F376861

General Info

Members Datasets Scaffolds Average Seq Length
270 171 270 167

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100186914|Ga0075428_1001869142
Length 182
Sequence VAMRRTLFASFAGVEVEDAIRTRRTHKVYGSEPVPRGTLDELFELARWAPNHNLTNPWRFRVVGPDALARLKEAAGEEAAAKLDRAPTLVVVSVAETGDPVQDEEDHAAASVAAYIVLLAAHGRGLAGYWRTPAVLRSAEGRAAVGVPDRERVIGLLHLGPRRQEKEPPERLAPGDFVTYLP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 12.96
Rhizosphere 82.96
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10070638 3300005327 Bacteria 2859
2 Ga0070683_100935288 3300005329 Bacteria 832
3 Ga0070682_100525832 3300005337 Bacteria 921
4 Ga0068868_100156296 3300005338 Bacteria 1881
5 Ga0070660_100045443 3300005339 Bacteria 3362
6 Ga0070691_10060352 3300005341 Bacteria 1823
7 Ga0070668_100013821 3300005347 Bacteria 6031
8 Ga0070674_101307310 3300005356 Bacteria 647
9 Ga0070659_100374820 3300005366 Bacteria 1198
10 Ga0070659_100621559 3300005366 Bacteria 930
11 Ga0070709_10463029 3300005434 Bacteria 957
12 Ga0070714_100003317 3300005435 Bacteria 12001
13 Ga0070713_100013565 3300005436 Bacteria 6024
14 Ga0070701_10127048 3300005438 Bacteria 1444
15 Ga0070711_100014522 3300005439 Bacteria 4963
16 Ga0070700_100226140 3300005441 Bacteria 1329
17 Ga0070700_100417100 3300005441 Bacteria 1013
18 Ga0070662_100018434 3300005457 Bacteria 4722
19 Ga0070697_100696625 3300005536 Bacteria 896
20 Ga0070672_101178796 3300005543 Bacteria 682
21 Ga0070696_100020598 3300005546 Bacteria 4468
22 Ga0070704_100669544 3300005549 Bacteria 918
23 Ga0068857_100814462 3300005577 Unclassified 892
24 Ga0068854_100417113 3300005578 Bacteria 1114
25 Ga0068856_100063176 3300005614 Bacteria 3658
26 Ga0068856_100149452 3300005614 Bacteria 2345
27 Ga0068856_100525065 3300005614 Bacteria 1205
28 Ga0070702_100404088 3300005615 Bacteria 978
29 Ga0068852_100252984 3300005616 Bacteria 1688
30 Ga0068864_100000031 3300005618 Bacteria 215331
31 Ga0068864_100724591 3300005618 Bacteria 973
32 Ga0068861_100005414 3300005719 Bacteria 8639
33 Ga0068861_100533191 3300005719 Bacteria 1067
34 Ga0081455_10006483 3300005937 Bacteria 12547
35 Ga0081538_10002091 3300005981 Bacteria 19909
36 Ga0081540_1001176 3300005983 Bacteria 22902
37 Ga0081539_10003039 3300005985 Bacteria 21722
38 Ga0081539_10038100 3300005985 Bacteria 2853
39 Ga0070717_10055769 3300006028 Bacteria 3262
40 Ga0075365_10223134 3300006038 Bacteria 1322
41 Ga0075364_10053515 3300006051 Bacteria 2638
42 Ga0075364_10224754 3300006051 Bacteria 1275
43 Ga0070712_100372940 3300006175 Bacteria 1173
44 Ga0075428_100072917 3300006844 Bacteria 3749
45 Ga0075428_100186914 3300006844 Bacteria 2241
46 Ga0075428_100685786 3300006844 Bacteria 1092
47 Ga0075428_100734860 3300006844 Bacteria 1051
48 Ga0075430_100061480 3300006846 Bacteria 3156
49 Ga0075430_100224875 3300006846 Bacteria 1557
50 Ga0075430_100316358 3300006846 Bacteria 1291
51 Ga0075431_100059492 3300006847 Bacteria 3943
52 Ga0075431_100517050 3300006847 Bacteria 1183
53 Ga0075433_10142029 3300006852 Bacteria 2134
54 Ga0075433_10329482 3300006852 Bacteria 1350
55 Ga0075433_10750119 3300006852 Unclassified 854
56 Ga0075434_100007057 3300006871 Bacteria 10369
57 Ga0075434_100112293 3300006871 Bacteria 2736
58 Ga0075429_100104077 3300006880 Bacteria 2479
59 Ga0075429_100408821 3300006880 Bacteria 1189
60 Ga0075435_100012510 3300007076 Bacteria 6286
61 Ga0075435_100182017 3300007076 Bacteria 1776
62 Ga0111539_10050563 3300009094 Bacteria 4951
63 Ga0111539_10098416 3300009094 Bacteria 3436
64 Ga0111539_10462577 3300009094 Bacteria 1477
65 Ga0105245_10003707 3300009098 Bacteria 13629
66 Ga0105245_10454120 3300009098 Bacteria 1290
67 Ga0105245_11179556 3300009098 Bacteria 813
68 Ga0114129_10000609 3300009147 Bacteria 44313
69 Ga0114129_10005383 3300009147 Bacteria 18068
70 Ga0114129_10271247 3300009147 Bacteria 2270
71 Ga0114129_10412973 3300009147 Bacteria 1777
72 Ga0114129_10538173 3300009147 Bacteria 1521
73 Ga0114129_11625394 3300009147 Bacteria 790
