F376288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 176 | 269 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10096598|Ga0265338_100965983 |
| Length | 270 |
| Sequence | VDKSSFGGVFVALGGILLGLVLEGGKIGQILQPTAALIVFGGTLGAVMLQFPLPIMLEAFGSLARVFFETGEDPRLVLKEMIGYAQKARKSGIVSLDDDLEEIEEPFLKKTLMLAVDGTEPAELRSIMQLELDNRADHDDNIPRVFESAGGFSPTIGIIGAVLGLIQVMQHLDNIGEVGRGIAVAFVATIYGVGAANLFFLPASGKLKLRYREEQLRHEIILEGVVSILEGMNPRMLETKLLSFISERQQKAEQKAGKSEQKEATRAFQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 55 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 56 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 57 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 110 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 111 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 175 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 176 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 0 |
| Rhizoplane | 7.43 |
| Rhizosphere | 91.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10011223 | 3300003316 | Bacteria | 3381 |
| 2 | Ga0070658_10160078 | 3300005327 | Bacteria | 1888 |
| 3 | Ga0070658_10162803 | 3300005327 | Bacteria | 1872 |
| 4 | Ga0070670_100329304 | 3300005331 | Bacteria | 1339 |
| 5 | Ga0070670_100752654 | 3300005331 | Bacteria | 878 |
| 6 | Ga0070680_100090186 | 3300005336 | Bacteria | 2537 |
| 7 | Ga0070680_100100105 | 3300005336 | Bacteria | 2405 |
| 8 | Ga0070680_100150720 | 3300005336 | Bacteria | 1952 |
| 9 | Ga0068868_100052795 | 3300005338 | Bacteria | 3200 |
| 10 | Ga0070660_100042996 | 3300005339 | Bacteria | 3451 |
| 11 | Ga0070660_100148414 | 3300005339 | Bacteria | 1884 |
| 12 | Ga0070661_100023683 | 3300005344 | Bacteria | 4403 |
| 13 | Ga0070671_100001640 | 3300005355 | Bacteria | 16908 |
| 14 | Ga0070667_100075748 | 3300005367 | Bacteria | 2873 |
| 15 | Ga0070714_100151412 | 3300005435 | Bacteria | 2091 |
| 16 | Ga0070713_100112328 | 3300005436 | Bacteria | 2377 |
| 17 | Ga0070713_100197302 | 3300005436 | Bacteria | 1816 |
| 18 | Ga0070678_100333394 | 3300005456 | Bacteria | 1299 |
| 19 | Ga0070662_100031409 | 3300005457 | Bacteria | 3727 |
| 20 | Ga0070681_10043221 | 3300005458 | Bacteria | 4514 |
| 21 | Ga0070681_10254226 | 3300005458 | Bacteria | 1669 |
| 22 | Ga0068867_100148817 | 3300005459 | Bacteria | 1837 |
| 23 | Ga0070679_100006946 | 3300005530 | Bacteria | 10559 |
| 24 | Ga0070679_100165465 | 3300005530 | Bacteria | 2185 |
| 25 | Ga0068853_100215271 | 3300005539 | Bacteria | 1752 |
| 26 | Ga0070665_100012812 | 3300005548 | Bacteria | 8443 |
| 27 | Ga0070665_100035113 | 3300005548 | Bacteria | 5041 |
| 28 | Ga0070664_100397509 | 3300005564 | Bacteria | 1260 |
| 29 | Ga0068856_100110697 | 3300005614 | Bacteria | 2743 |
| 30 | Ga0068852_100027603 | 3300005616 | Bacteria | 4629 |
| 31 | Ga0068864_100073071 | 3300005618 | Bacteria | 2990 |
| 32 | Ga0068851_10079466 | 3300005834 | Bacteria | 1710 |
| 33 | Ga0068863_100018128 | 3300005841 | Bacteria | 6741 |
