F377136

General Info

Members Datasets Scaffolds Average Seq Length
270 132 540 207

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0068981|Ga0466957_0068981_1367_2107
Length 246
Sequence MPAHAEDRLQLRRGRAAVEGESRAVSDERSFDEPLPWLAPVEDEDEPRGFSARRMLAVLVVVLLAGLIIAGTFFWLGQRGTSTGGAPVLIKAPPGPYKVKPPNPGGLDISSESETAFETSAGEDKNSQLDLNKLPEAPVAKPPKEQPKTVPSNETKTPVAPDSTPEPKASGGAGSVVQLGAFANQAQAERAWTALSTRFPSVAALNKMIIPFSGGIRLRAGAASPADAKQVCQTLKAAGENCFVAQ

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.78
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0068981 3300044842 Bacteria 2184
2 Ga0070658_10121241 3300005327 Bacteria 2173
3 Ga0070690_100217771 3300005330 Bacteria 1336
4 Ga0070666_10004583 3300005335 Bacteria 8430
5 Ga0070666_10473408 3300005335 Archaea 906
6 Ga0070680_100003821 3300005336 Bacteria 11264
7 Ga0070682_100007496 3300005337 Bacteria 6150
8 Ga0070660_100229780 3300005339 Unclassified 1509
9 Ga0070660_100418770 3300005339 Archaea 1109
10 Ga0070660_100437896 3300005339 Bacteria 1083
11 Ga0070660_100441880 3300005339 Bacteria 1078
12 Ga0070661_100008744 3300005344 Bacteria 7008
13 Ga0070661_100059238 3300005344 Bacteria 2807
14 Ga0070671_100016337 3300005355 Bacteria 6001
15 Ga0070671_100019656 3300005355 Bacteria 5500
16 Ga0070671_100030782 3300005355 Bacteria 4429
17 Ga0070671_100476390 3300005355 Unclassified 1072
18 Ga0070674_100158352 3300005356 Bacteria 1716
19 Ga0070673_100003642 3300005364 Bacteria 9644
20 Ga0070673_100021235 3300005364 Bacteria 4701
21 Ga0070673_100083431 3300005364 Bacteria 2596
22 Ga0070659_100006039 3300005366 Bacteria 8733
23 Ga0070659_100029808 3300005366 Bacteria 4218
24 Ga0070667_100011603 3300005367 Bacteria 7284
25 Ga0070667_100080314 3300005367 Bacteria 2789
26 Ga0070709_10111509 3300005434 Bacteria 1839
27 Ga0070714_100005271 3300005435 Bacteria 9849
28 Ga0070714_100494466 3300005435 Bacteria 1166
29 Ga0070713_100185834 3300005436 Bacteria 1870
30 Ga0070678_100033960 3300005456 Bacteria 3547
31 Ga0070662_100011263 3300005457 Bacteria 5895
32 Ga0070681_10229767 3300005458 Bacteria 1770
33 Ga0070681_10287594 3300005458 Unclassified 1554
34 Ga0070685_10172115 3300005466 Bacteria 1388
35 Ga0070684_100011807 3300005535 Bacteria 6970
36 Ga0070684_100179926 3300005535 Bacteria 1922
37 Ga0070672_100025456 3300005543 Bacteria 4388
38 Ga0070672_100295352 3300005543 Bacteria 1372
39 Ga0070672_100434350 3300005543 Bacteria 1129
40 Ga0070672_100609830 3300005543 Archaea 951
41 Ga0070686_100174960 3300005544 Bacteria 1521
42 Ga0070665_100029269 3300005548 Bacteria 5544
43 Ga0068855_100768016 3300005563 Unclassified 1026
44 Ga0070664_100049469 3300005564 Bacteria 3555
45 Ga0070664_100079960 3300005564 Unclassified 2815
46 Ga0070664_100136837 3300005564 Bacteria 2154
47 Ga0068857_100003247 3300005577 Bacteria 13508