74 Ga0105249_10005340 3300009553 Bacteria 11082
75 Ga0163162_10258651 3300013306 Bacteria 1873
76 Ga0157375_11686210 3300013308 Bacteria 750
77 Ga0182008_10131077 3300014497 Bacteria 1250
78 Ga0157377_10659076 3300014745 Bacteria 754
79 Ga0157379_10054814 3300014968 Bacteria 3562
80 Ga0213874_10169369 3300021377 Unclassified 772
81 Ga0207692_10040189 3300025898 Bacteria 2307
82 Ga0207688_10073902 3300025901 Bacteria 1938
83 Ga0207699_10509699 3300025906 Unclassified 869
84 Ga0207705_10078933 3300025909 Bacteria 2397
85 Ga0207693_10011512 3300025915 Bacteria 7154
86 Ga0207693_10033507 3300025915 Bacteria 4053
87 Ga0207663_10008304 3300025916 Bacteria 5420
88 Ga0207657_10091296 3300025919 Bacteria 2540
89 Ga0207687_10187006 3300025927 Bacteria 1609
90 Ga0207687_10649865 3300025927 Bacteria 892
91 Ga0207700_10040908 3300025928 Bacteria 3387
92 Ga0207664_10029252 3300025929 Bacteria 4195
93 Ga0207690_10209703 3300025932 Bacteria 1485
94 Ga0207706_10015521 3300025933 Bacteria 6882
95 Ga0207661_10227462 3300025944 Bacteria 1651
96 Ga0207667_10604448 3300025949 Bacteria 1106
97 Ga0207667_11296647 3300025949 Bacteria 705
98 Ga0207677_10138347 3300026023 Bacteria 1860
99 Ga0207703_10790188 3300026035 Bacteria 906
100 Ga0207708_10107394 3300026075 Bacteria 2164
101 Ga0207708_10450037 3300026075 Bacteria 1072
102 Ga0207708_10644640 3300026075 Bacteria 901
103 Ga0207702_10116786 3300026078 Bacteria 2382
104 Ga0207702_10270710 3300026078 Bacteria 1602
105 Ga0207676_10000031 3300026095 Bacteria 215877
106 Ga0207676_11003993 3300026095 Bacteria 822
107 Ga0207675_100017873 3300026118 Bacteria 6613
108 Ga0207675_100242770 3300026118 Bacteria 1741
109 Ga0207698_10179377 3300026142 Bacteria 1874
110 Ga0207698_10267714 3300026142 Bacteria 1573
111 Ga0207428_10024735 3300027907 Bacteria 5040
112 Ga0268265_10807857 3300028380 Bacteria 915
113 Ga0307413_10024353 3300031824 Bacteria 3299
114 Ga0307410_10303677 3300031852 Bacteria 1260
115 Ga0307406_10002717 3300031901 Bacteria 9644
116 Ga0307407_10429148 3300031903 Bacteria 954
117 Ga0307409_100017724 3300031995 Bacteria 4758
118 Ga0307409_100583829 3300031995 Bacteria 1102
119 Ga0307416_100014992 3300032002 Bacteria 5336
120 Ga0307416_100025943 3300032002 Bacteria 4309
121 Ga0307416_100040801 3300032002 Bacteria 3610
122 Ga0307416_100426000 3300032002 Bacteria 1373
123 Ga0307416_100782778 3300032002 Bacteria 1049
124 Ga0307415_100044376 3300032126 Bacteria 2972
125 Ga0307415_100214544 3300032126 Bacteria 1538
126 Ga0373959_0022284 3300034820 Bacteria 1223
127 Ga0373938_0070029 3300034957 Bacteria 837
128 Ga0373940_0017872 3300035088 Bacteria 1772
129 Ga0373939_0024091 3300035114 Bacteria 1692
130 Ga0373931_0091167 3300035691 Bacteria 1698
131 Ga0373937_1393518 3300036401 Bacteria 649
132 Ga0395900_1039833 3300037418 Bacteria 738
133 Ga0395898_0105164 3300037466 Bacteria 2707
134 Ga0395905_0296223 3300037471 Bacteria 1505
135 Ga0436364_1353228 3300037853 Bacteria 838
136 Ga0395901_0327913 3300038443 Bacteria 1583
137 Ga0395901_0726665 3300038443 Bacteria 988
138 Ga0436363_0040825 3300039450 Bacteria 1926
139 Ga0436363_0083786 3300039450 Bacteria 596
140 Ga0436363_0197627 3300039450 Bacteria 2002
141 Ga0436362_0619697 3300039453 Bacteria 674
142 Ga0436362_0808425 3300039453 Archaea 1626
143 Ga0451802_1801496 3300041460 Unclassified 784
144 Ga0466965_0021236 3300044683 Bacteria 3124
145 Ga0466965_0024259 3300044683 Bacteria 2933
146 Ga0466966_0052133 3300044684 Bacteria 2600
147 Ga0466963_0005737 3300044694 Bacteria 7301
148 Ga0466964_0309860 3300044706 Bacteria 799
149 Ga0466968_0036438 3300044735 Bacteria 2062
150 Ga0466968_0053467 3300044735 Unclassified 1730
151 Ga0466968_0317451 3300044735 Bacteria 752
152 Ga0466970_0051962 3300044765 Unclassified 2188
153 Ga0466970_0099058 3300044765 Bacteria 1587
154 Ga0466957_0004474 3300044842 Bacteria 7795
155 Ga0466960_0000173 3300044901 Bacteria 22109
156 Ga0466960_0012173 3300044901 Bacteria 3622
