F377239

General Info

Members Datasets Scaffolds Average Seq Length
270 205 270 180

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0063622|Ga0501042_0063622_176_769
Length 197
Sequence MSEADAKSAREIRTWRSAMSYNLDQFISDCRTILARDPGPSGREEVRVRLERLLGEPEFLRAYCGDDAPQGLKVLYEDPQLGFQVLAHINDKARVSPPHDHGASWAIYGQATKYTEMTEWERVDTGTGGKAELRPTTKYRLMPGQAGIYQDGKIHSIDYPDHARFIRVTGTNLDKINRVRFDLKTGEVHQMTPQQAT

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0
Rhizoplane 8.89
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001140 3300003659 Bacteria 4501
2 Ga0065712_10017769 3300005290 Bacteria 1916
3 Ga0065712_10294905 3300005290 Bacteria 870
4 Ga0065715_10007628 3300005293 Bacteria 3623
5 Ga0070670_100296960 3300005331 Bacteria 1412
6 Ga0070680_100178333 3300005336 Bacteria 1789
7 Ga0070682_100281780 3300005337 Bacteria 1212
8 Ga0068868_100148055 3300005338 Bacteria 1932
9 Ga0070687_100476671 3300005343 Unclassified 835
10 Ga0070669_100031726 3300005353 Bacteria 3817
11 Ga0070669_100547044 3300005353 Bacteria 965
12 Ga0070675_100586034 3300005354 Bacteria 1011
13 Ga0070675_100599787 3300005354 Bacteria 999
14 Ga0070671_100150239 3300005355 Bacteria 1967
15 Ga0070671_100265844 3300005355 Unclassified 1458
16 Ga0070673_100571718 3300005364 Bacteria 1028
17 Ga0070688_100811009 3300005365 Bacteria 733
18 Ga0070667_100366944 3300005367 Unclassified 1306
19 Ga0070709_10181681 3300005434 Bacteria 1478
20 Ga0070714_100175942 3300005435 Bacteria 1944
21 Ga0070710_10124116 3300005437 Bacteria 1567
22 Ga0070678_100007224 3300005456 Bacteria 6573
23 Ga0070681_10085751 3300005458 Bacteria 3102
24 Ga0070681_10662511 3300005458 Bacteria 959
25 Ga0068867_100017007 3300005459 Bacteria 5167
26 Ga0070685_10113708 3300005466 Bacteria 1672
27 Ga0070679_100039626 3300005530 Bacteria 4682
28 Ga0070684_100211452 3300005535 Bacteria 1768
29 Ga0068853_100026786 3300005539 Bacteria 4843
30 Ga0070672_100015478 3300005543 Bacteria 5433
31 Ga0070686_100578731 3300005544 Unclassified 882
32 Ga0068857_100258586 3300005577 Bacteria 1597
33 Ga0068857_100872706 3300005577 Bacteria 862
34 Ga0068854_100857457 3300005578 Bacteria 796
35 Ga0068859_100905709 3300005617 Unclassified 966
36 Ga0068866_10014875 3300005718 Bacteria 3445
37 Ga0068861_100081305 3300005719 Bacteria 2537
38 Ga0068861_100089161 3300005719 Bacteria 2431
39 Ga0068861_101135198 3300005719 Bacteria 753
40 Ga0068870_10167171 3300005840 Bacteria 1309
41 Ga0068863_100120480 3300005841 Bacteria 2501
42 Ga0068858_100136452 3300005842 Bacteria 2302
43 Ga0068860_100273656 3300005843 Bacteria 1649
44 Ga0068862_100130355 3300005844 Bacteria 2223
45 Ga0081538_10016815 3300005981 Bacteria 5585
46 Ga0081540_1000241 3300005983 Bacteria 57441
47 Ga0075365_10540080 3300006038 Bacteria 824
48 Ga0075363_100119344 3300006048 Bacteria 1471
49 Ga0075364_10012827 3300006051 Bacteria 5140
50 Ga0075364_10550682 3300006051 Bacteria 788
51 Ga0070715_10528633 3300006163 Bacteria 680
52 Ga0070712_100100947 3300006175 Bacteria 2133
53 Ga0075362_10005694 3300006177 Bacteria 4584
54 Ga0075362_10136983 3300006177 Bacteria 1168
55 Ga0075367_10065052 3300006178 Bacteria 2183
56 Ga0075369_10020166 3300006186 Bacteria 2729
57 Ga0075369_10303344 3300006186 Bacteria 746
58 Ga0075366_10051578 3300006195 Bacteria 2444
59 Ga0097621_100220410 3300006237 Bacteria 1653
60 Ga0075430_100274628 3300006846 Bacteria 1395
61 Ga0075431_100131175 3300006847 Bacteria 2584
62 Ga0075429_100318773 3300006880 Bacteria 1361
63 Ga0075429_100691432 3300006880 Unclassified 894
64 Ga0075429_101226315 3300006880 Bacteria 655
65 Ga0068865_100252418 3300006881 Bacteria 1393
66 Ga0068865_100308985 3300006881 Bacteria 1268
67 Ga0097620_100905741 3300006931 Unclassified 966
68 Ga0105240_10146384 3300009093 Bacteria 2818
69 Ga0105240_10435386 3300009093 Bacteria 1470
70 Ga0111539_10059579 3300009094 Bacteria 4526
71 Ga0111539_11058820 3300009094 Bacteria 943