48 Ga0068857_100015582 3300005577 Bacteria 6641
49 Ga0068857_100044034 3300005577 Bacteria 3958
50 Ga0068854_100028583 3300005578 Bacteria 3854
51 Ga0068854_100343506 3300005578 Unclassified 1219
52 Ga0068856_100007086 3300005614 Bacteria 10947
53 Ga0068856_100153441 3300005614 Bacteria 2313
54 Ga0068856_100392506 3300005614 Bacteria 1407
55 Ga0068852_100012084 3300005616 Bacteria 6538
56 Ga0068852_100176713 3300005616 Bacteria 2005
57 Ga0068852_100372060 3300005616 Archaea 1400
58 Ga0068859_100203131 3300005617 Bacteria 2066
59 Ga0068864_100006461 3300005618 Bacteria 9604
60 Ga0068864_100009496 3300005618 Bacteria 8027
61 Ga0068864_100040478 3300005618 Bacteria 3987
62 Ga0068851_10033100 3300005834 Bacteria 2575
63 Ga0068851_10194241 3300005834 Bacteria 1130
64 Ga0068863_100062444 3300005841 Bacteria 3523
65 Ga0068863_100119771 3300005841 Bacteria 2509
66 Ga0068858_100012971 3300005842 Bacteria 7857
67 Ga0068858_100170376 3300005842 Bacteria 2053
68 Ga0068858_100489874 3300005842 Archaea 1187
69 Ga0068860_100201763 3300005843 Bacteria 1927
70 Ga0068860_100315798 3300005843 Unclassified 1533
71 Ga0081539_10055043 3300005985 Bacteria 2216
72 Ga0070717_10081690 3300006028 Bacteria 2714
73 Ga0070712_100002819 3300006175 Bacteria 10753
74 Ga0070712_100321362 3300006175 Bacteria 1259
75 Ga0097621_100013203 3300006237 Bacteria 6145
76 Ga0097621_100017089 3300006237 Bacteria 5502
77 Ga0068871_100012951 3300006358 Bacteria 6175
78 Ga0097620_100203130 3300006931 Bacteria 2066
79 Ga0105240_10009032 3300009093 Bacteria 14154
80 Ga0105243_10287591 3300009148 Bacteria 1484
81 Ga0105248_10003496 3300009177 Bacteria 17436
82 Ga0105248_10009154 3300009177 Bacteria 10892
83 Ga0105248_10075088 3300009177 Bacteria 3799
84 Ga0105238_10671183 3300009551 Bacteria 1047
85 Ga0105239_11146374 3300010375 Bacteria 895
86 Ga0157373_10003512 3300013100 Bacteria 11855
87 Ga0157371_10049087 3300013102 Bacteria 2999
88 Ga0157370_10191786 3300013104 Bacteria 1897
89 Ga0157369_10041008 3300013105 Bacteria 5053
90 Ga0157369_10113653 3300013105 Bacteria 2876
91 Ga0157374_10010951 3300013296 Bacteria 7830
92 Ga0163162_10024186 3300013306 Bacteria 5995
93 Ga0163162_10265607 3300013306 Bacteria 1848
94 Ga0163162_10581676 3300013306 Archaea 1247
95 Ga0157372_10008748 3300013307 Bacteria 10749
96 Ga0157372_11207652 3300013307 Bacteria 874
97 Ga0157375_10059332 3300013308 Bacteria 3790
98 Ga0163163_10001314 3300014325 Bacteria 20974
99 Ga0157379_10144023 3300014968 Bacteria 2149
100 Ga0206356_11905490 3300020070 Unclassified 1580
101 Ga0206354_10258591 3300020081 Unclassified 1154
102 Ga0206353_11143556 3300020082 Unclassified 2059
103 Ga0207680_10112077 3300025903 Bacteria 1771
104 Ga0207680_10188917 3300025903 Unclassified 1397
105 Ga0207699_10039173 3300025906 Bacteria 2721
106 Ga0207705_10002589 3300025909 Bacteria 13894