157 Ga0466960_0027076 3300044901 Bacteria 2611
158 Ga0466960_0045211 3300044901 Bacteria 2102
159 Ga0466959_0021431 3300045049 Bacteria 4766
160 Ga0466959_0354766 3300045049 Unclassified 1000
161 Ga0466958_0000836 3300045836 Bacteria 13618
162 Ga0466967_0001345 3300045976 Bacteria 14115
163 Ga0466967_0219018 3300045976 Bacteria 1808
164 Ga0466967_0890281 3300045976 Bacteria 885
165 Ga0495627_189653 3300046453 Bacteria 568
166 Ga0495590_0142404 3300046457 Bacteria 866
167 Ga0495605_0291113 3300046474 Bacteria 692
168 Ga0495662_0331233 3300046476 Bacteria 749
169 Ga0495584_0380287 3300046491 Bacteria 717
170 Ga0495596_0030339 3300046500 Bacteria 2165
171 Ga0495596_0069197 3300046500 Bacteria 1372
172 Ga0495608_0329377 3300046511 Bacteria 942
173 Ga0495620_0153687 3300046515 Bacteria 896
174 Ga0495630_0083268 3300046517 Bacteria 2415
175 Ga0495665_0625881 3300046531 Bacteria 537
176 Ga0495586_0330851 3300046535 Bacteria 874
177 Ga0495622_0296107 3300046557 Bacteria 706
178 Ga0495667_0025482 3300046559 Bacteria 3985
179 Ga0495588_0013117 3300046674 Bacteria 3940
180 Ga0495670_0046593 3300046691 Bacteria 2166
181 Ga0495600_0094883 3300046809 Bacteria 1945
182 Ga0495672_0031165 3300047320 Bacteria 3332
183 Ga0495680_0095928 3300047322 Bacteria 2216
184 Ga0496100_0164408 3300048903 Bacteria 1593
185 Ga0496100_0634692 3300048903 Bacteria 831
186 Ga0496100_0744694 3300048903 Bacteria 766
187 Ga0496101_0263498 3300048904 Bacteria 1345
188 Ga0496101_0311532 3300048904 Bacteria 1234
189 Ga0496101_0903487 3300048904 Bacteria 695
190 Ga0496102_0015396 3300048905 Bacteria 6662
191 Ga0496103_0277008 3300048906 Bacteria 1079
192 Ga0496104_0064352 3300048907 Bacteria 3479
193 Ga0496104_0193469 3300048907 Bacteria 1946
194 Ga0496105_0039774 3300048908 Bacteria 3877
195 Ga0496106_0049579 3300048909 Bacteria 3163
196 Ga0496106_0271888 3300048909 Bacteria 1357
197 Ga0496107_0038644 3300048910 Bacteria 3423
198 Ga0496107_0086584 3300048910 Bacteria 2287
199 Ga0496107_0277569 3300048910 Bacteria 1247
200 Ga0496108_0006262 3300048911 Bacteria 9641
201 Ga0496108_0030125 3300048911 Bacteria 4498
202 Ga0496108_0048456 3300048911 Bacteria 3553
203 Ga0496108_0151578 3300048911 Bacteria 2001
204 Ga0496108_0598008 3300048911 Bacteria 961
205 Ga0496109_0055905 3300048912 Bacteria 3600
206 Ga0496109_0110333 3300048912 Bacteria 2558
207 Ga0496109_0424314 3300048912 Bacteria 1256
208 Ga0496110_0030581 3300048913 Bacteria 4642
209 Ga0496111_0024701 3300048914 Bacteria 4236
210 Ga0496111_0147676 3300048914 Bacteria 1743
211 Ga0496112_0000807 3300048915 Bacteria 22108
212 Ga0496112_0112813 3300048915 Bacteria 2689
213 Ga0496113_0018930 3300048916 Bacteria 4807
214 Ga0496113_0026726 3300048916 Bacteria 4130
215 Ga0496113_0249645 3300048916 Bacteria 1416
216 Ga0496113_0295620 3300048916 Bacteria 1296
217 Ga0496115_0007944 3300048918 Bacteria 7828
218 Ga0501033_0439026 3300049570 Bacteria 908
219 Ga0501034_0005417 3300049571 Bacteria 13955
220 Ga0501036_0468510 3300049572 Bacteria 1049
221 Ga0501036_0637197 3300049572 Bacteria 883
222 Ga0501038_0364302 3300049574 Bacteria 1124
223 Ga0501040_0055955 3300049576 Bacteria 2706
224 Ga0501040_0401419 3300049576 Bacteria 984
225 Ga0501041_0084453 3300049577 Bacteria 1957
226 Ga0501042_0060884 3300049578 Bacteria 2697
227 Ga0501042_0660302 3300049578 Bacteria 760
228 Ga0501046_0145267 3300049580 Bacteria 1792
229 Ga0501046_0336821 3300049580 Bacteria 1097
230 Ga0501048_0213025 3300049582 Bacteria 1370
231 Ga0501070_0196400 3300049586 Bacteria 1657
232 Ga0501071_0893572 3300049587 Bacteria 685
233 Ga0501071_1008828 3300049587 Bacteria 643
234 Ga0501072_0019150 3300049588 Bacteria 5287
235 Ga0501072_0372758 3300049588 Bacteria 1133
236 Ga0501074_0976704 3300049590 Bacteria 596
237 Ga0501075_0586959 3300049591 Bacteria 850
238 Ga0501077_0225665 3300049593 Bacteria 1191
239 Ga0501077_1051981 3300049593 Bacteria 524
240 Ga0501045_0422723 3300049824 Bacteria 991
241 nmdc:mga00v17_123049_c1 3300050491 Bacteria 1653