| 34 | Ga0068858_100020517 | 3300005842 | Bacteria | 6175 |
| 35 | Ga0068860_100048541 | 3300005843 | Bacteria | 4045 |
| 36 | Ga0068862_100048378 | 3300005844 | Bacteria | 3630 |
| 37 | Ga0081540_1021290 | 3300005983 | Bacteria | 3868 |
| 38 | Ga0070717_10296230 | 3300006028 | Bacteria | 1437 |
| 39 | Ga0070712_100067486 | 3300006175 | Bacteria | 2545 |
| 40 | Ga0097621_100040506 | 3300006237 | Bacteria | 3746 |
| 41 | Ga0068871_100002024 | 3300006358 | Bacteria | 13726 |
| 42 | Ga0105240_10195724 | 3300009093 | Bacteria | 2374 |
| 43 | Ga0105240_10547286 | 3300009093 | Bacteria | 1281 |
| 44 | Ga0105245_10002914 | 3300009098 | Bacteria | 15354 |
| 45 | Ga0105243_10042411 | 3300009148 | Bacteria | 3562 |
| 46 | Ga0105241_10002023 | 3300009174 | Bacteria | 15325 |
| 47 | Ga0105241_10156717 | 3300009174 | Bacteria | 1868 |
| 48 | Ga0105241_10166478 | 3300009174 | Bacteria | 1817 |
| 49 | Ga0105242_10079012 | 3300009176 | Bacteria | 2747 |
| 50 | Ga0105248_10000006 | 3300009177 | Bacteria | 595060 |
| 51 | Ga0105248_10001945 | 3300009177 | Bacteria | 22950 |
| 52 | Ga0105248_10011206 | 3300009177 | Bacteria | 9889 |
| 53 | Ga0105248_10064976 | 3300009177 | Bacteria | 4096 |
| 54 | Ga0105248_10374777 | 3300009177 | Bacteria | 1602 |
| 55 | Ga0105237_10205973 | 3300009545 | Bacteria | 1967 |
| 56 | Ga0105237_10854205 | 3300009545 | Unclassified | 917 |
| 57 | Ga0105238_10640493 | 3300009551 | Bacteria | 1073 |
| 58 | Ga0105239_10760452 | 3300010375 | Bacteria | 1109 |
| 59 | Ga0157373_10002384 | 3300013100 | Bacteria | 14270 |
| 60 | Ga0157373_10078621 | 3300013100 | Bacteria | 2326 |
| 61 | Ga0157371_10245307 | 3300013102 | Bacteria | 1289 |
| 62 | Ga0157369_10046702 | 3300013105 | Bacteria | 4706 |
| 63 | Ga0157369_10074328 | 3300013105 | Bacteria | 3645 |
| 64 | Ga0157374_10107753 | 3300013296 | Bacteria | 2678 |
| 65 | Ga0157374_10256840 | 3300013296 | Bacteria | 1720 |
| 66 | Ga0157374_10321184 | 3300013296 | Bacteria | 1534 |
| 67 | Ga0157378_10001149 | 3300013297 | Bacteria | 24055 |
| 68 | Ga0157378_10406633 | 3300013297 | Bacteria | 1342 |
| 69 | Ga0163162_10193815 | 3300013306 | Bacteria | 2160 |
| 70 | Ga0163162_10219507 | 3300013306 | Bacteria | 2031 |
| 71 | Ga0163162_10252860 | 3300013306 | Bacteria | 1894 |
| 72 | Ga0163162_10289406 | 3300013306 | Bacteria | 1770 |
| 73 | Ga0157372_10004805 | 3300013307 | Bacteria | 14358 |
| 74 | Ga0157375_10519321 | 3300013308 | Bacteria | 1354 |
| 75 | Ga0163163_10019530 | 3300014325 | Bacteria | 6365 |
| 76 | Ga0163163_10086277 | 3300014325 | Bacteria | 3148 |
| 77 | Ga0182008_10025972 | 3300014497 | Bacteria | 2972 |
| 78 | Ga0157379_10030283 | 3300014968 | Bacteria | 4816 |
| 79 | Ga0157376_10039173 | 3300014969 | Bacteria | 3863 |
| 80 | Ga0157376_10157679 | 3300014969 | Bacteria | 2054 |
| 81 | Ga0213872_10081122 | 3300021361 | Bacteria | 1457 |
| 82 | Ga0213871_10000428 | 3300021441 | Bacteria | 5634 |
| 83 | Ga0224572_1019600 | 3300024225 | Unclassified | 1300 |