72 Ga0111539_11421005 3300009094 Bacteria 805
73 Ga0105247_10668798 3300009101 Bacteria 778
74 Ga0114129_10085099 3300009147 Bacteria 4387
75 Ga0114129_10760278 3300009147 Bacteria 1240
76 Ga0105243_10362199 3300009148 Unclassified 1335
77 Ga0105242_11305027 3300009176 Unclassified 750
78 Ga0105248_10912162 3300009177 Bacteria 992
79 Ga0105238_10041687 3300009551 Bacteria 4650
80 Ga0105238_11274510 3300009551 Bacteria 760
81 Ga0105249_10837821 3300009553 Bacteria 985
82 Ga0105249_11060200 3300009553 Bacteria 880
83 Ga0105246_10129909 3300011119 Bacteria 1880
84 Ga0157370_10600571 3300013104 Bacteria 1008
85 Ga0157369_10870417 3300013105 Bacteria 924
86 Ga0157374_10246882 3300013296 Bacteria 1756
87 Ga0157378_10734562 3300013297 Bacteria 1009
88 Ga0163162_11329820 3300013306 Bacteria 817
89 Ga0157372_10155889 3300013307 Bacteria 2638
90 Ga0157372_10241314 3300013307 Bacteria 2097
91 Ga0163163_10370451 3300014325 Bacteria 1489
92 Ga0163163_10526905 3300014325 Bacteria 1244
93 Ga0163163_10894705 3300014325 Unclassified 951
94 Ga0157379_10749493 3300014968 Bacteria 919
95 Ga0157376_10066163 3300014969 Bacteria 3054
96 Ga0163161_10399403 3300017792 Bacteria 1102
97 Ga0213871_10085106 3300021441 Unclassified 910
98 Ga0228598_1046958 3300024227 Unclassified 855
99 Ga0207642_10118712 3300025899 Bacteria 1360
100 Ga0207645_10731267 3300025907 Bacteria 673
101 Ga0207643_10421450 3300025908 Bacteria 846
102 Ga0207654_10221499 3300025911 Bacteria 1255
103 Ga0207654_10267280 3300025911 Bacteria 1152
104 Ga0207695_10375637 3300025913 Bacteria 1307
105 Ga0207671_10194710 3300025914 Bacteria 1581
106 Ga0207693_10437638 3300025915 Bacteria 1022
107 Ga0207693_10559866 3300025915 Bacteria 891
108 Ga0207663_10537526 3300025916 Bacteria 912
109 Ga0207660_10242469 3300025917 Bacteria 1420
110 Ga0207652_10154311 3300025921 Bacteria 2057
111 Ga0207652_10406955 3300025921 Bacteria 1228
112 Ga0207681_10120646 3300025923 Bacteria 1922
113 Ga0207681_10189124 3300025923 Bacteria 1574
114 Ga0207681_10351961 3300025923 Bacteria 1179
115 Ga0207650_10079311 3300025925 Bacteria 2486
116 Ga0207687_10114799 3300025927 Bacteria 2005
117 Ga0207664_10088284 3300025929 Bacteria 2537
118 Ga0207644_10445495 3300025931 Unclassified 1063
119 Ga0207644_10990262 3300025931 Bacteria 705
120 Ga0207709_10040791 3300025935 Bacteria 2781
121 Ga0207669_10002702 3300025937 Bacteria 7590
122 Ga0207704_10176536 3300025938 Bacteria 1539
123 Ga0207704_10220841 3300025938 Bacteria 1402
124 Ga0207691_10009871 3300025940 Bacteria 9164
125 Ga0207711_11226639 3300025941 Unclassified 692
126 Ga0207689_10063391 3300025942 Bacteria 3041
127 Ga0207679_10494655 3300025945 Bacteria 1090
128 Ga0207679_11104432 3300025945 Bacteria 728
129 Ga0207668_10121479 3300025972 Bacteria 1979
130 Ga0207640_10789482 3300025981 Bacteria 822
131 Ga0207677_10151266 3300026023 Bacteria 1791
132 Ga0207703_10262101 3300026035 Bacteria 1563
133 Ga0207639_10487384 3300026041 Bacteria 1124
134 Ga0207639_10805373 3300026041 Bacteria 875
135 Ga0207708_10519176 3300026075 Bacteria 1001
136 Ga0207708_10605412 3300026075 Bacteria 929
137 Ga0207702_10417300 3300026078 Bacteria 1297
138 Ga0207641_10196495 3300026088 Bacteria 1857
139 Ga0207648_10014812 3300026089 Bacteria 7194
140 Ga0207648_10287374 3300026089 Bacteria 1472
141 Ga0207676_10210501 3300026095 Bacteria 1724
142 Ga0207674_10252939 3300026116 Bacteria 1709
143 Ga0207675_100166407 3300026118 Bacteria 2106
144 Ga0207675_100644867 3300026118 Bacteria 1065
145 Ga0207683_10012003 3300026121 Bacteria 7395
146 Ga0209984_1002948 3300027424 Bacteria 1925
147 Ga0209995_1006953 3300027471 Bacteria 1825
148 Ga0209968_1007146 3300027526 Bacteria 1687
149 Ga0209813_10038072 3300027866 Bacteria 1452
150 Ga0209974_10071699 3300027876 Bacteria 1182
151 Ga0209974_10128884 3300027876 Unclassified 901
152 Ga0207428_10015406 3300027907 Bacteria 6614
153 Ga0268265_10283091 3300028380 Bacteria 1484