242 nmdc:mga06z11_188931_c1 3300050494 Unclassified 1191
243 nmdc:mga06z11_663494_c1 3300050494 Unclassified 635
244 nmdc:mga05p37_11996_c1 3300050507 Bacteria 10341
245 nmdc:mga05p37_4922_c1 3300050507 Bacteria 15649
246 nmdc:mga05p37_536828_c1 3300050507 Bacteria 1334
247 nmdc:mga09592_106354_c1 3300050508 Bacteria 2406
248 nmdc:mga09592_211706_c1 3300050508 Bacteria 1679
249 nmdc:mga0qj67_4068_c1 3300050509 Bacteria 10608
250 nmdc:mga0qj67_83455_c1 3300050509 Bacteria 2561
251 nmdc:mga06r32_1199072_c1 3300050510 Bacteria 705
252 nmdc:mga06r32_120789_c1 3300050510 Bacteria 2584
253 nmdc:mga06r32_63781_c1 3300050510 Bacteria 3552
254 nmdc:mga08y16_175934_c1 3300050511 Bacteria 2222
255 nmdc:mga08y16_186697_c1 3300050511 Bacteria 2151
256 nmdc:mga08y16_264112_c1 3300050511 Bacteria 1777
257 nmdc:mga08y16_481030_c1 3300050511 Bacteria 1263
258 nmdc:mga08y16_65112_c1 3300050511 Bacteria 3805
259 nmdc:mga0n895_55902_c1 3300050512 Bacteria 3886
260 nmdc:mga0n895_67902_c1 3300050512 Bacteria 3531
261 nmdc:mga0rr50_25059_c1 3300050513 Bacteria 4142
262 nmdc:mga0a205_138486_c1 3300050515 Bacteria 2334
263 nmdc:mga0a205_319428_c1 3300050515 Bacteria 1424
264 nmdc:mga0a205_447355_c1 3300050515 Bacteria 1152
265 Ga0495601_0023756 3300053077 Bacteria 3769
266 Ga0495655_0045621 3300053083 Bacteria 1139
267 Ga0495619_0001837 3300053085 Bacteria 14120
268 Ga0501084_0857223 3300054114 Bacteria 764
269 Ga0530510_0053571 3300061734 Bacteria 2916
270 Ga0530510_0421314 3300061734 Bacteria 1008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0099058 Ga0466970_0099058_1096_1521 123
2 3300044683 Ga0466965_0021236 Ga0466965_0021236_2621_3070 132
3 3300021377 Ga0213874_10169369 Ga0213874_101693691 137
4 3300050510 nmdc:mga06r32_1199072_c1 nmdc:mga06r32_1199072_c1_106_648 139
5 3300009147 Ga0114129_10271247 Ga0114129_102712472 146
6 3300044765 Ga0466970_0051962 Ga0466970_0051962_985_1515 148
7 3300046491 Ga0495584_0380287 Ga0495584_0380287_254_703 149
8 3300046531 Ga0495665_0625881 Ga0495665_0625881_77_526 149
9 3300046557 Ga0495622_0296107 Ga0495622_0296107_26_475 149
10 3300048907 Ga0496104_0193469 Ga0496104_0193469_246_755 149
11 3300049587 Ga0501071_1008828 Ga0501071_1008828_161_610 149
12 3300038443 Ga0395901_0726665 Ga0395901_0726665_87_635 150
13 3300039450 Ga0436363_0083786 Ga0436363_0083786_36_533 150
14 3300006844 Ga0075428_100734860 Ga0075428_1007348601 151
15 3300044683 Ga0466965_0024259 Ga0466965_0024259_313_822 151
16 3300044735 Ga0466968_0053467 Ga0466968_0053467_310_819 151
17 3300045049 Ga0466959_0354766 Ga0466959_0354766_127_636 151
18 3300005441 Ga0070700_100226140 Ga0070700_1002261402 152
19 3300005543 Ga0070672_101178796 Ga0070672_1011787962 152
20 3300014745 Ga0157377_10659076 Ga0157377_106590762 152
21 3300026075 Ga0207708_10644640 Ga0207708_106446402 152
22 3300039453 Ga0436362_0619697 Ga0436362_0619697_105_614 152
23 3300044684 Ga0466966_0052133 Ga0466966_0052133_206_736 152
24 3300044694 Ga0466963_0005737 Ga0466963_0005737_1822_2352 152
25 3300044842 Ga0466957_0004474 Ga0466957_0004474_3789_4319 152
26 3300045049 Ga0466959_0021431 Ga0466959_0021431_1184_1714 152
27 3300045836 Ga0466958_0000836 Ga0466958_0000836_1180_1710 152
28 3300045976 Ga0466967_0001345 Ga0466967_0001345_10038_10568 152
29 3300048912 Ga0496109_0424314 Ga0496109_0424314_77_586 152
30 3300050511 nmdc:mga08y16_186697_c1 nmdc:mga08y16_186697_c1_838_1347 152
31 3300032002 Ga0307416_100782778 Ga0307416_1007827782 154
32 3300006051 Ga0075364_10224754 Ga0075364_102247542 155
33 3300049572 Ga0501036_0637197 Ga0501036_0637197_174_683 155
34 3300049574 Ga0501038_0364302 Ga0501038_0364302_61_570 155
35 3300049578 Ga0501042_0660302 Ga0501042_0660302_126_635 155
36 3300049590 Ga0501074_0976704 Ga0501074_0976704_27_536 155
37 3300049593 Ga0501077_1051981 Ga0501077_1051981_25_492 155
38 3300050491 nmdc:mga00v17_123049_c1 nmdc:mga00v17_123049_c1_370_879 155
39 3300054114 Ga0501084_0857223 Ga0501084_0857223_270_737 155
