F376979

General Info

Members Datasets Scaffolds Average Seq Length
270 133 540 303

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10119380|Ga0213875_101193801
Length 291
Sequence MAVTRFTSTRLRIRTRYLLLSLAMVPLFVSGQAAEQRAPLPPGQNPNGMHIYLWAGLKSHREGQHDYPQFLADWSKFLTQRGAVVDGALHGPRAADLEHTDVVVIYKGDAGYLSDAQKAALDEYVKRGGGLVSIHDSLCGPDPVYFASLVGGAKKHGEVNYTLDAPIHYTVVDKANPIMKDMSDITIPDDEAFFSMTWAKTGTLHVLATTEIPGTPSAGNHKGEVVPQIWTYEHTVPGGQPARAFVWMQGHIYANFSNDQIRKTLLRGIAWAGKRPVDELVNYVTPSPSPQ

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10119380 3300021388 Bacteria 1232
2 rootH2_10021994 3300003320 Bacteria 2560
3 rootH2_10083423 3300003320 Bacteria 5958
4 Ga0070658_10124176 3300005327 Bacteria 2147
5 Ga0070658_10235458 3300005327 Unclassified 1551
6 Ga0070683_100012471 3300005329 Bacteria 7386
7 Ga0070683_100026728 3300005329 Bacteria 5201
8 Ga0070683_100625893 3300005329 Unclassified 1030
9 Ga0070670_100002956 3300005331 Bacteria 14083
10 Ga0070680_100121333 3300005336 Bacteria 2182
11 Ga0068868_100036271 3300005338 Bacteria 3816
12 Ga0070660_100179088 3300005339 Bacteria 1715
13 Ga0070689_100158858 3300005340 Bacteria 1826
14 Ga0070661_100042796 3300005344 Bacteria 3307
15 Ga0070713_100011809 3300005436 Bacteria 6382
16 Ga0070713_100199375 3300005436 Bacteria 1807
17 Ga0070711_100002676 3300005439 Bacteria 10220
18 Ga0070711_100116501 3300005439 Bacteria 1969
19 Ga0070663_100298697 3300005455 Bacteria 1288
20 Ga0070662_100023796 3300005457 Unclassified 4212
21 Ga0070681_10000496 3300005458 Bacteria 32107
22 Ga0070681_10020105 3300005458 Bacteria 6691
23 Ga0070681_10020695 3300005458 Bacteria 6591
24 Ga0068867_100021504 3300005459 Unclassified 4603
25 Ga0068867_100278744 3300005459 Bacteria 1370
26 Ga0070706_100018133 3300005467 Bacteria 6493
27 Ga0070698_100111066 3300005471 Bacteria 2706
28 Ga0070679_100006647 3300005530 Bacteria 10783
29 Ga0070679_100037898 3300005530 Unclassified 4791
30 Ga0070679_100051960 3300005530 Unclassified 4083
31 Ga0070679_100072455 3300005530 Unclassified 3437
32 Ga0070684_100003791 3300005535 Bacteria 11417
33 Ga0070684_100017373 3300005535 Bacteria 5903
34 Ga0070684_100068832 3300005535 Bacteria 3112
35 Ga0070684_100172230 3300005535 Bacteria 1966
36 Ga0068853_100048226 3300005539 Bacteria 3658
37 Ga0068853_100050745 3300005539 Bacteria 3570
38 Ga0068853_100177555 3300005539 Bacteria 1930
39 Ga0070693_100007012 3300005547 Bacteria 5487
40 Ga0070693_100013670 3300005547 Bacteria 4141
41 Ga0070665_100024304 3300005548 Bacteria 6100
42 Ga0070665_100027454 3300005548 Bacteria 5734
43 Ga0070665_100059406 3300005548 Bacteria 3833
44 Ga0070665_100190936 3300005548 Unclassified 2049
45 Ga0068855_100001685 3300005563 Bacteria 27674
46 Ga0068855_100001812 3300005563 Bacteria 26661
47 Ga0068855_100013065 3300005563 Bacteria 10016
48 Ga0068855_100015324 3300005563 Bacteria 9231
49 Ga0068855_100022813 3300005563 Bacteria 7500
50 Ga0068855_100064698 3300005563 Bacteria 4265
51 Ga0068855_100254589 3300005563 Bacteria 1957
52 Ga0070664_100003374 3300005564 Bacteria 12903
53 Ga0068857_100000136 3300005577 Bacteria 44769