| 84 | Ga0228598_1000165 | 3300024227 | Bacteria | 11648 |
| 85 | Ga0207680_10069258 | 3300025903 | Bacteria | 2179 |
| 86 | Ga0207647_10013077 | 3300025904 | Bacteria | 5767 |
| 87 | Ga0207654_10002153 | 3300025911 | Bacteria | 10086 |
| 88 | Ga0207654_10103601 | 3300025911 | Bacteria | 1757 |
| 89 | Ga0207707_10208312 | 3300025912 | Bacteria | 1704 |
| 90 | Ga0207695_10042423 | 3300025913 | Bacteria | 4859 |
| 91 | Ga0207695_10044413 | 3300025913 | Bacteria | 4727 |
| 92 | Ga0207671_10122828 | 3300025914 | Bacteria | 1986 |
| 93 | Ga0207660_10060866 | 3300025917 | Bacteria | 2716 |
| 94 | Ga0207660_10177672 | 3300025917 | Bacteria | 1651 |
| 95 | Ga0207657_10001059 | 3300025919 | Bacteria | 29185 |
| 96 | Ga0207657_10054273 | 3300025919 | Bacteria | 3466 |
| 97 | Ga0207649_10253981 | 3300025920 | Bacteria | 1267 |
| 98 | Ga0207652_10060225 | 3300025921 | Unclassified | 3275 |
| 99 | Ga0207652_10170364 | 3300025921 | Bacteria | 1954 |
| 100 | Ga0207652_10223374 | 3300025921 | Unclassified | 1697 |
| 101 | Ga0207650_10673253 | 3300025925 | Bacteria | 873 |
| 102 | Ga0207700_10213228 | 3300025928 | Bacteria | 1634 |
| 103 | Ga0207664_10013934 | 3300025929 | Bacteria | 5794 |
| 104 | Ga0207664_10130896 | 3300025929 | Bacteria | 2112 |
| 105 | Ga0207644_10020587 | 3300025931 | Bacteria | 4487 |
| 106 | Ga0207706_10046846 | 3300025933 | Bacteria | 3827 |
| 107 | Ga0207709_10112305 | 3300025935 | Bacteria | 1824 |
| 108 | Ga0207711_10000007 | 3300025941 | Bacteria | 759410 |
| 109 | Ga0207711_10130821 | 3300025941 | Bacteria | 2250 |
| 110 | Ga0207667_10003154 | 3300025949 | Bacteria | 20397 |
| 111 | Ga0207658_10117231 | 3300025986 | Bacteria | 2116 |
| 112 | Ga0207658_10395406 | 3300025986 | Bacteria | 1214 |
| 113 | Ga0207677_10041165 | 3300026023 | Bacteria | 3053 |
| 114 | Ga0207703_10303805 | 3300026035 | Bacteria | 1456 |
| 115 | Ga0207639_10090709 | 3300026041 | Bacteria | 2445 |
| 116 | Ga0207702_10080297 | 3300026078 | Bacteria | 2829 |
| 117 | Ga0207702_10868490 | 3300026078 | Unclassified | 893 |
| 118 | Ga0207641_10015395 | 3300026088 | Bacteria | 6266 |
| 119 | Ga0207676_10062346 | 3300026095 | Bacteria | 2957 |
| 120 | Ga0207674_10413323 | 3300026116 | Bacteria | 1304 |
| 121 | Ga0209179_1018332 | 3300027512 | Bacteria | 1336 |
| 122 | Ga0265356_1005072 | 3300028017 | Bacteria | 1587 |
| 123 | Ga0268266_10056662 | 3300028379 | Bacteria | 3371 |
| 124 | Ga0268265_10024571 | 3300028380 | Bacteria | 4265 |
| 125 | Ga0268264_10029173 | 3300028381 | Bacteria | 4518 |
| 126 | Ga0265319_1002179 | 3300028563 | Bacteria | 10911 |
| 127 | Ga0265334_10026345 | 3300028573 | Bacteria | 2347 |
| 128 | Ga0265318_10000195 | 3300028577 | Bacteria | 53122 |
| 129 | Ga0265318_10000373 | 3300028577 | Bacteria | 35154 |
| 130 | Ga0265318_10011236 | 3300028577 | Bacteria | 3862 |
| 131 | Ga0265338_10001159 | 3300028800 | Bacteria | 43561 |
| 132 | Ga0265338_10010307 | 3300028800 | Bacteria | 10981 |
| 133 | Ga0265338_10020637 | 3300028800 | Bacteria | 6918 |