40 3300014497 Ga0182008_10131077 Ga0182008_101310772 156
41 3300039450 Ga0436363_0197627 Ga0436363_0197627_1333_1842 157
42 3300037853 Ga0436364_1353228 Ga0436364_1353228_239_748 158
43 3300005618 Ga0068864_100000031 Ga0068864_100000031207 160
44 3300026095 Ga0207676_10000031 Ga0207676_10000031206 160
45 3300005536 Ga0070697_100696625 Ga0070697_1006966251 161
46 3300005981 Ga0081538_10002091 Ga0081538_100020919 161
47 3300031995 Ga0307409_100583829 Ga0307409_1005838292 161
48 3300032126 Ga0307415_100214544 Ga0307415_1002145441 161
49 3300045976 Ga0466967_0219018 Ga0466967_0219018_615_1124 161
50 3300050507 nmdc:mga05p37_11996_c1 nmdc:mga05p37_11996_c1_2162_2719 161
51 3300006852 Ga0075433_10329482 Ga0075433_103294821 163
52 3300006871 Ga0075434_100007057 Ga0075434_1000070574 163
53 3300007076 Ga0075435_100182017 Ga0075435_1001820172 163
54 3300009147 Ga0114129_10005383 Ga0114129_1000538312 163
55 3300046691 Ga0495670_0046593 Ga0495670_0046593_571_1080 163
56 3300050512 nmdc:mga0n895_67902_c1 nmdc:mga0n895_67902_c1_2603_3160 163
57 3300050515 nmdc:mga0a205_319428_c1 nmdc:mga0a205_319428_c1_819_1376 163
58 3300005614 Ga0068856_100063176 Ga0068856_1000631762 164
59 3300026078 Ga0207702_10116786 Ga0207702_101167862 164
60 3300005719 Ga0068861_100533191 Ga0068861_1005331912 168
61 3300026118 Ga0207675_100242770 Ga0207675_1002427702 168
62 3300005327 Ga0070658_10070638 Ga0070658_100706382 169
63 3300005329 Ga0070683_100935288 Ga0070683_1009352882 169
64 3300005337 Ga0070682_100525832 Ga0070682_1005258322 169
65 3300005338 Ga0068868_100156296 Ga0068868_1001562963 169
66 3300005339 Ga0070660_100045443 Ga0070660_1000454432 169
67 3300005341 Ga0070691_10060352 Ga0070691_100603522 169
68 3300005347 Ga0070668_100013821 Ga0070668_1000138212 169
69 3300005356 Ga0070674_101307310 Ga0070674_1013073101 169
70 3300005366 Ga0070659_100374820 Ga0070659_1003748202 169
71 3300005366 Ga0070659_100621559 Ga0070659_1006215592 169
72 3300005434 Ga0070709_10463029 Ga0070709_104630292 169
73 3300005435 Ga0070714_100003317 Ga0070714_1000033177 169
74 3300005436 Ga0070713_100013565 Ga0070713_1000135653 169
75 3300005438 Ga0070701_10127048 Ga0070701_101270482 169
76 3300005439 Ga0070711_100014522 Ga0070711_1000145225 169
77 3300005441 Ga0070700_100417100 Ga0070700_1004171001 169
78 3300005457 Ga0070662_100018434 Ga0070662_1000184342 169
79 3300005546 Ga0070696_100020598 Ga0070696_1000205984 169
80 3300005549 Ga0070704_100669544 Ga0070704_1006695442 169
81 3300005577 Ga0068857_100814462 Ga0068857_1008144622 169
82 3300005578 Ga0068854_100417113 Ga0068854_1004171132 169
83 3300005614 Ga0068856_100149452 Ga0068856_1001494523 169
84 3300005614 Ga0068856_100525065 Ga0068856_1005250653 169
85 3300005615 Ga0070702_100404088 Ga0070702_1004040882 169
86 3300005616 Ga0068852_100252984 Ga0068852_1002529842 169
87 3300005618 Ga0068864_100724591 Ga0068864_1007245912 169
88 3300005719 Ga0068861_100005414 Ga0068861_1000054148 169
89 3300005937 Ga0081455_10006483 Ga0081455_100064834 169
90 3300005983 Ga0081540_1001176 Ga0081540_10011767 169
91 3300005985 Ga0081539_10003039 Ga0081539_100030397 169
92 3300005985 Ga0081539_10038100 Ga0081539_100381002 169
93 3300006028 Ga0070717_10055769 Ga0070717_100557696 169
94 3300006038 Ga0075365_10223134 Ga0075365_102231342 169
95 3300006051 Ga0075364_10053515 Ga0075364_100535151 169
96 3300006175 Ga0070712_100372940 Ga0070712_1003729402 169
97 3300006844 Ga0075428_100072917 Ga0075428_1000729173 169
98 3300006844 Ga0075428_100186914 Ga0075428_1001869142 169
99 3300006844 Ga0075428_100685786 Ga0075428_1006857862 169
100 3300006846 Ga0075430_100061480 Ga0075430_1000614803 169
101 3300006846 Ga0075430_100224875 Ga0075430_1002248752 169
102 3300006846 Ga0075430_100316358 Ga0075430_1003163582 169
103 3300006847 Ga0075431_100059492 Ga0075431_1000594924 169
104 3300006847 Ga0075431_100517050 Ga0075431_1005170502 169
105 3300006852 Ga0075433_10142029 Ga0075433_101420292 169
106 3300006852 Ga0075433_10750119 Ga0075433_107501192 169
