F376720

General Info

Members Datasets Scaffolds Average Seq Length
270 166 540 147

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10967940|Ga0070666_109679401
Length 171
Sequence MRRLDSPQPFLIASPPKDVERKRVMPNTIKIHRVLRAEPDKVYRAFLNPEAMAKWLPPNGFTGKVHQMDAKVGGGYRMSFTNFSNGQSHSFGGTYLELVPNERIRHTDKFDDPNMPGEMQVAITLKKVSCGTELNIVQEGVPDVIPPEMCYLGWQESLILLAKLVEAEIPD

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
149 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 3.33
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10967940 3300005335 Unclassified 631
2 JGI24751J29686_10082112 3300002459 Bacteria 668
3 Ga0065712_10012113 3300005290 Bacteria 1924
4 Ga0065712_10114004 3300005290 Bacteria 1773
5 Ga0065715_10017919 3300005293 Bacteria 2320
6 Ga0070676_10343681 3300005328 Bacteria 1024
7 Ga0070683_100008972 3300005329 Bacteria 8524
8 Ga0070690_100215170 3300005330 Bacteria 1344
9 Ga0070690_100281386 3300005330 Bacteria 1187
10 Ga0070690_100460867 3300005330 Bacteria 944
11 Ga0070670_100004471 3300005331 Bacteria 11710
12 Ga0070670_100005305 3300005331 Bacteria 10869
13 Ga0070670_100009823 3300005331 Bacteria 8175
14 Ga0070670_100034599 3300005331 Bacteria 4347
15 Ga0070670_100039951 3300005331 Bacteria 4035
16 Ga0070670_100456790 3300005331 Bacteria 1132
17 Ga0070670_100504621 3300005331 Bacteria 1076
18 Ga0070677_10713783 3300005333 Unclassified 566
19 Ga0070666_11017638 3300005335 Bacteria 615
20 Ga0070680_100512323 3300005336 Bacteria 1027
21 Ga0070660_101496823 3300005339 Bacteria 574
22 Ga0070689_100070692 3300005340 Bacteria 2725
23 Ga0070691_10708856 3300005341 Bacteria 605
24 Ga0070687_100259282 3300005343 Bacteria 1084
25 Ga0070661_101723215 3300005344 Bacteria 531
26 Ga0070692_11077700 3300005345 Bacteria 566
27 Ga0070668_100319528 3300005347 Bacteria 1307
28 Ga0070668_100420640 3300005347 Bacteria 1144
29 Ga0070668_101808610 3300005347 Bacteria 562
30 Ga0070669_100482437 3300005353 Bacteria 1026
31 Ga0070669_100595542 3300005353 Bacteria 926
32 Ga0070675_100006724 3300005354 Bacteria 8842
33 Ga0070675_100010548 3300005354 Bacteria 7220
34 Ga0070675_100053546 3300005354 Bacteria 3319
35 Ga0070671_100028209 3300005355 Bacteria 4622
36 Ga0070671_100154461 3300005355 Bacteria 1939
37 Ga0070671_100323194 3300005355 Bacteria 1315
38 Ga0070671_100673517 3300005355 Bacteria 896
39 Ga0070671_101527930 3300005355 Bacteria 591
40 Ga0070673_100444776 3300005364 Bacteria 1165
41 Ga0070688_100012322 3300005365 Bacteria 4788
42 Ga0070709_10829006 3300005434 Bacteria 727
43 Ga0070713_100276295 3300005436 Bacteria 1540
44 Ga0070713_100437539 3300005436 Bacteria 1226
45 Ga0070713_101007675 3300005436 Bacteria 803
46 Ga0070710_10639330 3300005437 Bacteria 745
47 Ga0070701_11239846 3300005438 Bacteria 531
48 Ga0070711_100228361 3300005439 Bacteria 1450
49 Ga0070700_101146027 3300005441 Bacteria 647
50 Ga0070663_101165984 3300005455 Bacteria 676
51 Ga0070662_100030341 3300005457 Bacteria 3782
52 Ga0070662_100793936 3300005457 Bacteria 805
