041_80_622 | 180 |
| 221 | 3300046683 | Ga0495658_0127282 | Ga0495658_0127282_527_1069 | 180 |
| 222 | 3300046689 | Ga0495613_0124923 | Ga0495613_0124923_1043_1585 | 180 |
| 223 | 3300048089 | Ga0495614_0050374 | Ga0495614_0050374_649_1191 | 180 |
| 224 | 3300048903 | Ga0496100_0014209 | Ga0496100_0014209_612_1154 | 180 |
| 225 | 3300048904 | Ga0496101_0002302 | Ga0496101_0002302_8457_8999 | 180 |
| 226 | 3300048905 | Ga0496102_0015422 | Ga0496102_0015422_761_1303 | 180 |
| 227 | 3300048906 | Ga0496103_0004970 | Ga0496103_0004970_5003_5545 | 180 |
| 228 | 3300048907 | Ga0496104_0001459 | Ga0496104_0001459_82_624 | 180 |
| 229 | 3300048907 | Ga0496104_0037372 | Ga0496104_0037372_670_1212 | 180 |
| 230 | 3300048908 | Ga0496105_0020603 | Ga0496105_0020603_1976_2518 | 180 |
| 231 | 3300048909 | Ga0496106_0025029 | Ga0496106_0025029_3216_3758 | 180 |
| 232 | 3300048910 | Ga0496107_0009730 | Ga0496107_0009730_4199_4741 | 180 |
| 233 | 3300048911 | Ga0496108_0004926 | Ga0496108_0004926_2887_3429 | 180 |
| 234 | 3300048911 | Ga0496108_0008116 | Ga0496108_0008116_2806_3348 | 180 |
| 235 | 3300048912 | Ga0496109_0005534 | Ga0496109_0005534_2726_3268 | 180 |
| 236 | 3300048912 | Ga0496109_0042653 | Ga0496109_0042653_2871_3413 | 180 |
| 237 | 3300048913 | Ga0496110_0008208 | Ga0496110_0008208_5214_5756 | 180 |
| 238 | 3300048913 | Ga0496110_0113550 | Ga0496110_0113550_1212_1754 | 180 |
| 239 | 3300048914 | Ga0496111_0000245 | Ga0496111_0000245_17676_18218 | 180 |
| 240 | 3300048914 | Ga0496111_0019852 | Ga0496111_0019852_2719_3261 | 180 |
| 241 | 3300048915 | Ga0496112_0010464 | Ga0496112_0010464_5013_5555 | 180 |
| 242 | 3300048915 | Ga0496112_0017506 | Ga0496112_0017506_1750_2292 | 180 |
| 243 | 3300048915 | Ga0496112_1003103 | Ga0496112_1003103_17_571 | 180 |
| 244 | 3300048916 | Ga0496113_0114303 | Ga0496113_0114303_348_890 | 180 |
| 245 | 3300048918 | Ga0496115_0039458 | Ga0496115_0039458_1264_1806 | 180 |
| 246 | 3300048918 | Ga0496115_0046599 | Ga0496115_0046599_2709_3362 | 180 |
| 247 | 3300049569 | Ga0501032_0236341 | Ga0501032_0236341_605_1177 | 180 |
| 248 | 3300049574 | Ga0501038_0411953 | Ga0501038_0411953_76_618 | 180 |
| 249 | 3300049575 | Ga0501039_0314259 | Ga0501039_0314259_178_750 | 180 |
| 250 | 3300049587 | Ga0501071_0145952 | Ga0501071_0145952_51_605 | 180 |
| 251 | 3300049589 | Ga0501073_0136678 | Ga0501073_0136678_516_1058 | 180 |
| 252 | 3300049590 | Ga0501074_0463878 | Ga0501074_0463878_55_597 | 180 |
| 253 | 3300049592 | Ga0501076_0245013 | Ga0501076_0245013_412_954 | 180 |
| 254 | 3300049592 | Ga0501076_0649432 | Ga0501076_0649432_255_797 | 180 |
| 255 | 3300049593 | Ga0501077_0022623 | Ga0501077_0022623_392_934 | 180 |
| 256 | 3300049742 | Ga0501080_0297331 | Ga0501080_0297331_899_1441 | 180 |
| 257 | 3300049822 | Ga0501035_0101560 | Ga0501035_0101560_1871_2425 | 180 |
| 258 | 3300049824 | Ga0501045_0258528 | Ga0501045_0258528_17_559 | 180 |
| 259 | 3300050491 | nmdc:mga00v17_707029_c1 | nmdc:mga00v17_707029_c1_36_578 | 180 |
| 260 | 3300050492 | nmdc:mga0yw44_345971_c1 | nmdc:mga0yw44_345971_c1_352_894 | 180 |
| 261 | 3300050493 | nmdc:mga0k408_112215_c1 | nmdc:mga0k408_112215_c1_271_903 | 180 |
| 262 | 3300050494 | nmdc:mga06z11_287034_c1 | nmdc:mga06z11_287034_c1_159_701 | 180 |
| 263 | 3300050495 | nmdc:mga04h51_175996_c1 | nmdc:mga04h51_175996_c1_31_573 | 180 |
| 264 | 3300050507 | nmdc:mga05p37_132231_c1 | nmdc:mga05p37_132231_c1_2318_2860 | 180 |
| 265 | 3300050507 | nmdc:mga05p37_72561_c1 | nmdc:mga05p37_72561_c1_2800_3342 | 180 |
| 266 | 3300053120 | Ga0500597_023022 | Ga0500597_023022_1062_1604 | 180 |
| 267 | 3300053134 | Ga0500658_0122217 | Ga0500658_0122217_469_1011 | 180 |
| 268 | 3300053151 | Ga0500604_0101088 | Ga0500604_0101088_312_869 | 180 |
| 269 | 3300060353 | Ga0501082_0116154 | Ga0501082_0116154_529_1071 | 180 |
| 270 | 3300060353 | Ga0501082_0259325 | Ga0501082_0259325_923_1465 | 180 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fq0-assembly1.cif.gz_A | the structure of kdgf from halomonas sp. | 0.8732 | 54 | 152 |
| 4e2g-assembly2.cif.gz_C | crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus | 0.8414 | 63 | 152 |
| 5hk2-assembly1.cif.gz_B | human sigma-1 receptor bound to 4-ibp | 0.8369 | 54 | 152 |
| 3d82-assembly1.cif.gz_E | crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution | 0.8348 | 53 | 151 |
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.8298 | 53 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76241_5_112_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8875 | 64 | 152 | 2.60.120.10 |
| af_Q9ZVZ4_163_347_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8713 | 54 | 152 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8441 | 50 | 152 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8249 | 53 | 152 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.822 | 66 | 150 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537LD82-F1-model_v4 | Cysteine dioxygenase | 0.9929 | 1 | 180 |
|
| AF-A0A537LD82-F1-model_v4 | Cysteine dioxygenase | 0.9874 | 1 | 180 |
|
| AF-A0A7X1P7F5-F1-model_v4 | Cysteine dioxygenase | 0.9859 | 1 | 171 |
|
| AF-A0A3D2BTJ8-F1-model_v4 | Cysteine dioxygenase | 0.9848 | 1 | 176 |
|
| AF-A0A1Z8NRZ4-F1-model_v4 | Cysteine dioxygenase | 0.9791 | 1 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar