F376564

General Info

Members Datasets Scaffolds Average Seq Length
269 153 538 206

Family's Representative Sequence

Representative Sequence 3300059655|Ga0587114_021026|Ga0587114_021026_95_835
Length 233
Sequence MLEQIIGFLEKKGRESPRAEATGRARMTPQAENATAPEPDQTVEKKIQQVRELYADAPELGRVALENGLSDLKRELAAATRTHSAGRIGARQGRVSELTLILPFADGGAERLRGLLQLLEGNFQGADRVGTVHDMRFVFLDNDTRMLFATAYDGDWDAYIDDFATKIPDFLDIIDSAWEGWPGIRSPQAKDYLAQHQITAEGWYVANDLTVAETRRLRRLGTAVDEFLDKVGD

Samples

Sample ID Description Type Environment
1 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.12
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.37
Rhizoplane 3.72
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587114_021026 3300059655 Bacteria 920
2 Ga0070676_10010747 3300005328 Bacteria 4967
3 Ga0070676_10172407 3300005328 Bacteria 1400
4 Ga0070676_10210176 3300005328 Bacteria 1280
5 Ga0070683_100244411 3300005329 Bacteria 1707
6 Ga0068869_100124329 3300005334 Bacteria 1977
7 Ga0070682_100032740 3300005337 Bacteria 3154
8 Ga0068868_100084476 3300005338 Bacteria 2550
9 Ga0070689_100164344 3300005340 Bacteria 1796
10 Ga0070689_100388361 3300005340 Bacteria 1178
11 Ga0070689_100828954 3300005340 Bacteria 815
12 Ga0070692_10078079 3300005345 Bacteria 1777
13 Ga0070668_100023557 3300005347 Bacteria 4657
14 Ga0070669_100002924 3300005353 Bacteria 12303
15 Ga0070669_100159532 3300005353 Bacteria 1752
16 Ga0070675_100014923 3300005354 Bacteria 6135
17 Ga0070675_100569377 3300005354 Bacteria 1026
18 Ga0070675_101112173 3300005354 Bacteria 727
19 Ga0070671_100055197 3300005355 Bacteria 3305
20 Ga0070671_100098864 3300005355 Bacteria 2448
21 Ga0070659_100673843 3300005366 Bacteria 893
22 Ga0070667_100024110 3300005367 Bacteria 5052
23 Ga0070703_10093018 3300005406 Bacteria 1049
24 Ga0070705_100011792 3300005440 Bacteria 4423
25 Ga0070700_100636195 3300005441 Bacteria 841
26 Ga0070694_100049740 3300005444 Bacteria 2823
27 Ga0070663_100053007 3300005455 Bacteria 2895
28 Ga0070678_100305683 3300005456 Bacteria 1353
29 Ga0068867_100315813 3300005459 Bacteria 1293
30 Ga0068867_100622530 3300005459 Bacteria 944
31 Ga0068867_100812169 3300005459 Bacteria 835
32 Ga0070685_10890558 3300005466 Unclassified 662
33 Ga0070706_100698904 3300005467 Bacteria 940
34 Ga0070707_100289860 3300005468 Bacteria 1590
35 Ga0070698_100088422 3300005471 Bacteria 3083
36 Ga0070698_100146058 3300005471 Bacteria 2314
37 Ga0070699_100001714 3300005518 Bacteria 19979
38 Ga0070699_100408951 3300005518 Bacteria 1227
39 Ga0070699_100487383 3300005518 Bacteria 1119
40 Ga0070684_100233490 3300005535 Bacteria 1680
41 Ga0070684_100260874 3300005535 Bacteria 1585
42 Ga0070684_100332168 3300005535 Bacteria 1397
43 Ga0070697_100025899 3300005536 Bacteria 4678
44 Ga0070672_100019697 3300005543 Bacteria 4903
45 Ga0070672_100473770 3300005543 Bacteria 1081
46 Ga0070686_100346450 3300005544 Bacteria 1115
47 Ga0070695_100013658 3300005545 Bacteria 4881
48 Ga0070695_100016579 3300005545 Bacteria 4461
49 Ga0070695_100064652 3300005545 Bacteria 2380
50 Ga0070696_100006236 3300005546 Bacteria 7979