154 Ga0268264_10228169 3300028381 Unclassified 1718
155 Ga0268264_10792822 3300028381 Bacteria 946
156 Ga0265328_10220353 3300031239 Bacteria 723
157 Ga0265325_10004069 3300031241 Bacteria 9318
158 Ga0265340_10040064 3300031247 Bacteria 2308
159 Ga0265339_10078909 3300031249 Bacteria 1742
160 Ga0265331_10126313 3300031250 Bacteria 1168
161 Ga0265313_10120126 3300031595 Unclassified 1147
162 Ga0265313_10271785 3300031595 Bacteria 687
163 Ga0316579_10001369 3300031691 Bacteria 8834
164 Ga0316579_10147777 3300031691 Bacteria 1133
165 Ga0265314_10250372 3300031711 Bacteria 1017
166 Ga0307409_101684933 3300031995 Bacteria 663
167 Ga0373943_0031117 3300035170 Unclassified 2530
168 Ga0373946_0017646 3300035171 Unclassified 2733
169 Ga0373935_0082943 3300035692 Unclassified 2086
170 Ga0373927_0052220 3300035695 Unclassified 2644
171 Ga0373947_0172418 3300035725 Bacteria 1404
172 Ga0373947_0177570 3300035725 Bacteria 1385
173 Ga0373925_0083171 3300037068 Unclassified 2437
174 Ga0316581_0001549 3300037588 Bacteria 5219
175 Ga0436364_1550340 3300037853 Bacteria 1466
176 Ga0436365_1322681 3300039437 Bacteria 2151
177 Ga0436365_1355856 3300039437 Bacteria 710
178 Ga0436360_0214377 3300039438 Bacteria 1433
179 Ga0439453_0028742 3300041408 Bacteria 1043
180 Ga0439461_0017770 3300041410 Bacteria 1386
181 Ga0451847_0444539 3300041503 Bacteria 759
182 Ga0439460_0021184 3300042461 Bacteria 1774
183 Ga0466959_0645188 3300045049 Bacteria 711
184 Ga0466967_0344864 3300045976 Bacteria 1441
185 Ga0495641_0291724 3300046461 Bacteria 735
186 Ga0495580_0176250 3300046472 Unclassified 1477
187 Ga0495605_0086738 3300046474 Bacteria 1456
188 Ga0495640_0559041 3300046533 Bacteria 693
189 Ga0495598_0229923 3300046537 Bacteria 680
190 Ga0495656_0092402 3300046615 Bacteria 1386
191 Ga0495658_0127282 3300046683 Unclassified 1547
192 Ga0495613_0124923 3300046689 Unclassified 1846
193 Ga0495636_0173857 3300047318 Bacteria 975
194 Ga0495614_0050374 3300048089 Unclassified 1784
195 Ga0495615_0012552 3300048090 Bacteria 1749
196 Ga0496100_0014209 3300048903 Bacteria 4616
197 Ga0496101_0002302 3300048904 Bacteria 11681
198 Ga0496102_0015422 3300048905 Bacteria 6656
199 Ga0496103_0004970 3300048906 Bacteria 8024
200 Ga0496104_0001459 3300048907 Bacteria 20443
201 Ga0496104_0037372 3300048907 Bacteria 4541
202 Ga0496105_0020603 3300048908 Bacteria 5330
203 Ga0496106_0025029 3300048909 Bacteria 4440
204 Ga0496107_0009730 3300048910 Bacteria 6667
205 Ga0496108_0004926 3300048911 Bacteria 10785
206 Ga0496108_0008116 3300048911 Bacteria 8514
207 Ga0496109_0005534 3300048912 Bacteria 10581
208 Ga0496109_0042653 3300048912 Bacteria 4110
209 Ga0496110_0008208 3300048913 Bacteria 8392
210 Ga0496110_0113550 3300048913 Bacteria 2436
211 Ga0496111_0000245 3300048914 Bacteria 26053
212 Ga0496111_0019852 3300048914 Bacteria 4672
213 Ga0496112_0010464 3300048915 Bacteria 8414
214 Ga0496112_0017506 3300048915 Bacteria 6734
215 Ga0496112_1003103 3300048915 Bacteria 755
216 Ga0496113_0114303 3300048916 Bacteria 2104
217 Ga0496115_0039458 3300048918 Bacteria 3750
218 Ga0496115_0046599 3300048918 Bacteria 3466
219 Ga0496115_0152893 3300048918 Bacteria 1906
220 Ga0501032_0236341 3300049569 Bacteria 1188
221 Ga0501038_0411953 3300049574 Unclassified 1044
222 Ga0501039_0314259 3300049575 Bacteria 1232
223 Ga0501042_0063622 3300049578 Bacteria 2637
224 Ga0501046_0145571 3300049580 Unclassified 1790
225 Ga0501047_0270101 3300049581 Unclassified 1547
226 Ga0501071_0145952 3300049587 Bacteria 1764
227 Ga0501072_0001086 3300049588 Bacteria 20188
228 Ga0501072_0376289 3300049588 Bacteria 1127
229 Ga0501073_0136678 3300049589 Unclassified 1699
230 Ga0501073_0448842 3300049589 Bacteria 891
231 Ga0501074_0463878 3300049590 Bacteria 898
232 Ga0501075_0348763 3300049591 Bacteria 1128
233 Ga0501076_0245013 3300049592 Bacteria 1466
234 Ga0501076_0649432 3300049592 Bacteria 871
235 Ga0501077_0022623 3300049593 Bacteria 3982