53 Ga0070685_10748372 3300005466 Bacteria 716
54 Ga0070679_100770938 3300005530 Bacteria 905
55 Ga0070672_100047640 3300005543 Bacteria 3327
56 Ga0070672_100252796 3300005543 Bacteria 1484
57 Ga0070686_100546351 3300005544 Bacteria 905
58 Ga0070686_101817599 3300005544 Bacteria 519
59 Ga0070696_101330411 3300005546 Bacteria 611
60 Ga0070665_101231055 3300005548 Bacteria 759
61 Ga0070664_100044610 3300005564 Bacteria 3743
62 Ga0070664_101835087 3300005564 Bacteria 575
63 Ga0068857_100387317 3300005577 Bacteria 1299
64 Ga0068854_101681144 3300005578 Bacteria 580
65 Ga0068856_100047063 3300005614 Bacteria 4249
66 Ga0068859_100022100 3300005617 Bacteria 6377
67 Ga0068859_100243309 3300005617 Bacteria 1888
68 Ga0068864_100040403 3300005618 Bacteria 3991
69 Ga0068864_100045132 3300005618 Bacteria 3780
70 Ga0068864_100165234 3300005618 Bacteria 2014
71 Ga0068864_100169472 3300005618 Bacteria 1990
72 Ga0068864_100362755 3300005618 Bacteria 1369
73 Ga0068861_100290793 3300005719 Bacteria 1411
74 Ga0068863_100062069 3300005841 Bacteria 3534
75 Ga0068858_100193908 3300005842 Bacteria 1919
76 Ga0068858_101054980 3300005842 Bacteria 797
77 Ga0068860_100039385 3300005843 Bacteria 4520
78 Ga0068860_100772334 3300005843 Unclassified 973
79 Ga0068860_101583069 3300005843 Bacteria 677
80 Ga0068862_100001477 3300005844 Bacteria 21566
81 Ga0068862_100401716 3300005844 Bacteria 1282
82 Ga0068862_100489052 3300005844 Bacteria 1166
83 Ga0068862_101463874 3300005844 Bacteria 688
84 Ga0075364_10071919 3300006051 Bacteria 2279
85 Ga0070716_100078373 3300006173 Bacteria 1964
86 Ga0070712_100275055 3300006175 Bacteria 1354
87 Ga0097621_100358776 3300006237 Bacteria 1298
88 Ga0068871_100386602 3300006358 Bacteria 1244
89 Ga0068871_100514011 3300006358 Bacteria 1081
90 Ga0075428_100494090 3300006844 Bacteria 1309
91 Ga0075433_10382939 3300006852 Bacteria 1242
92 Ga0075434_100051531 3300006871 Bacteria 4091
93 Ga0075434_100672979 3300006871 Bacteria 1053
94 Ga0075429_100169013 3300006880 Unclassified 1915
95 Ga0075429_100828894 3300006880 Bacteria 810
96 Ga0068865_100500783 3300006881 Bacteria 1013
97 Ga0068865_100728185 3300006881 Bacteria 850
98 Ga0097620_100022099 3300006931 Bacteria 6377
99 Ga0097620_100243318 3300006931 Bacteria 1888
100 Ga0075435_100195418 3300007076 Bacteria 1713
101 Ga0105251_10253152 3300009011 Bacteria 794
102 Ga0111539_10000098 3300009094 Bacteria 91568
103 Ga0111539_10074793 3300009094 Bacteria 3992
104 Ga0111539_10494392 3300009094 Bacteria 1425
105 Ga0114129_10532068 3300009147 Bacteria 1531
106 Ga0105242_12091623 3300009176 Bacteria 610
107 Ga0105242_12800525 3300009176 Bacteria 538
108 Ga0105248_10583804 3300009177 Bacteria 1261
109 Ga0105248_11401508 3300009177 Bacteria 791
110 Ga0105238_11242812 3300009551 Bacteria 770
111 Ga0105249_10086394 3300009553 Bacteria 2925
112 Ga0105249_10645041 3300009553 Bacteria 1116
113 Ga0105249_11964534 3300009553 Bacteria 658
114 Ga0105239_10061642 3300010375 Bacteria 4116
