F376860

General Info

Members Datasets Scaffolds Average Seq Length
270 175 540 302

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100134135|Ga0075428_1001341353
Length 340
Sequence MIMKRFKTPEMGVNRSVTIAQDDMPSAQDERRSEWTRRLPDPVAVLARRSRPRNVPPWWFGLPAMVLFAFVVLVPSARGVYFAFTDWDGLDPDFSVVGLANFGEMFDDPAAMQAIRHTLMIAVAITIIQNGFGLLLALGVNTLIKSRNVLRVFLFAPAVVTPIVTAYLWRNLLGPDGAVNSLLNAVGLGSWQQDWLGDPQLALWSVVGVIVWQFGGYSMVIFLAGLQSVPKEIQEAAAIDGTGPIRRFWSITRPLLAPAFTINLMLSIIGGIKLFDQVYALTNGGPGHATDTISTLIYKDAFTLGEFGYSIALAVVLTIIVAIVSTSQYFFLSRHEKANS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
161 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
162 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
169 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
170 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
171 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
172 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
173 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
174 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
175 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.37
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0.74
Rhizoplane 2.59
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100134135 3300006844 Bacteria 2692
2 JGI24739J22299_10046191 3300001989 Bacteria 1426
3 JGI25406J46586_10001752 3300003203 Bacteria 10203
4 JGI25406J46586_10015542 3300003203 Bacteria 3206
5 JGI25406J46586_10015759 3300003203 Bacteria 3176
6 Ga0070658_10035256 3300005327 Bacteria 4030
7 Ga0070676_10030472 3300005328 Bacteria 3077
8 Ga0070683_100008116 3300005329 Bacteria 8916
9 Ga0070683_100010841 3300005329 Bacteria 7847
10 Ga0070670_100047377 3300005331 Bacteria 3699
11 Ga0070661_100010386 3300005344 Bacteria 6472
12 Ga0070661_100057800 3300005344 Bacteria 2842
13 Ga0070668_100206837 3300005347 Bacteria 1613
14 Ga0070668_100208944 3300005347 Bacteria 1605
15 Ga0070669_100061660 3300005353 Bacteria 2756
16 Ga0070675_100001647 3300005354 Bacteria 16506
17 Ga0070674_100108288 3300005356 Bacteria 2036
18 Ga0070667_100025797 3300005367 Bacteria 4888
19 Ga0070663_100016730 3300005455 Bacteria 4772
20 Ga0070678_100439253 3300005456 Bacteria 1141
21 Ga0070681_10002707 3300005458 Bacteria 16307
22 Ga0070679_100003734 3300005530 Bacteria 13958
23 Ga0070684_100006720 3300005535 Bacteria 8920
24 Ga0070684_100009764 3300005535 Bacteria 7576
25 Ga0070684_100125284 3300005535 Bacteria 2314
26 Ga0070665_100500273 3300005548 Bacteria 1226
27 Ga0070664_100012022 3300005564 Bacteria 7032
28 Ga0070664_100265643 3300005564 Bacteria 1544
29 Ga0070664_100462403 3300005564 Bacteria 1166
30 Ga0068857_100032348 3300005577 Bacteria 4624
31 Ga0070702_100040292 3300005615 Bacteria 2612
32 Ga0068864_100039993 3300005618 Bacteria 4010
33 Ga0068860_100060216 3300005843 Bacteria 3609
34 Ga0068862_100448542 3300005844 Bacteria 1216
35 Ga0081455_10005765 3300005937 Bacteria 13502
36 Ga0081540_1011267 3300005983 Bacteria 5988
37 Ga0081539_10000137 3300005985 Bacteria 171821
38 Ga0081539_10001632 3300005985 Bacteria 36555