107 Ga0207705_10022048 3300025909 Bacteria 4545
108 Ga0207705_10053090 3300025909 Bacteria 2919
109 Ga0207693_10070709 3300025915 Bacteria 2731
110 Ga0207657_10008302 3300025919 Bacteria 10563
111 Ga0207657_10020229 3300025919 Bacteria 6296
112 Ga0207657_10634198 3300025919 Archaea 832
113 Ga0207649_10002603 3300025920 Bacteria 10019
114 Ga0207694_10009944 3300025924 Bacteria 7177
115 Ga0207700_10201838 3300025928 Bacteria 1676
116 Ga0207700_10599385 3300025928 Bacteria 980
117 Ga0207664_10052275 3300025929 Bacteria 3231
118 Ga0207664_10245311 3300025929 Bacteria 1561
119 Ga0207644_10000903 3300025931 Bacteria 18799
120 Ga0207644_10002754 3300025931 Bacteria 11323
121 Ga0207644_10043574 3300025931 Bacteria 3185
122 Ga0207690_10004691 3300025932 Bacteria 8073
123 Ga0207706_10026962 3300025933 Bacteria 5140
124 Ga0207706_10084654 3300025933 Bacteria 2788
125 Ga0207691_10001650 3300025940 Bacteria 22107
126 Ga0207691_10035764 3300025940 Bacteria 4606
127 Ga0207691_10537907 3300025940 Archaea 991
128 Ga0207711_10000772 3300025941 Bacteria 31495
129 Ga0207711_10009248 3300025941 Bacteria 8228
130 Ga0207711_10121071 3300025941 Bacteria 2336
131 Ga0207661_10005249 3300025944 Bacteria 9112
132 Ga0207679_10010926 3300025945 Bacteria 5858
133 Ga0207679_10027384 3300025945 Bacteria 3941
134 Ga0207667_10002809 3300025949 Bacteria 21579
135 Ga0207651_10058100 3300025960 Bacteria 2672
136 Ga0207640_10016127 3300025981 Bacteria 4338
137 Ga0207640_10247845 3300025981 Bacteria 1381
138 Ga0207658_10011343 3300025986 Bacteria 6064
139 Ga0207658_10181232 3300025986 Bacteria 1743
140 Ga0207703_10135426 3300026035 Unclassified 2132
141 Ga0207703_10179776 3300026035 Bacteria 1866
142 Ga0207678_10071458 3300026067 Bacteria 2976
143 Ga0207702_10015140 3300026078 Bacteria 6395
144 Ga0207702_10106882 3300026078 Bacteria 2480
145 Ga0207702_10341463 3300026078 Bacteria 1431
146 Ga0207641_10026960 3300026088 Bacteria 4745
147 Ga0207641_10164016 3300026088 Bacteria 2022
148 Ga0207676_10026464 3300026095 Bacteria 4315
149 Ga0207676_10037427 3300026095 Bacteria 3697
150 Ga0207676_10283833 3300026095 Bacteria 1504
151 Ga0207674_10005334 3300026116 Bacteria 15292
152 Ga0207674_10005456 3300026116 Bacteria 15103
153 Ga0207683_10041416 3300026121 Bacteria 4022
154 Ga0207698_10304532 3300026142 Bacteria 1485
155 Ga0207698_10307168 3300026142 Bacteria 1479
156 Ga0268266_10018938 3300028379 Bacteria 5865
157 Ga0268264_10257674 3300028381 Unclassified 1623
158 Ga0307413_10048649 3300031824 Bacteria 2536
159 Ga0307410_10024791 3300031852 Bacteria 3753
160 Ga0307409_100904120 3300031995 Bacteria 897
161 Ga0307416_100076643 3300032002 Bacteria 2804
162 Ga0307411_10104400 3300032005 Bacteria 2012
163 Ga0307415_100183047 3300032126 Bacteria 1646
164 Ga0373946_0023734 3300035171 Bacteria 2398