107 3300006871 Ga0075434_100112293 Ga0075434_1001122932 169
108 3300006880 Ga0075429_100104077 Ga0075429_1001040772 169
109 3300006880 Ga0075429_100408821 Ga0075429_1004088212 169
110 3300007076 Ga0075435_100012510 Ga0075435_1000125102 169
111 3300009094 Ga0111539_10050563 Ga0111539_100505633 169
112 3300009094 Ga0111539_10098416 Ga0111539_100984163 169
113 3300009094 Ga0111539_10462577 Ga0111539_104625772 169
114 3300009098 Ga0105245_10003707 Ga0105245_1000370711 169
115 3300009098 Ga0105245_10454120 Ga0105245_104541202 169
116 3300009098 Ga0105245_11179556 Ga0105245_111795561 169
117 3300009147 Ga0114129_10000609 Ga0114129_1000060938 169
118 3300009147 Ga0114129_10412973 Ga0114129_104129733 169
119 3300009147 Ga0114129_10538173 Ga0114129_105381732 169
120 3300009147 Ga0114129_11625394 Ga0114129_116253941 169
121 3300009553 Ga0105249_10005340 Ga0105249_100053406 169
122 3300013306 Ga0163162_10258651 Ga0163162_102586513 169
123 3300013308 Ga0157375_11686210 Ga0157375_116862102 169
124 3300014968 Ga0157379_10054814 Ga0157379_100548143 169
125 3300025898 Ga0207692_10040189 Ga0207692_100401893 169
126 3300025901 Ga0207688_10073902 Ga0207688_100739022 169
127 3300025906 Ga0207699_10509699 Ga0207699_105096992 169
128 3300025909 Ga0207705_10078933 Ga0207705_100789334 169
129 3300025915 Ga0207693_10011512 Ga0207693_100115126 169
130 3300025915 Ga0207693_10033507 Ga0207693_100335076 169
131 3300025916 Ga0207663_10008304 Ga0207663_100083045 169
132 3300025919 Ga0207657_10091296 Ga0207657_100912963 169
133 3300025927 Ga0207687_10187006 Ga0207687_101870062 169
134 3300025927 Ga0207687_10649865 Ga0207687_106498652 169
135 3300025928 Ga0207700_10040908 Ga0207700_100409084 169
136 3300025929 Ga0207664_10029252 Ga0207664_100292525 169
137 3300025932 Ga0207690_10209703 Ga0207690_102097032 169
138 3300025933 Ga0207706_10015521 Ga0207706_100155212 169
139 3300025944 Ga0207661_10227462 Ga0207661_102274622 169
140 3300025949 Ga0207667_10604448 Ga0207667_106044482 169
141 3300025949 Ga0207667_11296647 Ga0207667_112966472 169
142 3300026023 Ga0207677_10138347 Ga0207677_101383472 169
143 3300026035 Ga0207703_10790188 Ga0207703_107901882 169
144 3300026075 Ga0207708_10107394 Ga0207708_101073942 169
145 3300026075 Ga0207708_10450037 Ga0207708_104500372 169
146 3300026078 Ga0207702_10270710 Ga0207702_102707102 169
147 3300026095 Ga0207676_11003993 Ga0207676_110039932 169
148 3300026118 Ga0207675_100017873 Ga0207675_1000178736 169
149 3300026142 Ga0207698_10179377 Ga0207698_101793772 169
150 3300026142 Ga0207698_10267714 Ga0207698_102677142 169
151 3300027907 Ga0207428_10024735 Ga0207428_100247353 169
152 3300028380 Ga0268265_10807857 Ga0268265_108078572 169
153 3300031824 Ga0307413_10024353 Ga0307413_100243533 169
154 3300031852 Ga0307410_10303677 Ga0307410_103036772 169
155 3300031901 Ga0307406_10002717 Ga0307406_100027178 169
156 3300031903 Ga0307407_10429148 Ga0307407_104291482 169
157 3300031995 Ga0307409_100017724 Ga0307409_1000177245 169
158 3300032002 Ga0307416_100014992 Ga0307416_1000149922 169
159 3300032002 Ga0307416_100025943 Ga0307416_1000259432 169
160 3300032002 Ga0307416_100040801 Ga0307416_1000408012 169
161 3300032002 Ga0307416_100426000 Ga0307416_1004260002 169
162 3300032126 Ga0307415_100044376 Ga0307415_1000443763 169
163 3300034820 Ga0373959_0022284 Ga0373959_0022284_278_787 169
164 3300034957 Ga0373938_0070029 Ga0373938_0070029_280_789 169
165 3300035088 Ga0373940_0017872 Ga0373940_0017872_1227_1736 169
166 3300035114 Ga0373939_0024091 Ga0373939_0024091_785_1294 169
167 3300035691 Ga0373931_0091167 Ga0373931_0091167_991_1500 169
168 3300036401 Ga0373937_1393518 Ga0373937_1393518_13_525 169
169 3300037418 Ga0395900_1039833 Ga0395900_1039833_30_545 169
170 3300037466 Ga0395898_0105164 Ga0395898_0105164_1685_2194 169
171 3300037471 Ga0395905_0296223 Ga0395905_0296223_313_822 169
172 3300038443 Ga0395901_0327913 Ga0395901_0327913_957_1469 169