51 Ga0070696_100132751 3300005546 Bacteria 1813
52 Ga0070696_100832209 3300005546 Bacteria 761
53 Ga0070665_100121043 3300005548 Bacteria 2618
54 Ga0070704_100158354 3300005549 Bacteria 1788
55 Ga0070704_100252720 3300005549 Bacteria 1448
56 Ga0070704_100285781 3300005549 Bacteria 1369
57 Ga0070704_100834079 3300005549 Unclassified 826
58 Ga0068855_100567356 3300005563 Bacteria 1227
59 Ga0070664_100021170 3300005564 Bacteria 5356
60 Ga0070664_100040720 3300005564 Bacteria 3918
61 Ga0070664_100426659 3300005564 Bacteria 1215
62 Ga0070664_100767198 3300005564 Bacteria 901
63 Ga0068856_100655913 3300005614 Bacteria 1070
64 Ga0068852_100072817 3300005616 Bacteria 3021
65 Ga0068859_100182984 3300005617 Bacteria 2179
66 Ga0068859_100663365 3300005617 Bacteria 1135
67 Ga0068859_101018633 3300005617 Unclassified 910
68 Ga0068866_10601806 3300005718 Bacteria 742
69 Ga0068861_100082888 3300005719 Bacteria 2514
70 Ga0068861_100116595 3300005719 Bacteria 2148
71 Ga0068870_10180408 3300005840 Bacteria 1267
72 Ga0068863_100029767 3300005841 Bacteria 5214
73 Ga0068863_100479763 3300005841 Bacteria 1223
74 Ga0068858_100287408 3300005842 Bacteria 1567
75 Ga0068858_100341081 3300005842 Bacteria 1434
76 Ga0068860_100008792 3300005843 Bacteria 10063
77 Ga0068860_101244892 3300005843 Unclassified 765
78 Ga0068862_100070635 3300005844 Bacteria 3014
79 Ga0068862_100286732 3300005844 Bacteria 1511
80 Ga0068862_100735417 3300005844 Bacteria 958
81 Ga0068862_101154160 3300005844 Bacteria 772
82 Ga0081455_10002062 3300005937 Bacteria 24040
83 Ga0070712_100282391 3300006175 Bacteria 1337
84 Ga0068871_100295018 3300006358 Bacteria 1422
85 Ga0075428_100073281 3300006844 Bacteria 3740
86 Ga0075428_100096993 3300006844 Bacteria 3214
87 Ga0075428_100190276 3300006844 Bacteria 2220
88 Ga0075433_10000767 3300006852 Bacteria 22077
89 Ga0075433_10057210 3300006852 Bacteria 3408
90 Ga0075434_100000933 3300006871 Bacteria 23472
91 Ga0075434_100060998 3300006871 Bacteria 3751
92 Ga0075434_100242265 3300006871 Bacteria 1823
93 Ga0075429_100354038 3300006880 Bacteria 1285
94 Ga0075429_100494469 3300006880 Bacteria 1072
95 Ga0068865_100235084 3300006881 Bacteria 1440
96 Ga0075436_100290810 3300006914 Bacteria 1169
97 Ga0097620_100182970 3300006931 Bacteria 2179
98 Ga0097620_100663329 3300006931 Bacteria 1135
99 Ga0097620_101018609 3300006931 Unclassified 910
100 Ga0075435_100013494 3300007076 Bacteria 6079
101 Ga0075435_100025975 3300007076 Bacteria 4565
102 Ga0075435_100060107 3300007076 Bacteria 3081
103 Ga0111539_10040991 3300009094 Bacteria 5570
104 Ga0105245_10033840 3300009098 Bacteria 4529
105 Ga0105247_10092358 3300009101 Bacteria 1923
106 Ga0105247_10272948 3300009101 Bacteria 1164
107 Ga0114129_10000369 3300009147 Bacteria 52251
108 Ga0114129_10035231 3300009147 Bacteria 7071
109 Ga0114129_10294777 3300009147 Bacteria 2164
110 Ga0114129_10330860 3300009147 Bacteria 2023
111 Ga0114129_10364188 3300009147 Bacteria 1912
112 Ga0105243_10233216 3300009148 Bacteria 1634
113 Ga0105241_10518098 3300009174 Bacteria 1066