165 Ga0373935_0013191 3300035692 Bacteria 4983
166 Ga0373925_0006512 3300037068 Bacteria 8587
167 Ga0395899_0005760 3300037312 Bacteria 9617
168 Ga0395899_0016419 3300037312 Bacteria 5643
169 Ga0395899_0017246 3300037312 Bacteria 5502
170 Ga0395899_0038428 3300037312 Bacteria 3585
171 Ga0395899_0093334 3300037312 Bacteria 2178
172 Ga0395899_0204731 3300037312 Bacteria 1374
173 Ga0395899_0328600 3300037312 Bacteria 1028
174 Ga0395900_0000405 3300037418 Bacteria 62091
175 Ga0395900_0008287 3300037418 Bacteria 10698
176 Ga0395900_0011820 3300037418 Bacteria 8927
177 Ga0395900_0025818 3300037418 Bacteria 6013
178 Ga0395900_0031705 3300037418 Bacteria 5432
179 Ga0395900_0063073 3300037418 Bacteria 3810
180 Ga0395900_0125932 3300037418 Bacteria 2627
181 Ga0395900_0142714 3300037418 Bacteria 2451
182 Ga0395900_0145123 3300037418 Bacteria 2427
183 Ga0395900_0167494 3300037418 Bacteria 2238
184 Ga0395900_0169230 3300037418 Bacteria 2225
185 Ga0395900_0205923 3300037418 Bacteria 1988
186 Ga0395898_0003398 3300037466 Bacteria 17834
187 Ga0395898_0010431 3300037466 Bacteria 9711
188 Ga0395898_0015591 3300037466 Bacteria 7791
189 Ga0395898_0023812 3300037466 Bacteria 6183
190 Ga0395898_0054683 3300037466 Bacteria 3895
191 Ga0395898_0086744 3300037466 Bacteria 3016
192 Ga0395898_0124518 3300037466 Bacteria 2469
193 Ga0395898_0140050 3300037466 Bacteria 2316
194 Ga0395898_0158395 3300037466 Bacteria 2165
195 Ga0395905_0001965 3300037471 Bacteria 23516
196 Ga0395905_0004004 3300037471 Bacteria 15481
197 Ga0395905_0004047 3300037471 Bacteria 15380
198 Ga0395905_0018156 3300037471 Bacteria 6675
199 Ga0395905_0033125 3300037471 Bacteria 4856
200 Ga0395905_0041535 3300037471 Bacteria 4315
201 Ga0395905_0044113 3300037471 Bacteria 4184
202 Ga0395905_0090505 3300037471 Bacteria 2868
203 Ga0395905_0188746 3300037471 Bacteria 1934
204 Ga0395905_0210769 3300037471 Bacteria 1820
205 Ga0395905_0235188 3300037471 Bacteria 1713
206 Ga0395905_0488787 3300037471 Unclassified 1130
207 Ga0395905_1028959 3300037471 Unclassified 727
208 Ga0395901_0010867 3300038443 Bacteria 9227
209 Ga0395901_0018140 3300038443 Bacteria 7181
210 Ga0395901_0024789 3300038443 Bacteria 6157
211 Ga0395901_0027469 3300038443 Bacteria 5848
212 Ga0395901_0027790 3300038443 Bacteria 5817
213 Ga0395901_0050841 3300038443 Bacteria 4306
214 Ga0395901_0057401 3300038443 Bacteria 4048
215 Ga0395901_0099358 3300038443 Bacteria 3051
216 Ga0395901_0111600 3300038443 Bacteria 2871
217 Ga0395901_0119312 3300038443 Bacteria 2771
218 Ga0395901_0131701 3300038443 Bacteria 2628
219 Ga0395901_0139074 3300038443 Bacteria 2552
220 Ga0395901_0336734 3300038443 Bacteria 1559
221 Ga0395901_0864501 3300038443 Bacteria 889
222 Ga0436363_0946088 3300039450 Bacteria 1362
223 Ga0466972_0087786 3300044658 Bacteria 1477
224 Ga0466966_0022013 3300044684 Bacteria 4185