115 Ga0157373_10792921 3300013100 Bacteria 698
116 Ga0157369_10100915 3300013105 Bacteria 3076
117 Ga0157378_10182913 3300013297 Bacteria 1973
118 Ga0157378_10505734 3300013297 Bacteria 1208
119 Ga0157378_11268139 3300013297 Bacteria 777
120 Ga0157375_10017493 3300013308 Bacteria 6471
121 Ga0157375_11633613 3300013308 Bacteria 762
122 Ga0163163_10027525 3300014325 Bacteria 5448
123 Ga0163163_10190061 3300014325 Bacteria 2102
124 Ga0157380_10553303 3300014326 Bacteria 1129
125 Ga0157380_11509846 3300014326 Bacteria 725
126 Ga0157379_10389315 3300014968 Bacteria 1280
127 Ga0157376_10035773 3300014969 Bacteria 4018
128 Ga0163161_10107514 3300017792 Bacteria 2082
129 Ga0207653_10278203 3300025885 Bacteria 646
130 Ga0207642_10099823 3300025899 Bacteria 1454
131 Ga0207688_10044934 3300025901 Bacteria 2463
132 Ga0207680_10592666 3300025903 Bacteria 793
133 Ga0207645_10299923 3300025907 Unclassified 1070
134 Ga0207645_10389855 3300025907 Bacteria 936
135 Ga0207643_10032078 3300025908 Bacteria 2932
136 Ga0207663_10333744 3300025916 Bacteria 1143
137 Ga0207662_10261165 3300025918 Bacteria 1140
138 Ga0207649_11431955 3300025920 Bacteria 547
139 Ga0207681_10029686 3300025923 Bacteria 3556
140 Ga0207681_10411503 3300025923 Bacteria 1094
141 Ga0207681_10673430 3300025923 Bacteria 859
142 Ga0207650_10040784 3300025925 Bacteria 3399
143 Ga0207650_10066729 3300025925 Bacteria 2699
144 Ga0207650_10166101 3300025925 Bacteria 1751
145 Ga0207650_10263517 3300025925 Bacteria 1398
146 Ga0207650_10654124 3300025925 Bacteria 886
147 Ga0207659_10003648 3300025926 Bacteria 9272
148 Ga0207644_10020046 3300025931 Bacteria 4543
149 Ga0207644_10081865 3300025931 Bacteria 2387
150 Ga0207644_10345084 3300025931 Bacteria 1208
151 Ga0207644_10463854 3300025931 Bacteria 1042
152 Ga0207706_10082542 3300025933 Bacteria 2825
153 Ga0207706_10443377 3300025933 Bacteria 1123
154 Ga0207706_10502853 3300025933 Bacteria 1046
155 Ga0207670_11158398 3300025936 Bacteria 654
156 Ga0207669_11004144 3300025937 Bacteria 701
157 Ga0207704_10053427 3300025938 Bacteria 2456
158 Ga0207665_10050500 3300025939 Bacteria 2797
159 Ga0207691_10000687 3300025940 Bacteria 33422
160 Ga0207711_10219623 3300025941 Bacteria 1738
161 Ga0207711_10758798 3300025941 Bacteria 904
162 Ga0207661_10017265 3300025944 Bacteria 5336
163 Ga0207679_10104609 3300025945 Bacteria 2221
164 Ga0207679_10319097 3300025945 Bacteria 1345
165 Ga0207679_11792591 3300025945 Bacteria 561
166 Ga0207651_10131327 3300025960 Bacteria 1918
167 Ga0207651_11308489 3300025960 Unclassified 652
168 Ga0207712_10317280 3300025961 Bacteria 1285
169 Ga0207712_10383458 3300025961 Bacteria 1177
170 Ga0207712_10565127 3300025961 Bacteria 980
171 Ga0207668_10026310 3300025972 Bacteria 3776
172 Ga0207668_10432775 3300025972 Bacteria 1119
173 Ga0207668_10975108 3300025972 Bacteria 757
174 Ga0207668_11741947 3300025972 Bacteria 562
175 Ga0207703_10303011 3300026035 Bacteria 1458
176 Ga0207639_11270937 3300026041 Bacteria 691