39 Ga0081539_10001788 3300005985 Bacteria 34101
40 Ga0081539_10003863 3300005985 Bacteria 17558
41 Ga0070712_100078627 3300006175 Bacteria 2382
42 Ga0075370_10005150 3300006353 Bacteria 6454
43 Ga0075428_100000132 3300006844 Bacteria 65638
44 Ga0075428_100006690 3300006844 Bacteria 12824
45 Ga0075428_100050481 3300006844 Bacteria 4562
46 Ga0075430_100004422 3300006846 Bacteria 11859
47 Ga0075430_100022740 3300006846 Bacteria 5332
48 Ga0075431_100020951 3300006847 Bacteria 6680
49 Ga0075431_100079532 3300006847 Bacteria 3384
50 Ga0075429_100023874 3300006880 Bacteria 5307
51 Ga0075429_100088304 3300006880 Bacteria 2702
52 Ga0111539_10000786 3300009094 Bacteria 41312
53 Ga0105245_10000580 3300009098 Bacteria 33235
54 Ga0114129_10001151 3300009147 Bacteria 34998
55 Ga0114129_10004535 3300009147 Bacteria 19609
56 Ga0114129_10045387 3300009147 Bacteria 6178
57 Ga0114129_10050161 3300009147 Bacteria 5863
58 Ga0114129_10323895 3300009147 Bacteria 2048
59 Ga0114129_10360515 3300009147 Bacteria 1924
60 Ga0105241_10212076 3300009174 Bacteria 1623
61 Ga0105249_10036512 3300009553 Bacteria 4457
62 Ga0105246_10325198 3300011119 Bacteria 1251
63 Ga0157369_10013732 3300013105 Bacteria 9154
64 Ga0157378_10068404 3300013297 Bacteria 3185
65 Ga0157375_10369668 3300013308 Bacteria 1600
66 Ga0157375_10455762 3300013308 Bacteria 1444
67 Ga0163163_10038805 3300014325 Bacteria 4643
68 Ga0157377_10000889 3300014745 Bacteria 12469
69 Ga0157379_10099922 3300014968 Bacteria 2605
70 Ga0157376_10183782 3300014969 Bacteria 1913
71 Ga0206356_10187024 3300020070 Bacteria 1205
72 Ga0207647_10063799 3300025904 Bacteria 2240
73 Ga0207645_10039905 3300025907 Bacteria 3007
74 Ga0207705_10027835 3300025909 Bacteria 4031
75 Ga0207707_10019888 3300025912 Bacteria 5860
76 Ga0207693_10048166 3300025915 Bacteria 3347
77 Ga0207649_10014101 3300025920 Bacteria 4473
78 Ga0207649_10017899 3300025920 Bacteria 4018
79 Ga0207652_10011176 3300025921 Bacteria 7236
80 Ga0207681_10067526 3300025923 Bacteria 2480
81 Ga0207659_10005858 3300025926 Bacteria 7495
82 Ga0207687_10014850 3300025927 Bacteria 5100
83 Ga0207700_10118056 3300025928 Bacteria 2146
84 Ga0207664_10001656 3300025929 Bacteria 14671
85 Ga0207691_10139197 3300025940 Bacteria 2139
86 Ga0207689_10007044 3300025942 Bacteria 9886
87 Ga0207689_10180060 3300025942 Bacteria 1743
88 Ga0207661_10001129 3300025944 Bacteria 17821
89 Ga0207661_10018145 3300025944 Bacteria 5227
90 Ga0207661_10018903 3300025944 Bacteria 5128
91 Ga0207679_10446013 3300025945 Bacteria 1147
92 Ga0207712_10049547 3300025961 Bacteria 2927
93 Ga0207678_10015382 3300026067 Bacteria 6728
94 Ga0207678_10350070 3300026067 Bacteria 1274
95 Ga0207708_10073408 3300026075 Bacteria 2622
96 Ga0207641_10340407 3300026088 Bacteria 1427
97 Ga0207648_10520458 3300026089 Bacteria 1090
98 Ga0207676_10537622 3300026095 Bacteria 1115
99 Ga0207674_10014186 3300026116 Bacteria 8807
100 Ga0207683_10412609 3300026121 Bacteria 1243
101 Ga0207698_10016022 3300026142 Bacteria 5042
102 Ga0207428_10105844 3300027907 Bacteria 2169
103 Ga0268266_10416249 3300028379 Bacteria 1273