236 Ga0501077_0274293 3300049593 Bacteria 1073
237 Ga0501080_0297331 3300049742 Bacteria 1465
238 Ga0501083_0276413 3300049744 Bacteria 1092
239 Ga0501083_0498574 3300049744 Unclassified 793
240 Ga0501035_0101560 3300049822 Bacteria 2524
241 Ga0501035_0404563 3300049822 Bacteria 1135
242 Ga0501044_0060454 3300049823 Bacteria 3879
243 Ga0501044_0204621 3300049823 Bacteria 1931
244 Ga0501045_0258528 3300049824 Bacteria 1296
245 nmdc:mga03683_118748_c1 3300050489 Bacteria 1174
246 nmdc:mga03n38_70064_c1 3300050490 Bacteria 1621
247 nmdc:mga00v17_249544_c1 3300050491 Bacteria 1151
248 nmdc:mga00v17_707029_c1 3300050491 Bacteria 646
249 nmdc:mga0yw44_345971_c1 3300050492 Bacteria 1000
250 nmdc:mga0k408_112215_c1 3300050493 Bacteria 1612
251 nmdc:mga0k408_64906_c1 3300050493 Bacteria 2125
252 nmdc:mga06z11_287034_c1 3300050494 Unclassified 976
253 nmdc:mga06z11_449466_c1 3300050494 Bacteria 778
254 nmdc:mga06z11_77877_c1 3300050494 Bacteria 1771
255 nmdc:mga04h51_175996_c1 3300050495 Bacteria 831
256 nmdc:mga07m45_51613_c1 3300050496 Bacteria 2319
257 nmdc:mga05p37_132231_c1 3300050507 Bacteria 3061
258 nmdc:mga05p37_72561_c1 3300050507 Bacteria 4236
259 nmdc:mga09592_295280_c1 3300050508 Bacteria 1405
260 nmdc:mga0qj67_47612_c1 3300050509 Bacteria 3387
261 nmdc:mga06r32_1027002_c1 3300050510 Unclassified 776
262 nmdc:mga08y16_18814_c1 3300050511 Bacteria 7277
263 nmdc:mga08y16_655755_c1 3300050511 Bacteria 1053
264 Ga0500597_023022 3300053120 Bacteria 2486
265 Ga0500658_0122217 3300053134 Bacteria 1155
266 Ga0500604_0101088 3300053151 Bacteria 951
267 Ga0501084_0099280 3300054114 Bacteria 2445
268 Ga0501082_0000306 3300060353 Bacteria 43493
269 Ga0501082_0116154 3300060353 Bacteria 2318
270 Ga0501082_0259325 3300060353 Unclassified 1512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10287374 Ga0207648_102873742 156
2 3300041503 Ga0451847_0444539 Ga0451847_0444539_161_697 163
3 3300050494 nmdc:mga06z11_449466_c1 nmdc:mga06z11_449466_c1_12_503 163
4 3300024227 Ga0228598_1046958 Ga0228598_10469581 176
5 3300005290 Ga0065712_10017769 Ga0065712_100177692 178
6 3300005290 Ga0065712_10294905 Ga0065712_102949052 178
7 3300005293 Ga0065715_10007628 Ga0065715_100076283 178
8 3300005331 Ga0070670_100296960 Ga0070670_1002969602 178
9 3300005337 Ga0070682_100281780 Ga0070682_1002817801 178
10 3300005338 Ga0068868_100148055 Ga0068868_1001480552 178
11 3300005353 Ga0070669_100031726 Ga0070669_1000317263 178
12 3300005353 Ga0070669_100547044 Ga0070669_1005470442 178
13 3300005354 Ga0070675_100586034 Ga0070675_1005860342 178
14 3300005354 Ga0070675_100599787 Ga0070675_1005997871 178
15 3300005355 Ga0070671_100150239 Ga0070671_1001502392 178
16 3300005364 Ga0070673_100571718 Ga0070673_1005717181 178
17 3300005365 Ga0070688_100811009 Ga0070688_1008110091 178
18 3300005367 Ga0070667_100366944 Ga0070667_1003669441 178
19 3300005456 Ga0070678_100007224 Ga0070678_1000072245 178
20 3300005459 Ga0068867_100017007 Ga0068867_1000170073 178
21 3300005466 Ga0070685_10113708 Ga0070685_101137082 178
22 3300005539 Ga0068853_100026786 Ga0068853_1000267862 178
23 3300005543 Ga0070672_100015478 Ga0070672_1000154784 178
24 3300005544 Ga0070686_100578731 Ga0070686_1005787312 178
25 3300005577 Ga0068857_100258586 Ga0068857_1002585862 178
26 3300005577 Ga0068857_100872706 Ga0068857_1008727061 178
27 3300005617 Ga0068859_100905709 Ga0068859_1009057092 178
28 3300005718 Ga0068866_10014875 Ga0068866_100148752 178
29 3300005719 Ga0068861_100081305 Ga0068861_1000813052 178
30 3300005719 Ga0068861_100089161 Ga0068861_1000891612 178
31 3300005719 Ga0068861_101135198 Ga0068861_1011351981 178
32 3300005840 Ga0068870_10167171 Ga0068870_101671712 178
33 3300005841 Ga0068863_100120480 Ga0068863_1001204802 178
34 3300005842 Ga0068858_100136452 Ga0068858_1001364522 178
35 3300005843 Ga0068860_100273656 Ga0068860_1002736562 178
36 3300005844 Ga0068862_100130355 Ga0068862_1001303552 178