177 Ga0207708_10193915 3300026075 Bacteria 1618
178 Ga0207641_10024707 3300026088 Bacteria 4953
179 Ga0207676_10055105 3300026095 Bacteria 3119
180 Ga0207676_10125463 3300026095 Bacteria 2173
181 Ga0207676_10340005 3300026095 Bacteria 1384
182 Ga0207676_10478139 3300026095 Bacteria 1179
183 Ga0207675_100410461 3300026118 Bacteria 1336
184 Ga0207683_10257477 3300026121 Bacteria 1593
185 Ga0207683_10293864 3300026121 Bacteria 1486
186 Ga0207683_10460087 3300026121 Bacteria 1173
187 Ga0207428_10000432 3300027907 Bacteria 51578
188 Ga0268266_11004800 3300028379 Bacteria 807
189 Ga0268265_10008923 3300028380 Bacteria 6777
190 Ga0268265_10023155 3300028380 Bacteria 4375
191 Ga0268265_10480867 3300028380 Bacteria 1166
192 Ga0268265_10978556 3300028380 Bacteria 835
193 Ga0268265_11070946 3300028380 Bacteria 799
194 Ga0268264_10197949 3300028381 Bacteria 1836
195 Ga0268264_10582631 3300028381 Bacteria 1101
196 Ga0307408_100258088 3300031548 Bacteria 1441
197 Ga0307405_11286473 3300031731 Bacteria 636
198 Ga0307406_10061989 3300031901 Bacteria 2418
199 Ga0307416_100049116 3300032002 Bacteria 3353
200 Ga0307416_100892771 3300032002 Bacteria 988
201 Ga0307416_101904118 3300032002 Bacteria 698
202 Ga0373928_0107651 3300035084 Bacteria 734
203 Ga0373927_0000779 3300035695 Bacteria 24308
204 Ga0373937_0061907 3300036401 Bacteria 3440
205 Ga0373937_1970561 3300036401 Bacteria 530
206 Ga0373925_0011244 3300037068 Bacteria 6492
207 Ga0373925_0253391 3300037068 Bacteria 1412
208 Ga0395900_0478356 3300037418 Bacteria 1198
209 Ga0451793_0955175 3300041452 Bacteria 594
210 Ga0451797_0981168 3300041453 Bacteria 799
211 Ga0451798_0043095 3300041458 Bacteria 2317
212 Ga0451802_0299834 3300041460 Bacteria 4438
213 Ga0451802_1781243 3300041460 Bacteria 816
214 Ga0451843_0760415 3300041509 Bacteria 2225
215 Ga0451577_0002390 3300042876 Bacteria 22478
216 Ga0453683_0000304 3300044673 Bacteria 61772
217 Ga0453683_0037593 3300044673 Bacteria 3045
218 Ga0453683_1055004 3300044673 Bacteria 541
219 Ga0453684_0001702 3300044712 Bacteria 59234
220 Ga0453684_0002540 3300044712 Bacteria 43933
221 Ga0453684_0047114 3300044712 Bacteria 5721
222 Ga0451576_0000967 3300045051 Bacteria 53617
223 Ga0451576_0030857 3300045051 Bacteria 5718
224 Ga0451576_0109215 3300045051 Bacteria 2878
225 Ga0451576_0113829 3300045051 Bacteria 2816
226 Ga0466967_0115392 3300045976 Bacteria 2473
227 Ga0466967_0743919 3300045976 Bacteria 972
228 Ga0495618_0092745 3300046514 Bacteria 1931
229 Ga0495640_0681197 3300046533 Bacteria 618
230 Ga0495645_0018940 3300046543 Bacteria 4952
231 Ga0495633_0118334 3300046558 Bacteria 1227
232 Ga0495634_0079514 3300046642 Bacteria 2147
233 Ga0495659_0236583 3300046664 Bacteria 758
234 Ga0495657_0362585 3300046675 Bacteria 856
235 Ga0495646_0391784 3300046680 Bacteria 723
236 Ga0495613_0011445 3300046689 Bacteria 6596
237 Ga0495680_0133691 3300047322 Bacteria 1820
238 Ga0495675_0052974 3300047444 Bacteria 2576
239 Ga0495684_0053258 3300047471 Bacteria 3087