104 Ga0268265_10179802 3300028380 Bacteria 1816
105 Ga0268264_10051377 3300028381 Bacteria 3435
106 Ga0268264_10131216 3300028381 Bacteria 2221
107 Ga0307515_10000027 3300028794 Bacteria 371624
108 Ga0307515_10135693 3300028794 Bacteria 2678
109 Ga0307511_10094301 3300030521 Bacteria 2007
110 Ga0307512_10001052 3300030522 Bacteria 40344
111 Ga0307512_10081712 3300030522 Bacteria 2316
112 Ga0307513_10000508 3300031456 Bacteria 56049
113 Ga0307513_10011155 3300031456 Bacteria 11192
114 Ga0307513_10023363 3300031456 Bacteria 7223
115 Ga0307408_100070489 3300031548 Bacteria 2581
116 Ga0307508_10006681 3300031616 Bacteria 10820
117 Ga0307508_10013543 3300031616 Bacteria 7454
118 Ga0307508_10319790 3300031616 Bacteria 1143
119 Ga0307516_10002495 3300031730 Bacteria 24542
120 Ga0307516_10043709 3300031730 Bacteria 4437
121 Ga0307516_10199358 3300031730 Bacteria 1722
122 Ga0307516_10314552 3300031730 Bacteria 1238
123 Ga0307516_10328510 3300031730 Bacteria 1199
124 Ga0307405_10004923 3300031731 Bacteria 6377
125 Ga0307405_10041728 3300031731 Bacteria 2788
126 Ga0307413_10149249 3300031824 Bacteria 1627
127 Ga0307410_10072001 3300031852 Bacteria 2399
128 Ga0307410_10319416 3300031852 Bacteria 1231
129 Ga0307406_10040464 3300031901 Bacteria 2898
130 Ga0307406_10052605 3300031901 Bacteria 2591
131 Ga0307406_10274561 3300031901 Bacteria 1282
132 Ga0307407_10026529 3300031903 Bacteria 3070
133 Ga0307412_10031930 3300031911 Bacteria 3331
134 Ga0307409_100027569 3300031995 Bacteria 4028
135 Ga0307409_100065794 3300031995 Bacteria 2854
136 Ga0307409_100071928 3300031995 Bacteria 2752
137 Ga0307416_100071328 3300032002 Bacteria 2885
138 Ga0307416_100101855 3300032002 Bacteria 2502
139 Ga0307416_100629951 3300032002 Bacteria 1155
140 Ga0307416_100811562 3300032002 Bacteria 1032
141 Ga0307415_100003030 3300032126 Bacteria 8465
142 Ga0307415_100035805 3300032126 Bacteria 3246
143 Ga0307415_100075969 3300032126 Bacteria 2380
144 Ga0307415_100213960 3300032126 Bacteria 1540
145 Ga0307507_10009293 3300033179 Bacteria 13163
146 Ga0307507_10018332 3300033179 Bacteria 7968
147 Ga0307507_10167511 3300033179 Bacteria 1606
148 Ga0373950_0002420 3300034818 Bacteria 2565
149 Ga0373951_0002397 3300035091 Bacteria 4735
150 Ga0373941_0041490 3300035115 Bacteria 1424
151 Ga0373942_0005176 3300035207 Bacteria 3021
152 Ga0373935_0003221 3300035692 Bacteria 9426
153 Ga0451791_0020775 3300041451 Bacteria 3102
154 Ga0451793_1340510 3300041452 Bacteria 896
155 Ga0495592_0000011 3300046454 Bacteria 156647
156 Ga0495592_0008305 3300046454 Bacteria 7791
157 Ga0495592_0060378 3300046454 Bacteria 2789
158 Ga0495603_0071534 3300046455 Bacteria 2038
159 Ga0495629_0000827 3300046459 Bacteria 25099
160 Ga0495629_0006409 3300046459 Bacteria 8723
161 Ga0495638_0025919 3300046460 Bacteria 3806
162 Ga0495651_0003289 3300046462 Bacteria 12406
163 Ga0495651_0003786 3300046462 Bacteria 11572
164 Ga0495651_0059969 3300046462 Bacteria 2916
165 Ga0495651_0227980 3300046462 Bacteria 1285
166 Ga0495653_0000345 3300046463 Bacteria 37856
167 Ga0495662_0000141 3300046476 Bacteria 27833