37 3300006048 Ga0075363_100119344 Ga0075363_1001193441 178
38 3300006051 Ga0075364_10012827 Ga0075364_100128272 178
39 3300006177 Ga0075362_10005694 Ga0075362_100056945 178
40 3300006177 Ga0075362_10136983 Ga0075362_101369832 178
41 3300006178 Ga0075367_10065052 Ga0075367_100650522 178
42 3300006186 Ga0075369_10303344 Ga0075369_103033442 178
43 3300006195 Ga0075366_10051578 Ga0075366_100515781 178
44 3300006237 Ga0097621_100220410 Ga0097621_1002204102 178
45 3300006881 Ga0068865_100252418 Ga0068865_1002524182 178
46 3300006881 Ga0068865_100308985 Ga0068865_1003089851 178
47 3300006931 Ga0097620_100905741 Ga0097620_1009057412 178
48 3300009093 Ga0105240_10435386 Ga0105240_104353862 178
49 3300009094 Ga0111539_10059579 Ga0111539_100595794 178
50 3300009094 Ga0111539_11058820 Ga0111539_110588201 178
51 3300009101 Ga0105247_10668798 Ga0105247_106687981 178
52 3300009148 Ga0105243_10362199 Ga0105243_103621992 178
53 3300009176 Ga0105242_11305027 Ga0105242_113050271 178
54 3300009177 Ga0105248_10912162 Ga0105248_109121622 178
55 3300009551 Ga0105238_10041687 Ga0105238_100416872 178
56 3300009553 Ga0105249_10837821 Ga0105249_108378212 178
57 3300009553 Ga0105249_11060200 Ga0105249_110602002 178
58 3300011119 Ga0105246_10129909 Ga0105246_101299092 178
59 3300013296 Ga0157374_10246882 Ga0157374_102468822 178
60 3300013297 Ga0157378_10734562 Ga0157378_107345622 178
61 3300013306 Ga0163162_11329820 Ga0163162_113298201 178
62 3300013307 Ga0157372_10155889 Ga0157372_101558891 178
63 3300014325 Ga0163163_10370451 Ga0163163_103704512 178
64 3300014325 Ga0163163_10526905 Ga0163163_105269052 178
65 3300014325 Ga0163163_10894705 Ga0163163_108947051 178
66 3300014968 Ga0157379_10749493 Ga0157379_107494931 178
67 3300014969 Ga0157376_10066163 Ga0157376_100661633 178
68 3300017792 Ga0163161_10399403 Ga0163161_103994032 178
69 3300021441 Ga0213871_10085106 Ga0213871_100851062 178
70 3300025899 Ga0207642_10118712 Ga0207642_101187121 178
71 3300025907 Ga0207645_10731267 Ga0207645_107312671 178
72 3300025908 Ga0207643_10421450 Ga0207643_104214501 178
73 3300025911 Ga0207654_10267280 Ga0207654_102672802 178
74 3300025913 Ga0207695_10375637 Ga0207695_103756372 178
75 3300025914 Ga0207671_10194710 Ga0207671_101947102 178
76 3300025923 Ga0207681_10120646 Ga0207681_101206462 178
77 3300025923 Ga0207681_10189124 Ga0207681_101891242 178
78 3300025923 Ga0207681_10351961 Ga0207681_103519612 178
79 3300025925 Ga0207650_10079311 Ga0207650_100793112 178
80 3300025927 Ga0207687_10114799 Ga0207687_101147992 178
81 3300025931 Ga0207644_10990262 Ga0207644_109902622 178
82 3300025935 Ga0207709_10040791 Ga0207709_100407912 178
83 3300025937 Ga0207669_10002702 Ga0207669_100027023 178
84 3300025938 Ga0207704_10176536 Ga0207704_101765362 178
85 3300025938 Ga0207704_10220841 Ga0207704_102208412 178
86 3300025940 Ga0207691_10009871 Ga0207691_100098714 178
87 3300025941 Ga0207711_11226639 Ga0207711_112266392 178
88 3300025942 Ga0207689_10063391 Ga0207689_100633912 178
89 3300025945 Ga0207679_10494655 Ga0207679_104946551 178
90 3300025945 Ga0207679_11104432 Ga0207679_111044322 178
91 3300025972 Ga0207668_10121479 Ga0207668_101214792 178
92 3300026023 Ga0207677_10151266 Ga0207677_101512662 178
93 3300026035 Ga0207703_10262101 Ga0207703_102621012 178
94 3300026041 Ga0207639_10487384 Ga0207639_104873842 178
95 3300026075 Ga0207708_10519176 Ga0207708_105191762 178
96 3300026075 Ga0207708_10605412 Ga0207708_106054121 178
97 3300026088 Ga0207641_10196495 Ga0207641_101964952 178
98 3300026089 Ga0207648_10014812 Ga0207648_100148124 178
99 3300026095 Ga0207676_10210501 Ga0207676_102105012 178
100 3300026116 Ga0207674_10252939 Ga0207674_102529392 178
101 3300026118 Ga0207675_100166407 Ga0207675_1001664072 178
102 3300026118 Ga0207675_100644867 Ga0207675_1006448672 178
103 3300026121 Ga0207683_10012003 Ga0207683_100120033 178
104 3300027876 Ga0209974_10128884 Ga0209974_101288841 178