240 Ga0496100_0277641 3300048903 Bacteria 1248
241 Ga0496104_0711871 3300048907 Bacteria 912
242 Ga0496106_0193667 3300048909 Bacteria 1617
243 Ga0496108_1771586 3300048911 Bacteria 506
244 Ga0501297_021781 3300049520 Bacteria 806
245 Ga0501301_020971 3300049524 Bacteria 628
246 Ga0501034_0003541 3300049571 Bacteria 17738
247 Ga0501034_0026640 3300049571 Bacteria 5884
248 Ga0501043_0230338 3300049579 Bacteria 1431
249 Ga0501043_0531030 3300049579 Bacteria 876
250 Ga0501072_0001679 3300049588 Bacteria 16481
251 Ga0501074_0621561 3300049590 Bacteria 764
252 Ga0501074_0914732 3300049590 Bacteria 617
253 Ga0501249_074074 3300049679 Bacteria 797
254 Ga0501083_0919182 3300049744 Bacteria 569
255 Ga0501271_020709 3300049768 Bacteria 761
256 Ga0501044_0091938 3300049823 Bacteria 3060
257 nmdc:mga00v17_27130_c1 3300050491 Bacteria 3341
258 nmdc:mga0k408_908_c1 3300050493 Bacteria 16172
259 nmdc:mga09592_425360_c1 3300050508 Unclassified 1147
260 nmdc:mga08y16_1070561_c1 3300050511 Bacteria 783
261 nmdc:mga08y16_150856_c1 3300050511 Bacteria 2416
262 nmdc:mga08y16_1873033_c1 3300050511 Bacteria 551
263 nmdc:mga08y16_216_c1 3300050511 Bacteria 51710
264 nmdc:mga0n895_132585_c1 3300050512 Bacteria 2517
265 nmdc:mga0n895_36130_c1 3300050512 Bacteria 4770
266 nmdc:mga0rr50_19023_c1 3300050513 Bacteria 4626
267 nmdc:mga08x19_121775_c1 3300050514 Bacteria 1749
268 nmdc:mga0a205_32896_c1 3300050515 Bacteria 4972
269 nmdc:mga0a205_353621_c1 3300050515 Bacteria 1336
270 Ga0500568_0003691 3300053139 Bacteria 8402
271 Ga0070666_10967940
272 JGI24751J29686_10082112
273 Ga0065712_10012113
274 Ga0065712_10114004
275 Ga0065715_10017919
276 Ga0070676_10343681
277 Ga0070683_100008972
278 Ga0070690_100215170
279 Ga0070690_100281386
280 Ga0070690_100460867
281 Ga0070670_100004471
282 Ga0070670_100005305
283 Ga0070670_100009823
284 Ga0070670_100034599
285 Ga0070670_100039951
286 Ga0070670_100456790
287 Ga0070670_100504621
288 Ga0070677_10713783
289 Ga0070666_11017638
290 Ga0070680_100512323
291 Ga0070660_101496823
292 Ga0070689_100070692
293 Ga0070691_10708856
294 Ga0070687_100259282
295 Ga0070661_101723215
296 Ga0070692_11077700
297 Ga0070668_100319528
298 Ga0070668_100420640
299 Ga0070668_101808610
300 Ga0070669_100482437
301 Ga0070669_100595542
302 Ga0070675_100006724
303 Ga0070675_100010548
304 Ga0070675_100053546
305 Ga0070671_100028209
306 Ga0070671_100154461
307 Ga0070671_100323194
308 Ga0070671_100673517
309 Ga0070671_101527930
310 Ga0070673_100444776
311 Ga0070688_100012322
312 Ga0070709_10829006
313 Ga0070713_100276295
314 Ga0070713_100437539
315 Ga0070713_101007675
316 Ga0070710_10639330
317 Ga0070701_11239846
318 Ga0070711_100228361
319 Ga0070700_101146027
320 Ga0070663_101165984
321 Ga0070662_100030341
322 Ga0070662_100793936
323 Ga0070685_10748372
324 Ga0070679_100770938
325 Ga0070672_100047640
326 Ga0070672_100252796
327 Ga0070686_100546351
328 Ga0070686_101817599
329 Ga0070696_101330411
330 Ga0070665_101231055
331 Ga0070664_100044610