114 Ga0105248_10012663 3300009177 Bacteria 9308
115 Ga0105237_10319790 3300009545 Bacteria 1555
116 Ga0105249_10042707 3300009553 Bacteria 4124
117 Ga0105249_10075411 3300009553 Bacteria 3124
118 Ga0105249_11273623 3300009553 Bacteria 807
119 Ga0105239_10019503 3300010375 Bacteria 7485
120 Ga0105239_10190912 3300010375 Bacteria 2293
121 Ga0157371_10222624 3300013102 Bacteria 1355
122 Ga0157371_10243725 3300013102 Bacteria 1293
123 Ga0157374_10187626 3300013296 Bacteria 2022
124 Ga0157374_10353205 3300013296 Bacteria 1461
125 Ga0157374_10709568 3300013296 Bacteria 1019
126 Ga0157378_10005460 3300013297 Bacteria 11136
127 Ga0157378_10194322 3300013297 Bacteria 1916
128 Ga0163162_10069192 3300013306 Bacteria 3582
129 Ga0157372_11128833 3300013307 Bacteria 907
130 Ga0157375_10019456 3300013308 Bacteria 6175
131 Ga0157375_10130980 3300013308 Bacteria 2627
132 Ga0157375_12086781 3300013308 Bacteria 674
133 Ga0163163_10106748 3300014325 Bacteria 2826
134 Ga0157380_10025992 3300014326 Bacteria 4443
135 Ga0157380_10146019 3300014326 Bacteria 2039
136 Ga0157377_10331926 3300014745 Bacteria 1014
137 Ga0163161_10813424 3300017792 Bacteria 786
138 Ga0213876_10000262 3300021384 Bacteria 48652
139 Ga0213876_10036797 3300021384 Bacteria 2582
140 Ga0207697_10108191 3300025315 Bacteria 1189
141 Ga0207653_10020272 3300025885 Bacteria 2103
142 Ga0207653_10195019 3300025885 Bacteria 762
143 Ga0207710_10061892 3300025900 Bacteria 1699
144 Ga0207680_10012608 3300025903 Bacteria 4311
145 Ga0207645_10013851 3300025907 Bacteria 5411
146 Ga0207645_10154303 3300025907 Bacteria 1500
147 Ga0207643_10551972 3300025908 Bacteria 739
148 Ga0207705_10535216 3300025909 Bacteria 911
149 Ga0207662_10426559 3300025918 Bacteria 903
150 Ga0207649_10129970 3300025920 Bacteria 1709
151 Ga0207646_10083801 3300025922 Bacteria 2852
152 Ga0207646_10286354 3300025922 Bacteria 1489
153 Ga0207681_10009508 3300025923 Bacteria 5941
154 Ga0207681_10022853 3300025923 Bacteria 3993
155 Ga0207659_10015695 3300025926 Bacteria 4916
156 Ga0207687_10135546 3300025927 Bacteria 1862
157 Ga0207644_10006573 3300025931 Bacteria 7575
158 Ga0207644_10048628 3300025931 Bacteria 3034
159 Ga0207644_10086370 3300025931 Bacteria 2329
160 Ga0207690_10109608 3300025932 Bacteria 1986
161 Ga0207690_10166071 3300025932 Bacteria 1650
162 Ga0207709_10137615 3300025935 Bacteria 1674
163 Ga0207709_10405818 3300025935 Bacteria 1043
164 Ga0207670_10268217 3300025936 Bacteria 1326
165 Ga0207670_10359872 3300025936 Bacteria 1154
166 Ga0207704_10527314 3300025938 Bacteria 956
167 Ga0207704_10956770 3300025938 Bacteria 722
168 Ga0207665_10080311 3300025939 Bacteria 2243
169 Ga0207691_10016458 3300025940 Bacteria 7020
170 Ga0207691_10373544 3300025940 Bacteria 1218
171 Ga0207711_10002880 3300025941 Bacteria 15072
172 Ga0207711_10083828 3300025941 Bacteria 2789
173 Ga0207689_10012685 3300025942 Bacteria 7198
174 Ga0207689_10687343 3300025942 Unclassified 863
175 Ga0207689_10830858 3300025942 Unclassified 780
176 Ga0207679_10061430 3300025945 Bacteria 2797