105 3300027907 Ga0207428_10015406 Ga0207428_100154067 178
106 3300028380 Ga0268265_10283091 Ga0268265_102830912 178
107 3300028381 Ga0268264_10228169 Ga0268264_102281692 178
108 3300028381 Ga0268264_10792822 Ga0268264_107928222 178
109 3300031239 Ga0265328_10220353 Ga0265328_102203531 178
110 3300031247 Ga0265340_10040064 Ga0265340_100400642 178
111 3300031249 Ga0265339_10078909 Ga0265339_100789092 178
112 3300031250 Ga0265331_10126313 Ga0265331_101263132 178
113 3300031711 Ga0265314_10250372 Ga0265314_102503722 178
114 3300039437 Ga0436365_1322681 Ga0436365_1322681_1492_2028 178
115 3300039437 Ga0436365_1355856 Ga0436365_1355856_79_615 178
116 3300041408 Ga0439453_0028742 Ga0439453_0028742_47_583 178
117 3300041410 Ga0439461_0017770 Ga0439461_0017770_589_1125 178
118 3300042461 Ga0439460_0021184 Ga0439460_0021184_789_1325 178
119 3300046474 Ga0495605_0086738 Ga0495605_0086738_27_563 178
120 3300046537 Ga0495598_0229923 Ga0495598_0229923_29_565 178
121 3300046615 Ga0495656_0092402 Ga0495656_0092402_314_850 178
122 3300047318 Ga0495636_0173857 Ga0495636_0173857_186_722 178
123 3300048090 Ga0495615_0012552 Ga0495615_0012552_363_899 178
124 3300048918 Ga0496115_0152893 Ga0496115_0152893_312_848 178
125 3300049588 Ga0501072_0001086 Ga0501072_0001086_5222_5758 178
126 3300049591 Ga0501075_0348763 Ga0501075_0348763_452_988 178
127 3300049593 Ga0501077_0274293 Ga0501077_0274293_325_861 178
128 3300049744 Ga0501083_0276413 Ga0501083_0276413_51_587 178
129 3300050489 nmdc:mga03683_118748_c1 nmdc:mga03683_118748_c1_167_703 178
130 3300050490 nmdc:mga03n38_70064_c1 nmdc:mga03n38_70064_c1_884_1420 178
131 3300050491 nmdc:mga00v17_249544_c1 nmdc:mga00v17_249544_c1_198_734 178
132 3300050493 nmdc:mga0k408_64906_c1 nmdc:mga0k408_64906_c1_1248_1784 178
133 3300050494 nmdc:mga06z11_77877_c1 nmdc:mga06z11_77877_c1_754_1290 178
134 3300050496 nmdc:mga07m45_51613_c1 nmdc:mga07m45_51613_c1_295_831 178
135 3300050510 nmdc:mga06r32_1027002_c1 nmdc:mga06r32_1027002_c1_72_608 178
136 3300050511 nmdc:mga08y16_18814_c1 nmdc:mga08y16_18814_c1_2423_2959 178
137 3300050511 nmdc:mga08y16_655755_c1 nmdc:mga08y16_655755_c1_18_554 178
138 3300060353 Ga0501082_0000306 Ga0501082_0000306_21489_22025 178
139 3300005336 Ga0070680_100178333 Ga0070680_1001783332 179
140 3300005458 Ga0070681_10662511 Ga0070681_106625112 179
141 3300005530 Ga0070679_100039626 Ga0070679_1000396265 179
142 3300005981 Ga0081538_10016815 Ga0081538_100168152 179
143 3300006163 Ga0070715_10528633 Ga0070715_105286331 179
144 3300006846 Ga0075430_100274628 Ga0075430_1002746282 179
145 3300006847 Ga0075431_100131175 Ga0075431_1001311752 179
146 3300006880 Ga0075429_100318773 Ga0075429_1003187732 179
147 3300006880 Ga0075429_100691432 Ga0075429_1006914321 179
148 3300009094 Ga0111539_11421005 Ga0111539_114210052 179
149 3300025921 Ga0207652_10154311 Ga0207652_101543112 179
150 3300025929 Ga0207664_10088284 Ga0207664_100882842 179
151 3300031595 Ga0265313_10271785 Ga0265313_102717851 179
152 3300035725 Ga0373947_0177570 Ga0373947_0177570_328_867 179
153 3300039438 Ga0436360_0214377 Ga0436360_0214377_789_1328 179
154 3300049578 Ga0501042_0063622 Ga0501042_0063622_176_769 179
155 3300049580 Ga0501046_0145571 Ga0501046_0145571_578_1117 179
156 3300049581 Ga0501047_0270101 Ga0501047_0270101_226_765 179
157 3300049588 Ga0501072_0376289 Ga0501072_0376289_482_1021 179
158 3300049589 Ga0501073_0448842 Ga0501073_0448842_331_870 179
159 3300049744 Ga0501083_0498574 Ga0501083_0498574_45_584 179
160 3300049822 Ga0501035_0404563 Ga0501035_0404563_346_885 179
161 3300049823 Ga0501044_0060454 Ga0501044_0060454_204_743 179
162 3300049823 Ga0501044_0204621 Ga0501044_0204621_349_888 179
163 3300050508 nmdc:mga09592_295280_c1 nmdc:mga09592_295280_c1_689_1228 179
164 3300050509 nmdc:mga0qj67_47612_c1 nmdc:mga0qj67_47612_c1_1664_2203 179
165 3300054114 Ga0501084_0099280 Ga0501084_0099280_1696_2289 179