225 Ga0466961_0423692 3300044693 Bacteria 807
226 Ga0466963_0202982 3300044694 Bacteria 1387
227 Ga0466963_0417459 3300044694 Unclassified 946
228 Ga0466968_0055030 3300044735 Bacteria 1707
229 Ga0466970_0059015 3300044765 Bacteria 2055
230 Ga0466957_0065572 3300044842 Bacteria 2237
231 Ga0466957_0164905 3300044842 Unclassified 1441
232 Ga0466957_0194488 3300044842 Bacteria 1330
233 Ga0466960_0023865 3300044901 Bacteria 2751
234 Ga0466960_0066016 3300044901 Bacteria 1788
235 Ga0466959_0254464 3300045049 Bacteria 1211
236 Ga0451576_0843266 3300045051 Bacteria 962
237 Ga0466958_0018689 3300045836 Bacteria 4026
238 Ga0466958_0058588 3300045836 Bacteria 2342
239 Ga0466958_0160293 3300045836 Bacteria 1421
240 Ga0466967_0024182 3300045976 Bacteria 4991
241 Ga0466967_0045203 3300045976 Bacteria 3825
242 Ga0466967_0164066 3300045976 Bacteria 2087
243 Ga0466967_0262311 3300045976 Bacteria 1653
244 Ga0466967_0887492 3300045976 Bacteria 886
245 Ga0495629_0281965 3300046459 Unclassified 1140
246 Ga0495669_0013276 3300046684 Bacteria 3508
247 Ga0495677_0001123 3300047445 Bacteria 10706
248 Ga0495677_0062687 3300047445 Bacteria 1380
249 Ga0496100_0078852 3300048903 Bacteria 2218
250 Ga0496101_0178588 3300048904 Unclassified 1634
251 Ga0496104_0069433 3300048907 Bacteria 3349
252 Ga0496105_0215742 3300048908 Bacteria 1563
253 Ga0496107_0026925 3300048910 Bacteria 4081
254 Ga0496107_0066468 3300048910 Bacteria 2614
255 Ga0496107_0328100 3300048910 Bacteria 1139
256 Ga0496108_0000634 3300048911 Bacteria 27402
257 Ga0496108_0005492 3300048911 Bacteria 10258
258 Ga0496108_0020364 3300048911 Bacteria 5452
259 Ga0496109_0009873 3300048912 Bacteria 8148
260 Ga0496109_0029661 3300048912 Bacteria 4900
261 Ga0496110_0015522 3300048913 Bacteria 6341
262 Ga0496110_0207591 3300048913 Unclassified 1780
263 Ga0496111_0013223 3300048914 Bacteria 5610
264 Ga0496112_0017222 3300048915 Bacteria 6784
265 Ga0496112_0020126 3300048915 Bacteria 6317
266 Ga0496113_0010551 3300048916 Bacteria 6112
267 Ga0496113_0079702 3300048916 Bacteria 2507
268 Ga0496113_0110337 3300048916 Bacteria 2140
269 Ga0496114_0417146 3300048917 Bacteria 1189
270 Ga0466962_0097940 3300061719 Bacteria 1407
271 Ga0466957_0068981
272 Ga0070658_10121241
273 Ga0070690_100217771
274 Ga0070666_10004583
275 Ga0070666_10473408
276 Ga0070680_100003821
277 Ga0070682_100007496
278 Ga0070660_100229780
279 Ga0070660_100418770
280 Ga0070660_100437896
281 Ga0070660_100441880
282 Ga0070661_100008744
283 Ga0070661_100059238
284 Ga0070671_100016337
285 Ga0070671_100019656
286 Ga0070671_100030782
287 Ga0070671_100476390
288 Ga0070674_100158352
289 Ga0070673_100003642
290 Ga0070673_100021235
291 Ga0070673_100083431
292 Ga0070659_100006039
293 Ga0070659_100029808
294 Ga0070667_100011603
295 Ga0070667_100080314
296 Ga0070709_10111509
297 Ga0070714_100005271