177 Ga0207679_10320874 3300025945 Bacteria 1341
178 Ga0207679_10356301 3300025945 Bacteria 1277
179 Ga0207679_11009871 3300025945 Bacteria 762
180 Ga0207712_11152588 3300025961 Bacteria 691
181 Ga0207668_10009051 3300025972 Bacteria 5951
182 Ga0207640_10739263 3300025981 Bacteria 847
183 Ga0207658_10010798 3300025986 Bacteria 6214
184 Ga0207658_10458426 3300025986 Bacteria 1130
185 Ga0207677_10102739 3300026023 Bacteria 2108
186 Ga0207703_10047142 3300026035 Bacteria 3474
187 Ga0207678_10124796 3300026067 Bacteria 2197
188 Ga0207702_10327133 3300026078 Bacteria 1461
189 Ga0207641_10005407 3300026088 Bacteria 10907
190 Ga0207641_10444209 3300026088 Bacteria 1252
191 Ga0207641_10686017 3300026088 Bacteria 1008
192 Ga0207648_10157223 3300026089 Bacteria 2007
193 Ga0207648_10224367 3300026089 Bacteria 1671
194 Ga0207675_100010747 3300026118 Bacteria 8577
195 Ga0207683_10121369 3300026121 Bacteria 2346
196 Ga0207683_10501986 3300026121 Bacteria 1120
197 Ga0207698_10141338 3300026142 Bacteria 2075
198 Ga0209970_1037805 3300027614 Bacteria 853
199 Ga0268266_10597926 3300028379 Bacteria 1059
200 Ga0268266_10682324 3300028379 Bacteria 990
201 Ga0268265_10180065 3300028380 Bacteria 1815
202 Ga0268265_10198855 3300028380 Bacteria 1737
203 Ga0268265_10313474 3300028380 Bacteria 1417
204 Ga0268264_10040308 3300028381 Bacteria 3859
205 Ga0268264_10140824 3300028381 Bacteria 2151
206 Ga0395899_0016282 3300037312 Bacteria 5668
207 Ga0395900_0075111 3300037418 Bacteria 3474
208 Ga0395905_0002674 3300037471 Bacteria 19542
209 Ga0395905_0029170 3300037471 Bacteria 5200
210 Ga0395905_0205736 3300037471 Bacteria 1845
211 Ga0395905_0227416 3300037471 Bacteria 1745
212 Ga0395901_0003058 3300038443 Bacteria 16851
213 Ga0436365_1120687 3300039437 Bacteria 61803
214 Ga0436365_1791612 3300039437 Bacteria 9078
215 Ga0439435_0053533 3300042436 Bacteria 1161
216 Ga0439459_0080897 3300042438 Bacteria 767
217 Ga0439464_0027144 3300042439 Bacteria 1591
218 Ga0439460_0105876 3300042461 Bacteria 908
219 Ga0466961_0738077 3300044693 Bacteria 589
220 Ga0451576_0886630 3300045051 Bacteria 936
221 Ga0495590_0000406 3300046457 Bacteria 21724
222 Ga0495632_0027278 3300046519 Bacteria 2993
223 Ga0495668_0218737 3300046616 Bacteria 1043
224 Ga0495625_0018794 3300046660 Bacteria 5383
225 Ga0495672_0009639 3300047320 Bacteria 6969
226 Ga0495672_0076475 3300047320 Bacteria 1880
227 Ga0496102_0197561 3300048905 Bacteria 1896
228 Ga0496103_0288879 3300048906 Bacteria 1055
229 Ga0496106_0547976 3300048909 Bacteria 928
230 Ga0496108_0073906 3300048911 Bacteria 2878
231 Ga0496108_0739703 3300048911 Bacteria 851
232 Ga0496109_0174028 3300048912 Bacteria 2020
233 Ga0496109_0513201 3300048912 Bacteria 1131
234 Ga0496110_0033111 3300048913 Bacteria 4469
235 Ga0496110_0428687 3300048913 Bacteria 1206
236 Ga0496113_0550829 3300048916 Bacteria 925
237 Ga0496121_0009799 3300048924 Bacteria 10943
238 Ga0496126_0012510 3300048929 Bacteria 8688
239 nmdc:mga05p37_107580_c1 3300050507 Bacteria 3431
240 nmdc:mga05p37_151395_c1 3300050507 Bacteria 2837