166 3300003659 JGI25404J52841_10001140 JGI25404J52841_100011403 180
167 3300005343 Ga0070687_100476671 Ga0070687_1004766711 180
168 3300005355 Ga0070671_100265844 Ga0070671_1002658442 180
169 3300005434 Ga0070709_10181681 Ga0070709_101816812 180
170 3300005435 Ga0070714_100175942 Ga0070714_1001759421 180
171 3300005437 Ga0070710_10124116 Ga0070710_101241162 180
172 3300005458 Ga0070681_10085751 Ga0070681_100857512 180
173 3300005535 Ga0070684_100211452 Ga0070684_1002114522 180
174 3300005578 Ga0068854_100857457 Ga0068854_1008574572 180
175 3300005983 Ga0081540_1000241 Ga0081540_100024154 180
176 3300006038 Ga0075365_10540080 Ga0075365_105400801 180
177 3300006051 Ga0075364_10550682 Ga0075364_105506822 180
178 3300006175 Ga0070712_100100947 Ga0070712_1001009472 180
179 3300006186 Ga0075369_10020166 Ga0075369_100201662 180
180 3300006880 Ga0075429_101226315 Ga0075429_1012263151 180
181 3300009093 Ga0105240_10146384 Ga0105240_101463843 180
182 3300009147 Ga0114129_10085099 Ga0114129_100850995 180
183 3300009147 Ga0114129_10760278 Ga0114129_107602781 180
184 3300009551 Ga0105238_11274510 Ga0105238_112745101 180
185 3300013104 Ga0157370_10600571 Ga0157370_106005711 180
186 3300013105 Ga0157369_10870417 Ga0157369_108704172 180
187 3300013307 Ga0157372_10241314 Ga0157372_102413142 180
188 3300025911 Ga0207654_10221499 Ga0207654_102214992 180
189 3300025915 Ga0207693_10437638 Ga0207693_104376382 180
190 3300025915 Ga0207693_10559866 Ga0207693_105598661 180
191 3300025916 Ga0207663_10537526 Ga0207663_105375261 180
192 3300025917 Ga0207660_10242469 Ga0207660_102424692 180
193 3300025921 Ga0207652_10406955 Ga0207652_104069552 180
194 3300025931 Ga0207644_10445495 Ga0207644_104454952 180
195 3300025981 Ga0207640_10789482 Ga0207640_107894822 180
196 3300026041 Ga0207639_10805373 Ga0207639_108053731 180
197 3300026078 Ga0207702_10417300 Ga0207702_104173001 180
198 3300027424 Ga0209984_1002948 Ga0209984_10029484 180
199 3300027471 Ga0209995_1006953 Ga0209995_10069533 180
200 3300027526 Ga0209968_1007146 Ga0209968_10071463 180
201 3300027866 Ga0209813_10038072 Ga0209813_100380722 180
202 3300027876 Ga0209974_10071699 Ga0209974_100716992 180
203 3300031241 Ga0265325_10004069 Ga0265325_100040696 180
204 3300031595 Ga0265313_10120126 Ga0265313_101201261 180
205 3300031691 Ga0316579_10001369 Ga0316579_100013697 180
206 3300031691 Ga0316579_10147777 Ga0316579_101477771 180
207 3300031995 Ga0307409_101684933 Ga0307409_1016849331 180
208 3300035170 Ga0373943_0031117 Ga0373943_0031117_212_754 180
209 3300035171 Ga0373946_0017646 Ga0373946_0017646_431_973 180
210 3300035692 Ga0373935_0082943 Ga0373935_0082943_203_745 180
211 3300035695 Ga0373927_0052220 Ga0373927_0052220_255_797 180
212 3300035725 Ga0373947_0172418 Ga0373947_0172418_283_825 180
213 3300037068 Ga0373925_0083171 Ga0373925_0083171_237_779 180
214 3300037588 Ga0316581_0001549 Ga0316581_0001549_3187_3729 180
215 3300037853 Ga0436364_1550340 Ga0436364_1550340_83_625 180
216 3300045049 Ga0466959_0645188 Ga0466959_0645188_113_655 180
217 3300045976 Ga0466967_0344864 Ga0466967_0344864_336_878 180
218 3300046461 Ga0495641_0291724 Ga0495641_0291724_118_660 180
219 3300046472 Ga0495580_0176250 Ga0495580_0176250_893_1435 180
220 3300046533 Ga0495640_0559041 Ga0495640_0559041_80_622 180
221 3300046683 Ga0495658_0127282 Ga0495658_0127282_527_1069 180
222 3300046689 Ga0495613_0124923 Ga0495613_0124923_1043_1585 180
223 3300048089 Ga0495614_0050374 Ga0495614_0050374_649_1191 180
224 3300048903 Ga0496100_0014209 Ga0496100_0014209_612_1154 180
225 3300048904 Ga0496101_0002302 Ga0496101_0002302_8457_8999 180
226 3300048905 Ga0496102_0015422 Ga0496102_0015422_761_1303 180
227 3300048906 Ga0496103_0004970 Ga0496103_0004970_5003_5545 180
228 3300048907 Ga0496104_0001459 Ga0496104_0001459_82_624 180
229 3300048907 Ga0496104_0037372 Ga0496104_0037372_670_1212 180
230 3300048908 Ga0496105_0020603 Ga0496105_0020603_1976_2518 180