54 Ga0068857_100257439 3300005577 Bacteria 1601
55 Ga0068854_100013790 3300005578 Bacteria 5314
56 Ga0068854_100076668 3300005578 Bacteria 2458
57 Ga0068856_100002233 3300005614 Bacteria 20000
58 Ga0068856_100002345 3300005614 Bacteria 19474
59 Ga0068856_100036213 3300005614 Unclassified 4838
60 Ga0068852_100000124 3300005616 Bacteria 51999
61 Ga0068852_100028339 3300005616 Bacteria 4582
62 Ga0068852_100096992 3300005616 Bacteria 2651
63 Ga0068852_100201564 3300005616 Bacteria 1883
64 Ga0068859_100003481 3300005617 Bacteria 16023
65 Ga0068859_100124774 3300005617 Bacteria 2643
66 Ga0068864_100001130 3300005618 Bacteria 22316
67 Ga0068864_100205759 3300005618 Bacteria 1810
68 Ga0068866_10037915 3300005718 Bacteria 2370
69 Ga0068861_100102695 3300005719 Bacteria 2277
70 Ga0068863_100046779 3300005841 Bacteria 4107
71 Ga0068858_100012239 3300005842 Bacteria 8089
72 Ga0068858_100055965 3300005842 Bacteria 3646
73 Ga0068860_100134707 3300005843 Bacteria 2372
74 Ga0068860_100300952 3300005843 Bacteria 1571
75 Ga0068860_100465469 3300005843 Bacteria 1258
76 Ga0081455_10086561 3300005937 Bacteria 2552
77 Ga0081539_10034204 3300005985 Bacteria 3078
78 Ga0070717_10119970 3300006028 Unclassified 2252
79 Ga0070717_10442152 3300006028 Bacteria 1171
80 Ga0070715_10001900 3300006163 Bacteria 6271
81 Ga0070712_100000139 3300006175 Bacteria 37733
82 Ga0097621_100007910 3300006237 Bacteria 7625
83 Ga0097621_100013352 3300006237 Bacteria 6120
84 Ga0097621_100093944 3300006237 Bacteria 2514
85 Ga0097621_100136295 3300006237 Bacteria 2094
86 Ga0097621_100384573 3300006237 Bacteria 1254
87 Ga0097621_100499779 3300006237 Bacteria 1101
88 Ga0068871_100001676 3300006358 Bacteria 14888
89 Ga0068865_100054105 3300006881 Bacteria 2787
90 Ga0097620_100003481 3300006931 Bacteria 16023
91 Ga0097620_100124773 3300006931 Bacteria 2643
92 Ga0105240_10002589 3300009093 Bacteria 28966
93 Ga0105240_10003814 3300009093 Bacteria 23293
94 Ga0105240_10011651 3300009093 Bacteria 12224
95 Ga0105240_10088816 3300009093 Bacteria 3781
96 Ga0114129_10002773 3300009147 Bacteria 24404
97 Ga0105241_10446300 3300009174 Unclassified 1143
98 Ga0105248_10017290 3300009177 Bacteria 7946
99 Ga0105237_10087635 3300009545 Bacteria 3102
100 Ga0105237_10122443 3300009545 Bacteria 2595
101 Ga0105237_10142904 3300009545 Bacteria 2387
102 Ga0105237_10148396 3300009545 Bacteria 2340
103 Ga0105237_10172939 3300009545 Bacteria 2160
104 Ga0105237_10447215 3300009545 Bacteria 1298
105 Ga0105238_10000720 3300009551 Bacteria 34494
106 Ga0105238_10003041 3300009551 Bacteria 16730
107 Ga0105238_10008117 3300009551 Bacteria 10497
108 Ga0105238_10124102 3300009551 Bacteria 2562
109 Ga0105238_10162715 3300009551 Bacteria 2207
110 Ga0105238_10280119 3300009551 Bacteria 1649
111 Ga0105239_10039092 3300010375 Bacteria 5198
112 Ga0105239_10146262 3300010375 Bacteria 2636
113 Ga0157373_10016554 3300013100 Bacteria 5376
114 Ga0157373_10048050 3300013100 Bacteria 3043
115 Ga0157371_10047843 3300013102 Bacteria 3040
116 Ga0157371_10048506 3300013102 Unclassified 3018