332 Ga0070664_101835087
333 Ga0068857_100387317
334 Ga0068854_101681144
335 Ga0068856_100047063
336 Ga0068859_100022100
337 Ga0068859_100243309
338 Ga0068864_100040403
339 Ga0068864_100045132
340 Ga0068864_100165234
341 Ga0068864_100169472
342 Ga0068864_100362755
343 Ga0068861_100290793
344 Ga0068863_100062069
345 Ga0068858_100193908
346 Ga0068858_101054980
347 Ga0068860_100039385
348 Ga0068860_100772334
349 Ga0068860_101583069
350 Ga0068862_100001477
351 Ga0068862_100401716
352 Ga0068862_100489052
353 Ga0068862_101463874
354 Ga0075364_10071919
355 Ga0070716_100078373
356 Ga0070712_100275055
357 Ga0097621_100358776
358 Ga0068871_100386602
359 Ga0068871_100514011
360 Ga0075428_100494090
361 Ga0075433_10382939
362 Ga0075434_100051531
363 Ga0075434_100672979
364 Ga0075429_100169013
365 Ga0075429_100828894
366 Ga0068865_100500783
367 Ga0068865_100728185
368 Ga0097620_100022099
369 Ga0097620_100243318
370 Ga0075435_100195418
371 Ga0105251_10253152
372 Ga0111539_10000098
373 Ga0111539_10074793
374 Ga0111539_10494392
375 Ga0114129_10532068
376 Ga0105242_12091623
377 Ga0105242_12800525
378 Ga0105248_10583804
379 Ga0105248_11401508
380 Ga0105238_11242812
381 Ga0105249_10086394
382 Ga0105249_10645041
383 Ga0105249_11964534
384 Ga0105239_10061642
385 Ga0157373_10792921
386 Ga0157369_10100915
387 Ga0157378_10182913
388 Ga0157378_10505734
389 Ga0157378_11268139
390 Ga0157375_10017493
391 Ga0157375_11633613
392 Ga0163163_10027525
393 Ga0163163_10190061
394 Ga0157380_10553303
395 Ga0157380_11509846
396 Ga0157379_10389315
397 Ga0157376_10035773
398 Ga0163161_10107514
399 Ga0207653_10278203
400 Ga0207642_10099823
401 Ga0207688_10044934
402 Ga0207680_10592666
403 Ga0207645_10299923
404 Ga0207645_10389855
405 Ga0207643_10032078
406 Ga0207663_10333744
407 Ga0207662_10261165
408 Ga0207649_11431955
409 Ga0207681_10029686
410 Ga0207681_10411503
411 Ga0207681_10673430
412 Ga0207650_10040784
413 Ga0207650_10066729
414 Ga0207650_10166101
415 Ga0207650_10263517
416 Ga0207650_10654124
417 Ga0207659_10003648
418 Ga0207644_10020046
419 Ga0207644_10081865
420 Ga0207644_10345084
421 Ga0207644_10463854
422 Ga0207706_10082542
423 Ga0207706_10443377
424 Ga0207706_10502853
425 Ga0207670_11158398
426 Ga0207669_11004144
427 Ga0207704_10053427
428 Ga0207665_10050500
429 Ga0207691_10000687
430 Ga0207711_10219623
431 Ga0207711_10758798
432 Ga0207661_10017265
433 Ga0207679_10104609
434 Ga0207679_10319097
435 Ga0207679_11792591
436 Ga0207651_10131327
437 Ga0207651_11308489
438 Ga0207712_10317280
439 Ga0207712_10383458
440 Ga0207712_10565127
441 Ga0207668_10026310
442 Ga0207668_10432775
443 Ga0207668_10975108
444 Ga0207668_11741947
445 Ga0207703_10303011
446 Ga0207639_11270937
447 Ga0207708_10193915
448 Ga0207641_10024707
449 Ga0207676_10055105
450 Ga0207676_10125463
451 Ga0207676_10340005
452 Ga0207676_10478139
453 Ga0207675_100410461
454 Ga0207683_10257477
455 Ga0207683_10293864
456 Ga0207683_10460087
457 Ga0207428_10000432
458 Ga0268266_11004800