168 Ga0495662_0009221 3300046476 Bacteria 4840
169 Ga0495664_0000520 3300046477 Bacteria 19243
170 Ga0495664_0028553 3300046477 Bacteria 3257
171 Ga0495585_0115359 3300046492 Bacteria 1425
172 Ga0495608_0014558 3300046511 Bacteria 5457
173 Ga0495618_0016401 3300046514 Bacteria 4531
174 Ga0495618_0019935 3300046514 Bacteria 4128
175 Ga0495628_0000064 3300046516 Bacteria 85991
176 Ga0495628_0049710 3300046516 Bacteria 3319
177 Ga0495630_0000035 3300046517 Bacteria 118545
178 Ga0495630_0010829 3300046517 Bacteria 6586
179 Ga0495632_0068023 3300046519 Bacteria 1717
180 Ga0495666_0000539 3300046526 Bacteria 16851
181 Ga0495652_0000169 3300046529 Bacteria 74610
182 Ga0495652_0248072 3300046529 Bacteria 1321
183 Ga0495640_0002459 3300046533 Bacteria 14887
184 Ga0495586_0221830 3300046535 Bacteria 1074
185 Ga0495587_0000064 3300046536 Bacteria 90007
186 Ga0495587_0001922 3300046536 Bacteria 13843
187 Ga0495645_0000042 3300046543 Bacteria 91093
188 Ga0495634_0000148 3300046642 Bacteria 62329
189 Ga0495634_0003396 3300046642 Bacteria 12784
190 Ga0495634_0004398 3300046642 Bacteria 11082
191 Ga0495611_0166022 3300046648 Bacteria 1032
192 Ga0495635_0000032 3300046663 Bacteria 109069
193 Ga0495635_0002578 3300046663 Bacteria 12401
194 Ga0495635_0025113 3300046663 Bacteria 4151
195 Ga0495635_0053505 3300046663 Bacteria 2781
196 Ga0495657_0000075 3300046675 Bacteria 89389
197 Ga0495657_0002582 3300046675 Bacteria 15165
198 Ga0495657_0005794 3300046675 Bacteria 9733
199 Ga0495657_0104565 3300046675 Bacteria 1800
200 Ga0495599_0000044 3300046678 Bacteria 89350
201 Ga0495623_0001203 3300046679 Bacteria 17541
202 Ga0495646_0000028 3300046680 Bacteria 92735
203 Ga0495646_0003174 3300046680 Bacteria 10204
204 Ga0495613_0000586 3300046689 Bacteria 29455
205 Ga0495613_0002107 3300046689 Bacteria 15108
206 Ga0495613_0003748 3300046689 Bacteria 11396
207 Ga0495613_0012599 3300046689 Bacteria 6288
208 Ga0495600_0000044 3300046809 Bacteria 71943
209 Ga0495600_0000312 3300046809 Bacteria 25755
210 Ga0495600_0010284 3300046809 Bacteria 5802
211 Ga0495581_0002865 3300047315 Bacteria 9852
212 Ga0495581_0198512 3300047315 Bacteria 1173
213 Ga0495604_0000162 3300047317 Bacteria 59086
214 Ga0495604_0000545 3300047317 Bacteria 33154
215 Ga0495674_0000036 3300047319 Bacteria 103830
216 Ga0495674_0058174 3300047319 Bacteria 3381
217 Ga0495676_0005498 3300047321 Bacteria 11624
218 Ga0495676_0329481 3300047321 Bacteria 1024
219 Ga0495680_0004036 3300047322 Bacteria 14162
220 Ga0495687_018811 3300047443 Bacteria 3405
221 Ga0495675_0000126 3300047444 Bacteria 54783
222 Ga0495684_0000474 3300047471 Bacteria 32805
223 Ga0495684_0308896 3300047471 Bacteria 1134
224 Ga0495593_0002178 3300047673 Bacteria 11724
225 Ga0495593_0033724 3300047673 Bacteria 2788
226 Ga0495593_0129260 3300047673 Bacteria 1283
227 Ga0495602_0000078 3300048088 Bacteria 94384
228 Ga0495602_0221393 3300048088 Bacteria 1428
229 Ga0495614_0000643 3300048089 Bacteria 14601
230 Ga0496108_0000066 3300048911 Bacteria 116839
231 Ga0496109_0009474 3300048912 Bacteria 8303
232 Ga0496110_0081674 3300048913 Bacteria 2882