117 Ga0157370_10002425 3300013104 Bacteria 22483
118 Ga0157370_10007561 3300013104 Bacteria 11804
119 Ga0157370_10113674 3300013104 Unclassified 2530
120 Ga0157369_10000134 3300013105 Bacteria 105562
121 Ga0157369_10005720 3300013105 Bacteria 14444
122 Ga0157369_10010818 3300013105 Bacteria 10391
123 Ga0157369_10011904 3300013105 Bacteria 9880
124 Ga0157369_10012228 3300013105 Bacteria 9746
125 Ga0157369_10034177 3300013105 Bacteria 5582
126 Ga0157369_10082792 3300013105 Bacteria 3433
127 Ga0157369_10093929 3300013105 Unclassified 3202
128 Ga0157369_10412375 3300013105 Unclassified 1401
129 Ga0157374_10001033 3300013296 Bacteria 24127
130 Ga0157374_10044974 3300013296 Bacteria 4084
131 Ga0157374_10299714 3300013296 Bacteria 1590
132 Ga0157378_10000641 3300013297 Bacteria 32867
133 Ga0157378_10011621 3300013297 Bacteria 7708
134 Ga0163162_10095101 3300013306 Bacteria 3066
135 Ga0157372_10000865 3300013307 Bacteria 32847
136 Ga0157372_10001235 3300013307 Bacteria 27682
137 Ga0157372_10001994 3300013307 Bacteria 22174
138 Ga0157372_10049537 3300013307 Unclassified 4671
139 Ga0157372_10060881 3300013307 Bacteria 4224
140 Ga0157372_10085512 3300013307 Bacteria 3577
141 Ga0157372_10097264 3300013307 Bacteria 3357
142 Ga0157372_10216070 3300013307 Bacteria 2222
143 Ga0157372_10303842 3300013307 Bacteria 1856
144 Ga0157376_10010623 3300014969 Bacteria 6743
145 Ga0157376_10044662 3300014969 Bacteria 3643
146 Ga0213872_10004069 3300021361 Bacteria 7873
147 Ga0213875_10125393 3300021388 Bacteria 1200
148 Ga0207685_10013863 3300025905 Unclassified 2506
149 Ga0207699_10099725 3300025906 Bacteria 1841
150 Ga0207699_10105916 3300025906 Bacteria 1794
151 Ga0207645_10088470 3300025907 Bacteria 1991
152 Ga0207684_10040417 3300025910 Bacteria 3954
153 Ga0207654_10011333 3300025911 Bacteria 4549
154 Ga0207707_10000664 3300025912 Bacteria 34148
155 Ga0207707_10093062 3300025912 Bacteria 2633
156 Ga0207695_10000105 3300025913 Bacteria 254764
157 Ga0207695_10047795 3300025913 Bacteria 4524
158 Ga0207695_10072831 3300025913 Bacteria 3503
159 Ga0207695_10101190 3300025913 Bacteria 2876
160 Ga0207671_10104594 3300025914 Bacteria 2147
161 Ga0207671_10140316 3300025914 Bacteria 1861
162 Ga0207671_10189279 3300025914 Bacteria 1604
163 Ga0207693_10002891 3300025915 Bacteria 14857
164 Ga0207663_10002620 3300025916 Bacteria 8658
165 Ga0207660_10010507 3300025917 Bacteria 6013
166 Ga0207660_10091624 3300025917 Bacteria 2255
167 Ga0207649_10050701 3300025920 Bacteria 2568
168 Ga0207652_10004953 3300025921 Bacteria 10785
169 Ga0207652_10101701 3300025921 Bacteria 2539
170 Ga0207694_10027314 3300025924 Bacteria 4346
171 Ga0207694_10039519 3300025924 Bacteria 3631
172 Ga0207700_10012065 3300025928 Bacteria 5551
173 Ga0207700_10023757 3300025928 Bacteria 4234
174 Ga0207700_10473442 3300025928 Unclassified 1106
175 Ga0207706_10043227 3300025933 Bacteria 3994
176 Ga0207706_10155491 3300025933 Bacteria 2011
177 Ga0207704_10018458 3300025938 Bacteria 3641
178 Ga0207711_10023135 3300025941 Bacteria 5202
179 Ga0207711_10082568 3300025941 Bacteria 2809