231 3300048909 Ga0496106_0025029 Ga0496106_0025029_3216_3758 180
232 3300048910 Ga0496107_0009730 Ga0496107_0009730_4199_4741 180
233 3300048911 Ga0496108_0004926 Ga0496108_0004926_2887_3429 180
234 3300048911 Ga0496108_0008116 Ga0496108_0008116_2806_3348 180
235 3300048912 Ga0496109_0005534 Ga0496109_0005534_2726_3268 180
236 3300048912 Ga0496109_0042653 Ga0496109_0042653_2871_3413 180
237 3300048913 Ga0496110_0008208 Ga0496110_0008208_5214_5756 180
238 3300048913 Ga0496110_0113550 Ga0496110_0113550_1212_1754 180
239 3300048914 Ga0496111_0000245 Ga0496111_0000245_17676_18218 180
240 3300048914 Ga0496111_0019852 Ga0496111_0019852_2719_3261 180
241 3300048915 Ga0496112_0010464 Ga0496112_0010464_5013_5555 180
242 3300048915 Ga0496112_0017506 Ga0496112_0017506_1750_2292 180
243 3300048915 Ga0496112_1003103 Ga0496112_1003103_17_571 180
244 3300048916 Ga0496113_0114303 Ga0496113_0114303_348_890 180
245 3300048918 Ga0496115_0039458 Ga0496115_0039458_1264_1806 180
246 3300048918 Ga0496115_0046599 Ga0496115_0046599_2709_3362 180
247 3300049569 Ga0501032_0236341 Ga0501032_0236341_605_1177 180
248 3300049574 Ga0501038_0411953 Ga0501038_0411953_76_618 180
249 3300049575 Ga0501039_0314259 Ga0501039_0314259_178_750 180
250 3300049587 Ga0501071_0145952 Ga0501071_0145952_51_605 180
251 3300049589 Ga0501073_0136678 Ga0501073_0136678_516_1058 180
252 3300049590 Ga0501074_0463878 Ga0501074_0463878_55_597 180
253 3300049592 Ga0501076_0245013 Ga0501076_0245013_412_954 180
254 3300049592 Ga0501076_0649432 Ga0501076_0649432_255_797 180
255 3300049593 Ga0501077_0022623 Ga0501077_0022623_392_934 180
256 3300049742 Ga0501080_0297331 Ga0501080_0297331_899_1441 180
257 3300049822 Ga0501035_0101560 Ga0501035_0101560_1871_2425 180
258 3300049824 Ga0501045_0258528 Ga0501045_0258528_17_559 180
259 3300050491 nmdc:mga00v17_707029_c1 nmdc:mga00v17_707029_c1_36_578 180
260 3300050492 nmdc:mga0yw44_345971_c1 nmdc:mga0yw44_345971_c1_352_894 180
261 3300050493 nmdc:mga0k408_112215_c1 nmdc:mga0k408_112215_c1_271_903 180
262 3300050494 nmdc:mga06z11_287034_c1 nmdc:mga06z11_287034_c1_159_701 180
263 3300050495 nmdc:mga04h51_175996_c1 nmdc:mga04h51_175996_c1_31_573 180
264 3300050507 nmdc:mga05p37_132231_c1 nmdc:mga05p37_132231_c1_2318_2860 180
265 3300050507 nmdc:mga05p37_72561_c1 nmdc:mga05p37_72561_c1_2800_3342 180
266 3300053120 Ga0500597_023022 Ga0500597_023022_1062_1604 180
267 3300053134 Ga0500658_0122217 Ga0500658_0122217_469_1011 180
268 3300053151 Ga0500604_0101088 Ga0500604_0101088_312_869 180
269 3300060353 Ga0501082_0116154 Ga0501082_0116154_529_1071 180
270 3300060353 Ga0501082_0259325 Ga0501082_0259325_923_1465 180

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fq0-assembly1.cif.gz_A the structure of kdgf from halomonas sp. 0.8732 54 152
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.8414 63 152
5hk2-assembly1.cif.gz_B human sigma-1 receptor bound to 4-ibp 0.8369 54 152
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8348 53 151
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8298 53 152
ID Description Score Start End Superfamily
af_P76241_5_112_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8875 64 152 2.60.120.10
af_Q9ZVZ4_163_347_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8713 54 152 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8441 50 152 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8249 53 152 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.822 66 150 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537LD82-F1-model_v4 Cysteine dioxygenase 0.9929 1 180
AF-A0A537LD82-F1-model_v4 Cysteine dioxygenase 0.9874 1 180
AF-A0A7X1P7F5-F1-model_v4 Cysteine dioxygenase 0.9859 1 171
AF-A0A3D2BTJ8-F1-model_v4 Cysteine dioxygenase 0.9848 1 176
AF-A0A1Z8NRZ4-F1-model_v4 Cysteine dioxygenase 0.9791 1 167

Feature Viewer

pLDDT pTM Quality
94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map