298 Ga0070714_100494466
299 Ga0070713_100185834
300 Ga0070678_100033960
301 Ga0070662_100011263
302 Ga0070681_10229767
303 Ga0070681_10287594
304 Ga0070685_10172115
305 Ga0070684_100011807
306 Ga0070684_100179926
307 Ga0070672_100025456
308 Ga0070672_100295352
309 Ga0070672_100434350
310 Ga0070672_100609830
311 Ga0070686_100174960
312 Ga0070665_100029269
313 Ga0068855_100768016
314 Ga0070664_100049469
315 Ga0070664_100079960
316 Ga0070664_100136837
317 Ga0068857_100003247
318 Ga0068857_100015582
319 Ga0068857_100044034
320 Ga0068854_100028583
321 Ga0068854_100343506
322 Ga0068856_100007086
323 Ga0068856_100153441
324 Ga0068856_100392506
325 Ga0068852_100012084
326 Ga0068852_100176713
327 Ga0068852_100372060
328 Ga0068859_100203131
329 Ga0068864_100006461
330 Ga0068864_100009496
331 Ga0068864_100040478
332 Ga0068851_10033100
333 Ga0068851_10194241
334 Ga0068863_100062444
335 Ga0068863_100119771
336 Ga0068858_100012971
337 Ga0068858_100170376
338 Ga0068858_100489874
339 Ga0068860_100201763
340 Ga0068860_100315798
341 Ga0081539_10055043
342 Ga0070717_10081690
343 Ga0070712_100002819
344 Ga0070712_100321362
345 Ga0097621_100013203
346 Ga0097621_100017089
347 Ga0068871_100012951
348 Ga0097620_100203130
349 Ga0105240_10009032
350 Ga0105243_10287591
351 Ga0105248_10003496
352 Ga0105248_10009154
353 Ga0105248_10075088
354 Ga0105238_10671183
355 Ga0105239_11146374
356 Ga0157373_10003512
357 Ga0157371_10049087
358 Ga0157370_10191786
359 Ga0157369_10041008
360 Ga0157369_10113653
361 Ga0157374_10010951
362 Ga0163162_10024186
363 Ga0163162_10265607
364 Ga0163162_10581676
365 Ga0157372_10008748
366 Ga0157372_11207652
367 Ga0157375_10059332
368 Ga0163163_10001314
369 Ga0157379_10144023
370 Ga0206356_11905490
371 Ga0206354_10258591
372 Ga0206353_11143556
373 Ga0207680_10112077
374 Ga0207680_10188917
375 Ga0207699_10039173
376 Ga0207705_10002589
377 Ga0207705_10022048
378 Ga0207705_10053090
379 Ga0207693_10070709
380 Ga0207657_10008302
381 Ga0207657_10020229
382 Ga0207657_10634198
383 Ga0207649_10002603
384 Ga0207694_10009944
385 Ga0207700_10201838
386 Ga0207700_10599385
387 Ga0207664_10052275
388 Ga0207664_10245311
389 Ga0207644_10000903
390 Ga0207644_10002754
391 Ga0207644_10043574
392 Ga0207690_10004691
393 Ga0207706_10026962
394 Ga0207706_10084654
395 Ga0207691_10001650
396 Ga0207691_10035764
397 Ga0207691_10537907
398 Ga0207711_10000772
399 Ga0207711_10009248
400 Ga0207711_10121071
401 Ga0207661_10005249
402 Ga0207679_10010926
403 Ga0207679_10027384
404 Ga0207667_10002809
405 Ga0207651_10058100
406 Ga0207640_10016127
407 Ga0207640_10247845
408 Ga0207658_10011343
409 Ga0207658_10181232
410 Ga0207703_10135426
411 Ga0207703_10179776
412 Ga0207678_10071458
413 Ga0207702_10015140
414 Ga0207702_10106882
415 Ga0207702_10341463
416 Ga0207641_10026960
417 Ga0207641_10164016