180 Ga0207689_10018358 3300025942 Bacteria 5902
181 Ga0207661_10018089 3300025944 Bacteria 5232
182 Ga0207661_10046982 3300025944 Bacteria 3425
183 Ga0207661_10070675 3300025944 Bacteria 2850
184 Ga0207661_10081523 3300025944 Unclassified 2673
185 Ga0207661_10444768 3300025944 Bacteria 1180
186 Ga0207661_10499781 3300025944 Unclassified 1111
187 Ga0207679_10086877 3300025945 Bacteria 2407
188 Ga0207667_10000245 3300025949 Bacteria 76423
189 Ga0207667_10005250 3300025949 Bacteria 15806
190 Ga0207667_10007320 3300025949 Bacteria 13285
191 Ga0207667_10013317 3300025949 Bacteria 9420
192 Ga0207667_10075111 3300025949 Bacteria 3510
193 Ga0207667_10078273 3300025949 Bacteria 3427
194 Ga0207667_10151402 3300025949 Unclassified 2387
195 Ga0207667_10158077 3300025949 Bacteria 2332
196 Ga0207667_10503874 3300025949 Bacteria 1228
197 Ga0207712_10014457 3300025961 Bacteria 5079
198 Ga0207640_10007983 3300025981 Bacteria 5846
199 Ga0207640_10168017 3300025981 Bacteria 1631
200 Ga0207677_10038918 3300026023 Unclassified 3122
201 Ga0207677_10164958 3300026023 Bacteria 1726
202 Ga0207677_10166456 3300026023 Bacteria 1719
203 Ga0207703_10009812 3300026035 Bacteria 7510
204 Ga0207703_10020963 3300026035 Bacteria 5114
205 Ga0207639_10024687 3300026041 Bacteria 4354
206 Ga0207639_10035413 3300026041 Bacteria 3694
207 Ga0207639_10225042 3300026041 Bacteria 1623
208 Ga0207678_10222741 3300026067 Unclassified 1615
209 Ga0207702_10000454 3300026078 Bacteria 46222
210 Ga0207702_10003743 3300026078 Bacteria 13744
211 Ga0207702_10006715 3300026078 Bacteria 9888
212 Ga0207702_10008081 3300026078 Bacteria 8900
213 Ga0207702_10178585 3300026078 Bacteria 1953
214 Ga0207641_10064925 3300026088 Bacteria 3121
215 Ga0207676_10034838 3300026095 Bacteria 3814
216 Ga0207674_10000126 3300026116 Bacteria 88965
217 Ga0207674_10000449 3300026116 Bacteria 53656
218 Ga0207674_10011567 3300026116 Bacteria 9911
219 Ga0207674_10247682 3300026116 Bacteria 1729
220 Ga0207675_100142128 3300026118 Bacteria 2280
221 Ga0207683_10229011 3300026121 Bacteria 1694
222 Ga0207683_10344858 3300026121 Bacteria 1366
223 Ga0207698_10000103 3300026142 Bacteria 53811
224 Ga0207698_10039863 3300026142 Bacteria 3483
225 Ga0207698_10060056 3300026142 Bacteria 2955
226 Ga0268266_10000271 3300028379 Bacteria 85685
227 Ga0268266_10000683 3300028379 Bacteria 45837
228 Ga0268266_10001284 3300028379 Bacteria 30597
229 Ga0268266_10106992 3300028379 Bacteria 2473
230 Ga0268265_10227828 3300028380 Bacteria 1636
231 Ga0268264_10060761 3300028381 Bacteria 3168
232 Ga0265338_10051077 3300028800 Bacteria 3728
233 Ga0265324_10018710 3300029957 Bacteria 2501
234 Ga0265328_10011007 3300031239 Bacteria 3626
235 Ga0265339_10001367 3300031249 Bacteria 18224
236 Ga0265316_10001734 3300031344 Bacteria 23126
237 Ga0265316_10043396 3300031344 Bacteria 3584
238 Ga0265314_10025356 3300031711 Bacteria 4473
239 Ga0373931_0044780 3300035691 Bacteria 2335
240 Ga0373937_0312158 3300036401 Unclassified 1487
241 Ga0395898_0632856 3300037466 Unclassified 1012
242 Ga0436364_0474253 3300037853 Bacteria 4907