241 nmdc:mga05p37_178466_c1 3300050507 Bacteria 2586
242 nmdc:mga05p37_184971_c1 3300050507 Bacteria 2533
243 nmdc:mga05p37_210980_c1 3300050507 Bacteria 2348
244 nmdc:mga05p37_47597_c1 3300050507 Bacteria 5273
245 nmdc:mga05p37_62_c1 3300050507 Bacteria 94760
246 nmdc:mga05p37_763296_c1 3300050507 Bacteria 1064
247 nmdc:mga05p37_803512_c1 3300050507 Unclassified 1029
248 nmdc:mga09592_153447_c1 3300050508 Bacteria 1987
249 nmdc:mga09592_521375_c1 3300050508 Bacteria 1022
250 nmdc:mga06r32_561905_c1 3300050510 Bacteria 1114
251 nmdc:mga08y16_153063_c1 3300050511 Bacteria 2397
252 nmdc:mga0n895_107877_c1 3300050512 Bacteria 2799
253 nmdc:mga0n895_240524_c1 3300050512 Archaea 1837
254 nmdc:mga0n895_294093_c1 3300050512 Bacteria 1647
255 nmdc:mga0n895_63555_c1 3300050512 Bacteria 3650
256 nmdc:mga0n895_690_c1 3300050512 Bacteria 23678
257 nmdc:mga0rr50_349668_c1 3300050513 Bacteria 1243
258 nmdc:mga0rr50_79639_c1 3300050513 Bacteria 2524
259 nmdc:mga0a205_128774_c1 3300050515 Bacteria 2432
260 nmdc:mga0a205_132888_c1 3300050515 Bacteria 2389
261 nmdc:mga0a205_169_c1 3300050515 Bacteria 43832
262 nmdc:mga0a205_259970_c1 3300050515 Bacteria 1614
263 nmdc:mga0a205_33332_c1 3300050515 Bacteria 4938
264 nmdc:mga0a205_523572_c1 3300050515 Bacteria 1042
265 nmdc:mga0a205_69906_c1 3300050515 Bacteria 3390
266 nmdc:mga0a205_71816_c1 3300050515 Bacteria 3343
267 Ga0587079_002325 3300059647 Bacteria 2308
268 Ga0587071_015240 3300060344 Bacteria 1345
269 2935923718 2935916978 Bacteria 9113783
270 Ga0587114_021026
271 Ga0070676_10010747
272 Ga0070676_10172407
273 Ga0070676_10210176
274 Ga0070683_100244411
275 Ga0068869_100124329
276 Ga0070682_100032740
277 Ga0068868_100084476
278 Ga0070689_100164344
279 Ga0070689_100388361
280 Ga0070689_100828954
281 Ga0070692_10078079
282 Ga0070668_100023557
283 Ga0070669_100002924
284 Ga0070669_100159532
285 Ga0070675_100014923
286 Ga0070675_100569377
287 Ga0070675_101112173
288 Ga0070671_100055197
289 Ga0070671_100098864
290 Ga0070659_100673843
291 Ga0070667_100024110
292 Ga0070703_10093018
293 Ga0070705_100011792
294 Ga0070700_100636195
295 Ga0070694_100049740
296 Ga0070663_100053007
297 Ga0070678_100305683
298 Ga0068867_100315813
299 Ga0068867_100622530
300 Ga0068867_100812169
301 Ga0070685_10890558
302 Ga0070706_100698904
303 Ga0070707_100289860
304 Ga0070698_100088422
305 Ga0070698_100146058
306 Ga0070699_100001714
307 Ga0070699_100408951
308 Ga0070699_100487383
309 Ga0070684_100233490
310 Ga0070684_100260874
311 Ga0070684_100332168
312 Ga0070697_100025899
313 Ga0070672_100019697
314 Ga0070672_100473770
315 Ga0070686_100346450
316 Ga0070695_100013658
317 Ga0070695_100016579
318 Ga0070695_100064652
319 Ga0070696_100006236
320 Ga0070696_100132751
321 Ga0070696_100832209
322 Ga0070665_100121043
323 Ga0070704_100158354
324 Ga0070704_100252720
325 Ga0070704_100285781
326 Ga0070704_100834079
327 Ga0068855_100567356
328 Ga0070664_100021170
329 Ga0070664_100040720
330 Ga0070664_100426659
331 Ga0070664_100767198
332 Ga0068856_100655913
333 Ga0068852_100072817
334 Ga0068859_100182984