173 3300039450 Ga0436363_0040825 Ga0436363_0040825_250_759 169
174 3300039453 Ga0436362_0808425 Ga0436362_0808425_206_715 169
175 3300041460 Ga0451802_1801496 Ga0451802_1801496_135_644 169
176 3300044706 Ga0466964_0309860 Ga0466964_0309860_157_666 169
177 3300044735 Ga0466968_0036438 Ga0466968_0036438_1068_1580 169
178 3300044735 Ga0466968_0317451 Ga0466968_0317451_187_696 169
179 3300044901 Ga0466960_0000173 Ga0466960_0000173_14260_14772 169
180 3300044901 Ga0466960_0012173 Ga0466960_0012173_1043_1555 169
181 3300044901 Ga0466960_0027076 Ga0466960_0027076_1034_1546 169
182 3300044901 Ga0466960_0045211 Ga0466960_0045211_1263_1775 169
183 3300045976 Ga0466967_0890281 Ga0466967_0890281_239_751 169
184 3300046453 Ga0495627_189653 Ga0495627_189653_39_548 169
185 3300046457 Ga0495590_0142404 Ga0495590_0142404_26_535 169
186 3300046474 Ga0495605_0291113 Ga0495605_0291113_65_574 169
187 3300046476 Ga0495662_0331233 Ga0495662_0331233_213_731 169
188 3300046500 Ga0495596_0030339 Ga0495596_0030339_472_1014 169
189 3300046500 Ga0495596_0069197 Ga0495596_0069197_213_722 169
190 3300046511 Ga0495608_0329377 Ga0495608_0329377_42_554 169
191 3300046515 Ga0495620_0153687 Ga0495620_0153687_107_616 169
192 3300046517 Ga0495630_0083268 Ga0495630_0083268_934_1446 169
193 3300046535 Ga0495586_0330851 Ga0495586_0330851_314_826 169
194 3300046559 Ga0495667_0025482 Ga0495667_0025482_2510_3022 169
195 3300046674 Ga0495588_0013117 Ga0495588_0013117_2460_2972 169
196 3300046809 Ga0495600_0094883 Ga0495600_0094883_379_888 169
197 3300047320 Ga0495672_0031165 Ga0495672_0031165_1842_2351 169
198 3300047322 Ga0495680_0095928 Ga0495680_0095928_1436_1948 169
199 3300048903 Ga0496100_0164408 Ga0496100_0164408_1030_1539 169
200 3300048903 Ga0496100_0634692 Ga0496100_0634692_302_814 169
201 3300048903 Ga0496100_0744694 Ga0496100_0744694_27_545 169
202 3300048904 Ga0496101_0263498 Ga0496101_0263498_787_1305 169
203 3300048904 Ga0496101_0311532 Ga0496101_0311532_182_709 169
204 3300048904 Ga0496101_0903487 Ga0496101_0903487_139_648 169
205 3300048905 Ga0496102_0015396 Ga0496102_0015396_4777_5286 169
206 3300048906 Ga0496103_0277008 Ga0496103_0277008_534_1052 169
207 3300048907 Ga0496104_0064352 Ga0496104_0064352_2502_3011 169
208 3300048908 Ga0496105_0039774 Ga0496105_0039774_275_784 169
209 3300048909 Ga0496106_0049579 Ga0496106_0049579_1614_2123 169
210 3300048909 Ga0496106_0271888 Ga0496106_0271888_316_825 169
211 3300048910 Ga0496107_0038644 Ga0496107_0038644_2046_2555 169
212 3300048910 Ga0496107_0086584 Ga0496107_0086584_825_1334 169
213 3300048910 Ga0496107_0277569 Ga0496107_0277569_371_880 169
214 3300048911 Ga0496108_0006262 Ga0496108_0006262_2608_3117 169
215 3300048911 Ga0496108_0030125 Ga0496108_0030125_2221_2730 169
216 3300048911 Ga0496108_0048456 Ga0496108_0048456_1901_2410 169
217 3300048911 Ga0496108_0151578 Ga0496108_0151578_754_1266 169
218 3300048911 Ga0496108_0598008 Ga0496108_0598008_89_598 169
219 3300048912 Ga0496109_0055905 Ga0496109_0055905_553_1062 169
220 3300048912 Ga0496109_0110333 Ga0496109_0110333_390_899 169
221 3300048913 Ga0496110_0030581 Ga0496110_0030581_2957_3466 169
222 3300048914 Ga0496111_0024701 Ga0496111_0024701_2159_2668 169
223 3300048914 Ga0496111_0147676 Ga0496111_0147676_615_1124 169
224 3300048915 Ga0496112_0000807 Ga0496112_0000807_15723_16238 169
225 3300048915 Ga0496112_0112813 Ga0496112_0112813_1393_1902 169
226 3300048916 Ga0496113_0018930 Ga0496113_0018930_1267_1776 169
227 3300048916 Ga0496113_0026726 Ga0496113_0026726_3248_3757 169
228 3300048916 Ga0496113_0249645 Ga0496113_0249645_611_1120 169
229 3300048916 Ga0496113_0295620 Ga0496113_0295620_86_595 169
230 3300048918 Ga0496115_0007944 Ga0496115_0007944_2559_3077 169
231 3300049570 Ga0501033_0439026 Ga0501033_0439026_330_839 169
232 3300049571 Ga0501034_0005417 Ga0501034_0005417_4917_5429 169
233 3300049572 Ga0501036_0468510 Ga0501036_0468510_96_605 169
234 3300049576 Ga0501040_0055955 Ga0501040_0055955_2181_2690 169