418 Ga0207676_10026464
419 Ga0207676_10037427
420 Ga0207676_10283833
421 Ga0207674_10005334
422 Ga0207674_10005456
423 Ga0207683_10041416
424 Ga0207698_10304532
425 Ga0207698_10307168
426 Ga0268266_10018938
427 Ga0268264_10257674
428 Ga0307413_10048649
429 Ga0307410_10024791
430 Ga0307409_100904120
431 Ga0307416_100076643
432 Ga0307411_10104400
433 Ga0307415_100183047
434 Ga0373946_0023734
435 Ga0373935_0013191
436 Ga0373925_0006512
437 Ga0395899_0005760
438 Ga0395899_0016419
439 Ga0395899_0017246
440 Ga0395899_0038428
441 Ga0395899_0093334
442 Ga0395899_0204731
443 Ga0395899_0328600
444 Ga0395900_0000405
445 Ga0395900_0008287
446 Ga0395900_0011820
447 Ga0395900_0025818
448 Ga0395900_0031705
449 Ga0395900_0063073
450 Ga0395900_0125932
451 Ga0395900_0142714
452 Ga0395900_0145123
453 Ga0395900_0167494
454 Ga0395900_0169230
455 Ga0395900_0205923
456 Ga0395898_0003398
457 Ga0395898_0010431
458 Ga0395898_0015591
459 Ga0395898_0023812
460 Ga0395898_0054683
461 Ga0395898_0086744
462 Ga0395898_0124518
463 Ga0395898_0140050
464 Ga0395898_0158395
465 Ga0395905_0001965
466 Ga0395905_0004004
467 Ga0395905_0004047
468 Ga0395905_0018156
469 Ga0395905_0033125
470 Ga0395905_0041535
471 Ga0395905_0044113
472 Ga0395905_0090505
473 Ga0395905_0188746
474 Ga0395905_0210769
475 Ga0395905_0235188
476 Ga0395905_0488787
477 Ga0395905_1028959
478 Ga0395901_0010867
479 Ga0395901_0018140
480 Ga0395901_0024789
481 Ga0395901_0027469
482 Ga0395901_0027790
483 Ga0395901_0050841
484 Ga0395901_0057401
485 Ga0395901_0099358
486 Ga0395901_0111600
487 Ga0395901_0119312
488 Ga0395901_0131701
489 Ga0395901_0139074
490 Ga0395901_0336734
491 Ga0395901_0864501
492 Ga0436363_0946088
493 Ga0466972_0087786
494 Ga0466966_0022013
495 Ga0466961_0423692
496 Ga0466963_0202982
497 Ga0466963_0417459
498 Ga0466968_0055030
499 Ga0466970_0059015
500 Ga0466957_0065572
501 Ga0466957_0164905
502 Ga0466957_0194488
503 Ga0466960_0023865
504 Ga0466960_0066016
505 Ga0466959_0254464
506 Ga0451576_0843266
507 Ga0466958_0018689
508 Ga0466958_0058588
509 Ga0466958_0160293
510 Ga0466967_0024182
511 Ga0466967_0045203
512 Ga0466967_0164066
513 Ga0466967_0262311
514 Ga0466967_0887492
515 Ga0495629_0281965
516 Ga0495669_0013276
517 Ga0495677_0001123
518 Ga0495677_0062687
519 Ga0496100_0078852
520 Ga0496101_0178588
521 Ga0496104_0069433
522 Ga0496105_0215742
523 Ga0496107_0026925
524 Ga0496107_0066468
525 Ga0496107_0328100
526 Ga0496108_0000634
527 Ga0496108_0005492
528 Ga0496108_0020364
529 Ga0496109_0009873
530 Ga0496109_0029661
531 Ga0496110_0015522
532 Ga0496110_0207591
533 Ga0496111_0013223
534 Ga0496112_0017222
535 Ga0496112_0020126
536 Ga0496113_0010551
537 Ga0496113_0079702
538 Ga0496113_0110337
539 Ga0496114_0417146
540 Ga0466962_0097940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05036

SPOR

SPOR domain

171

246

0.92

Map