233 Ga0496112_0075063 3300048915 Bacteria 3343
234 Ga0496113_0007938 3300048916 Bacteria 6872
235 Ga0501033_0021664 3300049570 Bacteria 4850
236 Ga0501037_0173513 3300049573 Bacteria 1532
237 Ga0501047_0231361 3300049581 Bacteria 1702
238 nmdc:mga07m45_7981_c1 3300050496 Bacteria 5423
239 nmdc:mga05p37_1609_c1 3300050507 Bacteria 26157
240 nmdc:mga05p37_4990_c1 3300050507 Bacteria 15553
241 nmdc:mga05p37_56379_c1 3300050507 Bacteria 4838
242 nmdc:mga09592_3071_c1 3300050508 Bacteria 13539
243 nmdc:mga09592_32110_c1 3300050508 Bacteria 4376
244 nmdc:mga09592_34614_c1 3300050508 Bacteria 4223
245 nmdc:mga0qj67_2315_c1 3300050509 Bacteria 13539
246 nmdc:mga06r32_66647_c1 3300050510 Bacteria 3474
247 nmdc:mga06r32_7933_c1 3300050510 Bacteria 9546
248 nmdc:mga08y16_481615_c1 3300050511 Bacteria 1263
249 Ga0495601_0001449 3300053077 Bacteria 13074
250 Ga0495601_0041487 3300053077 Bacteria 2885
251 Ga0495619_0044242 3300053085 Bacteria 2922
252 Ga0500644_0077699 3300053088 Bacteria 1213
253 Ga0500646_0014868 3300053090 Bacteria 2023
254 Ga0500651_0088654 3300053093 Bacteria 1908
255 Ga0500640_026964 3300053095 Bacteria 2505
256 Ga0500650_0105160 3300053098 Bacteria 1319
257 Ga0500553_031205 3300053101 Bacteria 2659
258 Ga0500569_012170 3300053109 Bacteria 2076
259 Ga0500572_009340 3300053111 Bacteria 2316
260 Ga0500594_0020594 3300053118 Bacteria 1647
261 Ga0500616_0004455 3300053153 Bacteria 9972
262 Ga0500624_001909 3300053157 Bacteria 3000
263 2585306510 2582581313 Bacteria 10042643
264 2616701075 2616644814 Bacteria 11555299
265 2676486616 2675903059 Bacteria 8644972
266 2734972028 2734482000 Bacteria 5525167
267 2857293102 2857288857 Bacteria 7189066
268 2862392773 2862382967 Bacteria 10317375
269 2929222634 2929219909 Bacteria 6984360
270 8008565137 8008558824 Bacteria 10610750
271 Ga0075428_100134135
272 JGI24739J22299_10046191
273 JGI25406J46586_10001752
274 JGI25406J46586_10015542
275 JGI25406J46586_10015759
276 Ga0070658_10035256
277 Ga0070676_10030472
278 Ga0070683_100008116
279 Ga0070683_100010841
280 Ga0070670_100047377
281 Ga0070661_100010386
282 Ga0070661_100057800
283 Ga0070668_100206837
284 Ga0070668_100208944
285 Ga0070669_100061660
286 Ga0070675_100001647
287 Ga0070674_100108288
288 Ga0070667_100025797
289 Ga0070663_100016730
290 Ga0070678_100439253
291 Ga0070681_10002707
292 Ga0070679_100003734
293 Ga0070684_100006720
294 Ga0070684_100009764
295 Ga0070684_100125284
296 Ga0070665_100500273
297 Ga0070664_100012022
298 Ga0070664_100265643
299 Ga0070664_100462403
300 Ga0068857_100032348
301 Ga0070702_100040292
302 Ga0068864_100039993
303 Ga0068860_100060216
304 Ga0068862_100448542
305 Ga0081455_10005765
306 Ga0081540_1011267
307 Ga0081539_10000137
308 Ga0081539_10001632
309 Ga0081539_10001788
310 Ga0081539_10003863
311 Ga0070712_100078627
312 Ga0075370_10005150
313 Ga0075428_100000132
314 Ga0075428_100006690
315 Ga0075428_100050481
316 Ga0075430_100004422
317 Ga0075430_100022740
318 Ga0075431_100020951
319 Ga0075431_100079532
320 Ga0075429_100023874
321 Ga0075429_100088304
322 Ga0111539_10000786