335 Ga0068859_100663365
336 Ga0068859_101018633
337 Ga0068866_10601806
338 Ga0068861_100082888
339 Ga0068861_100116595
340 Ga0068870_10180408
341 Ga0068863_100029767
342 Ga0068863_100479763
343 Ga0068858_100287408
344 Ga0068858_100341081
345 Ga0068860_100008792
346 Ga0068860_101244892
347 Ga0068862_100070635
348 Ga0068862_100286732
349 Ga0068862_100735417
350 Ga0068862_101154160
351 Ga0081455_10002062
352 Ga0070712_100282391
353 Ga0068871_100295018
354 Ga0075428_100073281
355 Ga0075428_100096993
356 Ga0075428_100190276
357 Ga0075433_10000767
358 Ga0075433_10057210
359 Ga0075434_100000933
360 Ga0075434_100060998
361 Ga0075434_100242265
362 Ga0075429_100354038
363 Ga0075429_100494469
364 Ga0068865_100235084
365 Ga0075436_100290810
366 Ga0097620_100182970
367 Ga0097620_100663329
368 Ga0097620_101018609
369 Ga0075435_100013494
370 Ga0075435_100025975
371 Ga0075435_100060107
372 Ga0111539_10040991
373 Ga0105245_10033840
374 Ga0105247_10092358
375 Ga0105247_10272948
376 Ga0114129_10000369
377 Ga0114129_10035231
378 Ga0114129_10294777
379 Ga0114129_10330860
380 Ga0114129_10364188
381 Ga0105243_10233216
382 Ga0105241_10518098
383 Ga0105248_10012663
384 Ga0105237_10319790
385 Ga0105249_10042707
386 Ga0105249_10075411
387 Ga0105249_11273623
388 Ga0105239_10019503
389 Ga0105239_10190912
390 Ga0157371_10222624
391 Ga0157371_10243725
392 Ga0157374_10187626
393 Ga0157374_10353205
394 Ga0157374_10709568
395 Ga0157378_10005460
396 Ga0157378_10194322
397 Ga0163162_10069192
398 Ga0157372_11128833
399 Ga0157375_10019456
400 Ga0157375_10130980
401 Ga0157375_12086781
402 Ga0163163_10106748
403 Ga0157380_10025992
404 Ga0157380_10146019
405 Ga0157377_10331926
406 Ga0163161_10813424
407 Ga0213876_10000262
408 Ga0213876_10036797
409 Ga0207697_10108191
410 Ga0207653_10020272
411 Ga0207653_10195019
412 Ga0207710_10061892
413 Ga0207680_10012608
414 Ga0207645_10013851
415 Ga0207645_10154303
416 Ga0207643_10551972
417 Ga0207705_10535216
418 Ga0207662_10426559
419 Ga0207649_10129970
420 Ga0207646_10083801
421 Ga0207646_10286354
422 Ga0207681_10009508
423 Ga0207681_10022853
424 Ga0207659_10015695
425 Ga0207687_10135546
426 Ga0207644_10006573
427 Ga0207644_10048628
428 Ga0207644_10086370
429 Ga0207690_10109608
430 Ga0207690_10166071
431 Ga0207709_10137615
432 Ga0207709_10405818
433 Ga0207670_10268217
434 Ga0207670_10359872
435 Ga0207704_10527314
436 Ga0207704_10956770
437 Ga0207665_10080311
438 Ga0207691_10016458
439 Ga0207691_10373544
440 Ga0207711_10002880
441 Ga0207711_10083828
442 Ga0207689_10012685
443 Ga0207689_10687343
444 Ga0207689_10830858
445 Ga0207679_10061430
446 Ga0207679_10320874
447 Ga0207679_10356301
448 Ga0207679_11009871
449 Ga0207712_11152588
450 Ga0207668_10009051
451 Ga0207640_10739263
452 Ga0207658_10010798
453 Ga0207658_10458426
454 Ga0207677_10102739
455 Ga0207703_10047142
456 Ga0207678_10124796
457 Ga0207702_10327133
458 Ga0207641_10005407
459 Ga0207641_10444209
460 Ga0207641_10686017
461 Ga0207648_10157223
462 Ga0207648_10224367
463 Ga0207675_100010747
464 Ga0207683_10121369
465 Ga0207683_10501986