235 3300049576 Ga0501040_0401419 Ga0501040_0401419_183_692 169
236 3300049577 Ga0501041_0084453 Ga0501041_0084453_729_1238 169
237 3300049578 Ga0501042_0060884 Ga0501042_0060884_1799_2308 169
238 3300049580 Ga0501046_0145267 Ga0501046_0145267_61_570 169
239 3300049580 Ga0501046_0336821 Ga0501046_0336821_247_756 169
240 3300049582 Ga0501048_0213025 Ga0501048_0213025_535_1044 169
241 3300049586 Ga0501070_0196400 Ga0501070_0196400_584_1093 169
242 3300049587 Ga0501071_0893572 Ga0501071_0893572_11_520 169
243 3300049588 Ga0501072_0019150 Ga0501072_0019150_4082_4591 169
244 3300049588 Ga0501072_0372758 Ga0501072_0372758_322_831 169
245 3300049591 Ga0501075_0586959 Ga0501075_0586959_262_771 169
246 3300049593 Ga0501077_0225665 Ga0501077_0225665_425_934 169
247 3300049824 Ga0501045_0422723 Ga0501045_0422723_136_645 169
248 3300050494 nmdc:mga06z11_188931_c1 nmdc:mga06z11_188931_c1_306_815 169
249 3300050494 nmdc:mga06z11_663494_c1 nmdc:mga06z11_663494_c1_68_577 169
250 3300050507 nmdc:mga05p37_4922_c1 nmdc:mga05p37_4922_c1_5513_6022 169
251 3300050507 nmdc:mga05p37_536828_c1 nmdc:mga05p37_536828_c1_320_829 169
252 3300050508 nmdc:mga09592_106354_c1 nmdc:mga09592_106354_c1_660_1169 169
253 3300050508 nmdc:mga09592_211706_c1 nmdc:mga09592_211706_c1_719_1228 169
254 3300050509 nmdc:mga0qj67_4068_c1 nmdc:mga0qj67_4068_c1_3608_4117 169
255 3300050509 nmdc:mga0qj67_83455_c1 nmdc:mga0qj67_83455_c1_1210_1719 169
256 3300050510 nmdc:mga06r32_120789_c1 nmdc:mga06r32_120789_c1_1728_2237 169
257 3300050510 nmdc:mga06r32_63781_c1 nmdc:mga06r32_63781_c1_2656_3165 169
258 3300050511 nmdc:mga08y16_175934_c1 nmdc:mga08y16_175934_c1_1260_1802 169
259 3300050511 nmdc:mga08y16_264112_c1 nmdc:mga08y16_264112_c1_1056_1565 169
260 3300050511 nmdc:mga08y16_481030_c1 nmdc:mga08y16_481030_c1_504_1013 169
261 3300050511 nmdc:mga08y16_65112_c1 nmdc:mga08y16_65112_c1_1077_1586 169
262 3300050512 nmdc:mga0n895_55902_c1 nmdc:mga0n895_55902_c1_908_1417 169
263 3300050513 nmdc:mga0rr50_25059_c1 nmdc:mga0rr50_25059_c1_2168_2677 169
264 3300050515 nmdc:mga0a205_138486_c1 nmdc:mga0a205_138486_c1_1183_1692 169
265 3300050515 nmdc:mga0a205_447355_c1 nmdc:mga0a205_447355_c1_387_896 169
266 3300053077 Ga0495601_0023756 Ga0495601_0023756_3102_3614 169
267 3300053083 Ga0495655_0045621 Ga0495655_0045621_567_1076 169
268 3300053085 Ga0495619_0001837 Ga0495619_0001837_12417_12929 169
269 3300061734 Ga0530510_0053571 Ga0530510_0053571_405_914 169
270 3300061734 Ga0530510_0421314 Ga0530510_0421314_224_733 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

20

83

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7h-assembly1.cif.gz_A crystal structure of the nitroreductase-like family protein from bacillus cereus 0.8977 1 169
2i7h-assembly1.cif.gz_A crystal structure of the nitroreductase-like family protein from bacillus cereus 0.8927 1 169
7z0w-assembly3.cif.gz_F e. coli nfsa bound to nadp+ 0.8801 1 166
3n2s-assembly2.cif.gz_D structure of nfra1 nitroreductase from b. subtilis 0.8798 2 166
3k6h-assembly1.cif.gz_B crystal structure of a nitroreductase family protein from agrobacterium tumefaciens str. c58 0.8765 1 169
ID Description Score Start End Superfamily
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8819 3 169 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8706 2 149 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8673 3 169 3.40.109.10
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8649 2 168 3.40.109.10
3e39B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8569 3 169 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A177R9D0-F1-model_v4 deleted 0.9833 3 169
AF-A0A538IB46-F1-model_v4 Nitroreductase domain-containing protein 0.9828 1 169 GO:0016491
AF-H0E343-F1-model_v4 Nitroreductase family protein 0.9826 1 169 GO:0016491
AF-A0A538KEH7-F1-model_v4 Nitroreductase domain-containing protein 0.9819 1 169 GO:0016491
AF-A0A6I3BTA6-F1-model_v4 Nitroreductase 0.9815 1 169 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map