243 Ga0436364_1264654 3300037853 Unclassified 1090
244 Ga0436365_1060315 3300039437 Unclassified 1511
245 Ga0436365_1430022 3300039437 Unclassified 4480
246 Ga0436361_0352553 3300039447 Bacteria 3271
247 Ga0436361_0694849 3300039447 Bacteria 18264
248 Ga0436361_0717017 3300039447 Bacteria 1269
249 Ga0466963_0012389 3300044694 Bacteria 5219
250 Ga0466957_0197791 3300044842 Bacteria 1319
251 Ga0466967_0272922 3300045976 Unclassified 1621
252 Ga0495582_0089031 3300046473 Bacteria 1720
253 Ga0495628_0443158 3300046516 Unclassified 944
254 Ga0495630_0149560 3300046517 Bacteria 1776
255 Ga0495652_0022077 3300046529 Bacteria 5652
256 Ga0495587_0076252 3300046536 Bacteria 1947
257 Ga0495645_0013299 3300046543 Bacteria 5817
258 Ga0495667_0014903 3300046559 Bacteria 5253
259 Ga0495646_0081378 3300046680 Bacteria 1887
260 Ga0495604_0278807 3300047317 Unclassified 1130
261 Ga0495674_0199955 3300047319 Unclassified 1658
262 Ga0495684_0274049 3300047471 Bacteria 1220
263 Ga0495602_0203988 3300048088 Bacteria 1506
264 Ga0496104_0221132 3300048907 Bacteria 1806
265 Ga0496112_0000712 3300048915 Bacteria 23067
266 Ga0496112_0032464 3300048915 Bacteria 5070
267 Ga0496115_0011774 3300048918 Bacteria 6569
268 nmdc:mga05p37_1510_c1 3300050507 Bacteria 27041
269 Ga0501082_0004971 3300060353 Bacteria 11606
270 Ga0466962_0030856 3300061719 Bacteria 2566
271 Ga0213875_10119380
272 rootH2_10021994
273 rootH2_10083423
274 Ga0070658_10124176
275 Ga0070658_10235458
276 Ga0070683_100012471
277 Ga0070683_100026728
278 Ga0070683_100625893
279 Ga0070670_100002956
280 Ga0070680_100121333
281 Ga0068868_100036271
282 Ga0070660_100179088
283 Ga0070689_100158858
284 Ga0070661_100042796
285 Ga0070713_100011809
286 Ga0070713_100199375
287 Ga0070711_100002676
288 Ga0070711_100116501
289 Ga0070663_100298697
290 Ga0070662_100023796
291 Ga0070681_10000496
292 Ga0070681_10020105
293 Ga0070681_10020695
294 Ga0068867_100021504
295 Ga0068867_100278744
296 Ga0070706_100018133
297 Ga0070698_100111066
298 Ga0070679_100006647
299 Ga0070679_100037898
300 Ga0070679_100051960
301 Ga0070679_100072455
302 Ga0070684_100003791
303 Ga0070684_100017373
304 Ga0070684_100068832
305 Ga0070684_100172230
306 Ga0068853_100048226
307 Ga0068853_100050745
308 Ga0068853_100177555
309 Ga0070693_100007012
310 Ga0070693_100013670
311 Ga0070665_100024304
312 Ga0070665_100027454
313 Ga0070665_100059406
314 Ga0070665_100190936
315 Ga0068855_100001685
316 Ga0068855_100001812
317 Ga0068855_100013065
318 Ga0068855_100015324
319 Ga0068855_100022813
320 Ga0068855_100064698
321 Ga0068855_100254589
322 Ga0070664_100003374
323 Ga0068857_100000136
324 Ga0068857_100257439
325 Ga0068854_100013790
326 Ga0068854_100076668
327 Ga0068856_100002233
328 Ga0068856_100002345
329 Ga0068856_100036213
330 Ga0068852_100000124
331 Ga0068852_100028339
332 Ga0068852_100096992
333 Ga0068852_100201564
334 Ga0068859_100003481
335 Ga0068859_100124774
336 Ga0068864_100001130
337 Ga0068864_100205759
338 Ga0068866_10037915
339 Ga0068861_100102695
340 Ga0068863_100046779
341 Ga0068858_100012239
342 Ga0068858_100055965
343 Ga0068860_100134707