466 Ga0207698_10141338
467 Ga0209970_1037805
468 Ga0268266_10597926
469 Ga0268266_10682324
470 Ga0268265_10180065
471 Ga0268265_10198855
472 Ga0268265_10313474
473 Ga0268264_10040308
474 Ga0268264_10140824
475 Ga0395899_0016282
476 Ga0395900_0075111
477 Ga0395905_0002674
478 Ga0395905_0029170
479 Ga0395905_0205736
480 Ga0395905_0227416
481 Ga0395901_0003058
482 Ga0436365_1120687
483 Ga0436365_1791612
484 Ga0439435_0053533
485 Ga0439459_0080897
486 Ga0439464_0027144
487 Ga0439460_0105876
488 Ga0466961_0738077
489 Ga0451576_0886630
490 Ga0495590_0000406
491 Ga0495632_0027278
492 Ga0495668_0218737
493 Ga0495625_0018794
494 Ga0495672_0009639
495 Ga0495672_0076475
496 Ga0496102_0197561
497 Ga0496103_0288879
498 Ga0496106_0547976
499 Ga0496108_0073906
500 Ga0496108_0739703
501 Ga0496109_0174028
502 Ga0496109_0513201
503 Ga0496110_0033111
504 Ga0496110_0428687
505 Ga0496113_0550829
506 Ga0496121_0009799
507 Ga0496126_0012510
508 nmdc:mga05p37_107580_c1
509 nmdc:mga05p37_151395_c1
510 nmdc:mga05p37_178466_c1
511 nmdc:mga05p37_184971_c1
512 nmdc:mga05p37_210980_c1
513 nmdc:mga05p37_47597_c1
514 nmdc:mga05p37_62_c1
515 nmdc:mga05p37_763296_c1
516 nmdc:mga05p37_803512_c1
517 nmdc:mga09592_153447_c1
518 nmdc:mga09592_521375_c1
519 nmdc:mga06r32_561905_c1
520 nmdc:mga08y16_153063_c1
521 nmdc:mga0n895_107877_c1
522 nmdc:mga0n895_240524_c1
523 nmdc:mga0n895_294093_c1
524 nmdc:mga0n895_63555_c1
525 nmdc:mga0n895_690_c1
526 nmdc:mga0rr50_349668_c1
527 nmdc:mga0rr50_79639_c1
528 nmdc:mga0a205_128774_c1
529 nmdc:mga0a205_132888_c1
530 nmdc:mga0a205_169_c1
531 nmdc:mga0a205_259970_c1
532 nmdc:mga0a205_33332_c1
533 nmdc:mga0a205_523572_c1
534 nmdc:mga0a205_69906_c1
535 nmdc:mga0a205_71816_c1
536 Ga0587079_002325
537 Ga0587071_015240
538 2935923718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.6653 69 150
1vqy-assembly1.cif.gz_B crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution 0.6331 68 157
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.6259 71 159
5b0b-assembly2.cif.gz_D polyketide cyclase oac from cannabis sativa, i7f mutant 0.6257 71 156
4dn9-assembly1.cif.gz_A crystal structure of putative antibiotic biosynthesis monooxygenase from chloroflexus aurantiacus j-10-fl 0.625 71 156
ID Description Score Start End Superfamily
af_P78833_2_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6367 72 156 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6257 71 156 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.616 71 157 3.30.70.100
af_Q9HDU7_108_202_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5979 73 150 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.595 73 141 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1I7LJV4-F1-model_v4 Uncharacterized protein 0.799 70 185 GO:0016020
AF-A0A534H9B0-F1-model_v4 Uncharacterized protein 0.7733 78 210
AF-A0A2U0YIY1-F1-model_v4 deleted 0.7667 72 188
AF-A0A530MHN4-F1-model_v4 Uncharacterized protein 0.7638 71 182
AF-A0A257KZR7-F1-model_v4 Uncharacterized protein 0.7584 72 192 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Map