459 Ga0268265_10008923
460 Ga0268265_10023155
461 Ga0268265_10480867
462 Ga0268265_10978556
463 Ga0268265_11070946
464 Ga0268264_10197949
465 Ga0268264_10582631
466 Ga0307408_100258088
467 Ga0307405_11286473
468 Ga0307406_10061989
469 Ga0307416_100049116
470 Ga0307416_100892771
471 Ga0307416_101904118
472 Ga0373928_0107651
473 Ga0373927_0000779
474 Ga0373937_0061907
475 Ga0373937_1970561
476 Ga0373925_0011244
477 Ga0373925_0253391
478 Ga0395900_0478356
479 Ga0451793_0955175
480 Ga0451797_0981168
481 Ga0451798_0043095
482 Ga0451802_0299834
483 Ga0451802_1781243
484 Ga0451843_0760415
485 Ga0451577_0002390
486 Ga0453683_0000304
487 Ga0453683_0037593
488 Ga0453683_1055004
489 Ga0453684_0001702
490 Ga0453684_0002540
491 Ga0453684_0047114
492 Ga0451576_0000967
493 Ga0451576_0030857
494 Ga0451576_0109215
495 Ga0451576_0113829
496 Ga0466967_0115392
497 Ga0466967_0743919
498 Ga0495618_0092745
499 Ga0495640_0681197
500 Ga0495645_0018940
501 Ga0495633_0118334
502 Ga0495634_0079514
503 Ga0495659_0236583
504 Ga0495657_0362585
505 Ga0495646_0391784
506 Ga0495613_0011445
507 Ga0495680_0133691
508 Ga0495675_0052974
509 Ga0495684_0053258
510 Ga0496100_0277641
511 Ga0496104_0711871
512 Ga0496106_0193667
513 Ga0496108_1771586
514 Ga0501297_021781
515 Ga0501301_020971
516 Ga0501034_0003541
517 Ga0501034_0026640
518 Ga0501043_0230338
519 Ga0501043_0531030
520 Ga0501072_0001679
521 Ga0501074_0621561
522 Ga0501074_0914732
523 Ga0501249_074074
524 Ga0501083_0919182
525 Ga0501271_020709
526 Ga0501044_0091938
527 nmdc:mga00v17_27130_c1
528 nmdc:mga0k408_908_c1
529 nmdc:mga09592_425360_c1
530 nmdc:mga08y16_1070561_c1
531 nmdc:mga08y16_150856_c1
532 nmdc:mga08y16_1873033_c1
533 nmdc:mga08y16_216_c1
534 nmdc:mga0n895_132585_c1
535 nmdc:mga0n895_36130_c1
536 nmdc:mga0rr50_19023_c1
537 nmdc:mga08x19_121775_c1
538 nmdc:mga0a205_32896_c1
539 nmdc:mga0a205_353621_c1
540 Ga0500568_0003691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

36

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9937 2 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9891 2 144
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9869 1 144
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9866 2 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9821 2 144
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9935 2 144 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9863 2 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8868 1 140 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8612 1 141 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8533 3 140 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0H3U7B5-F1-model_v4 N-acetyltransferase domain-containing protein 1.003 2 147 GO:0016747
AF-A0A2P5Z3C7-F1-model_v4 Polyketide cyclase 1 2 147
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 0.9999 3 147
AF-A0A143PEQ3-F1-model_v4 Activator of Hsp90 ATPase 0.9998 1 147
AF-A0A1C6NIL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9998 1 144

Map