344 Ga0068860_100300952
345 Ga0068860_100465469
346 Ga0081455_10086561
347 Ga0081539_10034204
348 Ga0070717_10119970
349 Ga0070717_10442152
350 Ga0070715_10001900
351 Ga0070712_100000139
352 Ga0097621_100007910
353 Ga0097621_100013352
354 Ga0097621_100093944
355 Ga0097621_100136295
356 Ga0097621_100384573
357 Ga0097621_100499779
358 Ga0068871_100001676
359 Ga0068865_100054105
360 Ga0097620_100003481
361 Ga0097620_100124773
362 Ga0105240_10002589
363 Ga0105240_10003814
364 Ga0105240_10011651
365 Ga0105240_10088816
366 Ga0114129_10002773
367 Ga0105241_10446300
368 Ga0105248_10017290
369 Ga0105237_10087635
370 Ga0105237_10122443
371 Ga0105237_10142904
372 Ga0105237_10148396
373 Ga0105237_10172939
374 Ga0105237_10447215
375 Ga0105238_10000720
376 Ga0105238_10003041
377 Ga0105238_10008117
378 Ga0105238_10124102
379 Ga0105238_10162715
380 Ga0105238_10280119
381 Ga0105239_10039092
382 Ga0105239_10146262
383 Ga0157373_10016554
384 Ga0157373_10048050
385 Ga0157371_10047843
386 Ga0157371_10048506
387 Ga0157370_10002425
388 Ga0157370_10007561
389 Ga0157370_10113674
390 Ga0157369_10000134
391 Ga0157369_10005720
392 Ga0157369_10010818
393 Ga0157369_10011904
394 Ga0157369_10012228
395 Ga0157369_10034177
396 Ga0157369_10082792
397 Ga0157369_10093929
398 Ga0157369_10412375
399 Ga0157374_10001033
400 Ga0157374_10044974
401 Ga0157374_10299714
402 Ga0157378_10000641
403 Ga0157378_10011621
404 Ga0163162_10095101
405 Ga0157372_10000865
406 Ga0157372_10001235
407 Ga0157372_10001994
408 Ga0157372_10049537
409 Ga0157372_10060881
410 Ga0157372_10085512
411 Ga0157372_10097264
412 Ga0157372_10216070
413 Ga0157372_10303842
414 Ga0157376_10010623
415 Ga0157376_10044662
416 Ga0213872_10004069
417 Ga0213875_10125393
418 Ga0207685_10013863
419 Ga0207699_10099725
420 Ga0207699_10105916
421 Ga0207645_10088470
422 Ga0207684_10040417
423 Ga0207654_10011333
424 Ga0207707_10000664
425 Ga0207707_10093062
426 Ga0207695_10000105
427 Ga0207695_10047795
428 Ga0207695_10072831
429 Ga0207695_10101190
430 Ga0207671_10104594
431 Ga0207671_10140316
432 Ga0207671_10189279
433 Ga0207693_10002891
434 Ga0207663_10002620
435 Ga0207660_10010507
436 Ga0207660_10091624
437 Ga0207649_10050701
438 Ga0207652_10004953
439 Ga0207652_10101701
440 Ga0207694_10027314
441 Ga0207694_10039519
442 Ga0207700_10012065
443 Ga0207700_10023757
444 Ga0207700_10473442
445 Ga0207706_10043227
446 Ga0207706_10155491
447 Ga0207704_10018458
448 Ga0207711_10023135
449 Ga0207711_10082568
450 Ga0207689_10018358
451 Ga0207661_10018089
452 Ga0207661_10046982
453 Ga0207661_10070675
454 Ga0207661_10081523
455 Ga0207661_10444768
456 Ga0207661_10499781
457 Ga0207679_10086877
458 Ga0207667_10000245
459 Ga0207667_10005250
460 Ga0207667_10007320
461 Ga0207667_10013317
462 Ga0207667_10075111
463 Ga0207667_10078273
464 Ga0207667_10151402
465 Ga0207667_10158077
466 Ga0207667_10503874
467 Ga0207712_10014457
468 Ga0207640_10007983
469 Ga0207640_10168017
470 Ga0207677_10038918
471 Ga0207677_10164958
472 Ga0207677_10166456
473 Ga0207703_10009812
474 Ga0207703_10020963
475 Ga0207639_10024687