323 Ga0105245_10000580
324 Ga0114129_10001151
325 Ga0114129_10004535
326 Ga0114129_10045387
327 Ga0114129_10050161
328 Ga0114129_10323895
329 Ga0114129_10360515
330 Ga0105241_10212076
331 Ga0105249_10036512
332 Ga0105246_10325198
333 Ga0157369_10013732
334 Ga0157378_10068404
335 Ga0157375_10369668
336 Ga0157375_10455762
337 Ga0163163_10038805
338 Ga0157377_10000889
339 Ga0157379_10099922
340 Ga0157376_10183782
341 Ga0206356_10187024
342 Ga0207647_10063799
343 Ga0207645_10039905
344 Ga0207705_10027835
345 Ga0207707_10019888
346 Ga0207693_10048166
347 Ga0207649_10014101
348 Ga0207649_10017899
349 Ga0207652_10011176
350 Ga0207681_10067526
351 Ga0207659_10005858
352 Ga0207687_10014850
353 Ga0207700_10118056
354 Ga0207664_10001656
355 Ga0207691_10139197
356 Ga0207689_10007044
357 Ga0207689_10180060
358 Ga0207661_10001129
359 Ga0207661_10018145
360 Ga0207661_10018903
361 Ga0207679_10446013
362 Ga0207712_10049547
363 Ga0207678_10015382
364 Ga0207678_10350070
365 Ga0207708_10073408
366 Ga0207641_10340407
367 Ga0207648_10520458
368 Ga0207676_10537622
369 Ga0207674_10014186
370 Ga0207683_10412609
371 Ga0207698_10016022
372 Ga0207428_10105844
373 Ga0268266_10416249
374 Ga0268265_10179802
375 Ga0268264_10051377
376 Ga0268264_10131216
377 Ga0307515_10000027
378 Ga0307515_10135693
379 Ga0307511_10094301
380 Ga0307512_10001052
381 Ga0307512_10081712
382 Ga0307513_10000508
383 Ga0307513_10011155
384 Ga0307513_10023363
385 Ga0307408_100070489
386 Ga0307508_10006681
387 Ga0307508_10013543
388 Ga0307508_10319790
389 Ga0307516_10002495
390 Ga0307516_10043709
391 Ga0307516_10199358
392 Ga0307516_10314552
393 Ga0307516_10328510
394 Ga0307405_10004923
395 Ga0307405_10041728
396 Ga0307413_10149249
397 Ga0307410_10072001
398 Ga0307410_10319416
399 Ga0307406_10040464
400 Ga0307406_10052605
401 Ga0307406_10274561
402 Ga0307407_10026529
403 Ga0307412_10031930
404 Ga0307409_100027569
405 Ga0307409_100065794
406 Ga0307409_100071928
407 Ga0307416_100071328
408 Ga0307416_100101855
409 Ga0307416_100629951
410 Ga0307416_100811562
411 Ga0307415_100003030
412 Ga0307415_100035805
413 Ga0307415_100075969
414 Ga0307415_100213960
415 Ga0307507_10009293
416 Ga0307507_10018332
417 Ga0307507_10167511
418 Ga0373950_0002420
419 Ga0373951_0002397
420 Ga0373941_0041490
421 Ga0373942_0005176
422 Ga0373935_0003221
423 Ga0451791_0020775
424 Ga0451793_1340510
425 Ga0495592_0000011
426 Ga0495592_0008305
427 Ga0495592_0060378
428 Ga0495603_0071534
429 Ga0495629_0000827
430 Ga0495629_0006409
431 Ga0495638_0025919
432 Ga0495651_0003289
433 Ga0495651_0003786
434 Ga0495651_0059969
435 Ga0495651_0227980
436 Ga0495653_0000345
437 Ga0495662_0000141
438 Ga0495662_0009221
439 Ga0495664_0000520
440 Ga0495664_0028553
441 Ga0495585_0115359
442 Ga0495608_0014558
443 Ga0495618_0016401
444 Ga0495618_0019935
445 Ga0495628_0000064
446 Ga0495628_0049710
447 Ga0495630_0000035
448 Ga0495630_0010829
449 Ga0495632_0068023
450 Ga0495666_0000539
451 Ga0495652_0000169
452 Ga0495652_0248072
453 Ga0495640_0002459
454 Ga0495586_0221830
455 Ga0495587_0000064
456 Ga0495587_0001922
457 Ga0495645_0000042