476 Ga0207639_10035413
477 Ga0207639_10225042
478 Ga0207678_10222741
479 Ga0207702_10000454
480 Ga0207702_10003743
481 Ga0207702_10006715
482 Ga0207702_10008081
483 Ga0207702_10178585
484 Ga0207641_10064925
485 Ga0207676_10034838
486 Ga0207674_10000126
487 Ga0207674_10000449
488 Ga0207674_10011567
489 Ga0207674_10247682
490 Ga0207675_100142128
491 Ga0207683_10229011
492 Ga0207683_10344858
493 Ga0207698_10000103
494 Ga0207698_10039863
495 Ga0207698_10060056
496 Ga0268266_10000271
497 Ga0268266_10000683
498 Ga0268266_10001284
499 Ga0268266_10106992
500 Ga0268265_10227828
501 Ga0268264_10060761
502 Ga0265338_10051077
503 Ga0265324_10018710
504 Ga0265328_10011007
505 Ga0265339_10001367
506 Ga0265316_10001734
507 Ga0265316_10043396
508 Ga0265314_10025356
509 Ga0373931_0044780
510 Ga0373937_0312158
511 Ga0395898_0632856
512 Ga0436364_0474253
513 Ga0436364_1264654
514 Ga0436365_1060315
515 Ga0436365_1430022
516 Ga0436361_0352553
517 Ga0436361_0694849
518 Ga0436361_0717017
519 Ga0466963_0012389
520 Ga0466957_0197791
521 Ga0466967_0272922
522 Ga0495582_0089031
523 Ga0495628_0443158
524 Ga0495630_0149560
525 Ga0495652_0022077
526 Ga0495587_0076252
527 Ga0495645_0013299
528 Ga0495667_0014903
529 Ga0495646_0081378
530 Ga0495604_0278807
531 Ga0495674_0199955
532 Ga0495684_0274049
533 Ga0495602_0203988
534 Ga0496104_0221132
535 Ga0496112_0000712
536 Ga0496112_0032464
537 Ga0496115_0011774
538 nmdc:mga05p37_1510_c1
539 Ga0501082_0004971
540 Ga0466962_0030856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

59

272

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v8j-assembly1.cif.gz_B toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with the reaction intermediates proline-adenylate (pro-amp) and pyrophosphate 0.6991 41 83
4twa-assembly1.cif.gz_B crystal structure of prolyl-trna synthetase (prs) from plasmodium falciparum 0.6976 42 81
3lzd-assembly1.cif.gz_B crystal structure of dph2 from pyrococcus horikoshii with 4fe-4s cluster 0.6836 42 98
3huf-assembly2.cif.gz_B structure of the s. pombe nbs1-ctp1 complex 0.6734 41 126
1wu7-assembly1.cif.gz_B crystal structure of histidyl-trna synthetase from thermoplasma acidophilum 0.6603 41 100
ID Description Score Start End Superfamily
af_Q4E2Q4_393_499_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.6919 43 97 3.40.50.11860
af_B0G132_348_449_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.6855 40 98 3.40.50.11860
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6715 41 265 3.40.50.880
4yj6A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.6521 41 81 3.90.1300.10
af_A0A1D6HSW9_336_459_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6496 39 83 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A3N5L4P5-F1-model_v4 ThuA domain-containing protein 0.9681 47 286
AF-A0A372IJR2-F1-model_v4 ThuA domain-containing protein 0.9535 26 286
AF-A0A7C5ETX1-F1-model_v4 ThuA-like domain-containing protein 0.9383 24 286 GO:0016020
AF-A0A3N5L4P5-F1-model_v4 ThuA domain-containing protein 0.9372 47 286
AF-A0A7V9S9L1-F1-model_v4 ThuA domain-containing protein 0.931 20 282

Map