458 Ga0495634_0000148
459 Ga0495634_0003396
460 Ga0495634_0004398
461 Ga0495611_0166022
462 Ga0495635_0000032
463 Ga0495635_0002578
464 Ga0495635_0025113
465 Ga0495635_0053505
466 Ga0495657_0000075
467 Ga0495657_0002582
468 Ga0495657_0005794
469 Ga0495657_0104565
470 Ga0495599_0000044
471 Ga0495623_0001203
472 Ga0495646_0000028
473 Ga0495646_0003174
474 Ga0495613_0000586
475 Ga0495613_0002107
476 Ga0495613_0003748
477 Ga0495613_0012599
478 Ga0495600_0000044
479 Ga0495600_0000312
480 Ga0495600_0010284
481 Ga0495581_0002865
482 Ga0495581_0198512
483 Ga0495604_0000162
484 Ga0495604_0000545
485 Ga0495674_0000036
486 Ga0495674_0058174
487 Ga0495676_0005498
488 Ga0495676_0329481
489 Ga0495680_0004036
490 Ga0495687_018811
491 Ga0495675_0000126
492 Ga0495684_0000474
493 Ga0495684_0308896
494 Ga0495593_0002178
495 Ga0495593_0033724
496 Ga0495593_0129260
497 Ga0495602_0000078
498 Ga0495602_0221393
499 Ga0495614_0000643
500 Ga0496108_0000066
501 Ga0496109_0009474
502 Ga0496110_0081674
503 Ga0496112_0075063
504 Ga0496113_0007938
505 Ga0501033_0021664
506 Ga0501037_0173513
507 Ga0501047_0231361
508 nmdc:mga07m45_7981_c1
509 nmdc:mga05p37_1609_c1
510 nmdc:mga05p37_4990_c1
511 nmdc:mga05p37_56379_c1
512 nmdc:mga09592_3071_c1
513 nmdc:mga09592_32110_c1
514 nmdc:mga09592_34614_c1
515 nmdc:mga0qj67_2315_c1
516 nmdc:mga06r32_66647_c1
517 nmdc:mga06r32_7933_c1
518 nmdc:mga08y16_481615_c1
519 Ga0495601_0001449
520 Ga0495601_0041487
521 Ga0495619_0044242
522 Ga0500644_0077699
523 Ga0500646_0014868
524 Ga0500651_0088654
525 Ga0500640_026964
526 Ga0500650_0105160
527 Ga0500553_031205
528 Ga0500569_012170
529 Ga0500572_009340
530 Ga0500594_0020594
531 Ga0500616_0004455
532 Ga0500624_001909
533 2585306510
534 2616701075
535 2676486616
536 2734972028
537 2857293102
538 2862392773
539 2929222634
540 8008565137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

337

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.6678 39 288
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.6646 57 282
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.6569 39 290
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.6548 38 283
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.6516 39 285
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.681 56 288 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6766 41 283 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6766 56 293 1.10.3720.10
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6714 56 284 1.10.3720.10
3puzF04 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6623 76 286 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0F9HUF7-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8048 39 240 GO:0005886
GO:0055085
AF-A0A7U9X7I5-F1-model_v4 Lactose transport system permease protein LacF 0.8035 39 240 GO:0005886
GO:0055085
AF-A0A3N5VM33-F1-model_v4 Sugar ABC transporter permease 0.7901 38 230 GO:0005886
GO:0055085
AF-A0A4Q6F4J9-F1-model_v4 deleted 0.7886 39 248
AF-A0A4P5RY53-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.7818 39 236 GO:0005886
GO:0055085

Map