| 134 | Ga0265338_10031937 | 3300028800 | Bacteria | 5151 |
| 135 | Ga0265338_10096598 | 3300028800 | Bacteria | 2423 |
| 136 | Ga0265338_10227273 | 3300028800 | Bacteria | 1390 |
| 137 | Ga0265338_10244665 | 3300028800 | Bacteria | 1326 |
| 138 | Ga0265338_10450721 | 3300028800 | Unclassified | 911 |
| 139 | Ga0265762_1000279 | 3300030760 | Bacteria | 8515 |
| 140 | Ga0265770_1004513 | 3300030878 | Bacteria | 1901 |
| 141 | Ga0265760_10001627 | 3300031090 | Bacteria | 6602 |
| 142 | Ga0265330_10000194 | 3300031235 | Bacteria | 47211 |
| 143 | Ga0265332_10012002 | 3300031238 | Bacteria | 3847 |
| 144 | Ga0265332_10029749 | 3300031238 | Bacteria | 2387 |
| 145 | Ga0265328_10002414 | 3300031239 | Bacteria | 8385 |
| 146 | Ga0265328_10034802 | 3300031239 | Bacteria | 1864 |
| 147 | Ga0265328_10087155 | 3300031239 | Bacteria | 1153 |
| 148 | Ga0265320_10000070 | 3300031240 | Bacteria | 90235 |
| 149 | Ga0265320_10001141 | 3300031240 | Bacteria | 19544 |
| 150 | Ga0265320_10016032 | 3300031240 | Bacteria | 4212 |
| 151 | Ga0265325_10000805 | 3300031241 | Bacteria | 22687 |
| 152 | Ga0265325_10003067 | 3300031241 | Bacteria | 11035 |
| 153 | Ga0265325_10009940 | 3300031241 | Bacteria | 5533 |
| 154 | Ga0265325_10012164 | 3300031241 | Bacteria | 4926 |
| 155 | Ga0265325_10116796 | 3300031241 | Bacteria | 1290 |
| 156 | Ga0265329_10000495 | 3300031242 | Bacteria | 20369 |
| 157 | Ga0265329_10004749 | 3300031242 | Bacteria | 5593 |
| 158 | Ga0265329_10018080 | 3300031242 | Bacteria | 2414 |
| 159 | Ga0265340_10000490 | 3300031247 | Bacteria | 21639 |
| 160 | Ga0265340_10006662 | 3300031247 | Bacteria | 6332 |
| 161 | Ga0265340_10117450 | 3300031247 | Bacteria | 1225 |
| 162 | Ga0265339_10004730 | 3300031249 | Bacteria | 9222 |
| 163 | Ga0265339_10008222 | 3300031249 | Bacteria | 6652 |
| 164 | Ga0265339_10019442 | 3300031249 | Bacteria | 3988 |
| 165 | Ga0265339_10085121 | 3300031249 | Bacteria | 1665 |
| 166 | Ga0265339_10100281 | 3300031249 | Bacteria | 1508 |
| 167 | Ga0265331_10000198 | 3300031250 | Bacteria | 73807 |
| 168 | Ga0265331_10000527 | 3300031250 | Bacteria | 35289 |
| 169 | Ga0265331_10078419 | 3300031250 | Unclassified | 1538 |
| 170 | Ga0265316_10002424 | 3300031344 | Bacteria | 19382 |
| 171 | Ga0265316_10002535 | 3300031344 | Bacteria | 18875 |
| 172 | Ga0265316_10036158 | 3300031344 | Unclassified | 3994 |
| 173 | Ga0265316_10040634 | 3300031344 | Unclassified | 3727 |
| 174 | Ga0265316_10137186 | 3300031344 | Bacteria | 1840 |
| 175 | Ga0265313_10001765 | 3300031595 | Bacteria | 19817 |
| 176 | Ga0265313_10002197 | 3300031595 | Bacteria | 17268 |
| 177 | Ga0265313_10074286 | 3300031595 | Bacteria | 1559 |
| 178 | Ga0265314_10002761 | 3300031711 | Bacteria | 17542 |
| 179 | Ga0265314_10092329 | 3300031711 | Unclassified | 1968 |
| 180 | Ga0265342_10000433 | 3300031712 | Bacteria | 45864 |
| 181 | Ga0265342_10002718 | 3300031712 | Bacteria | 15059 |
| 182 | Ga0265342_10011332 | 3300031712 | Bacteria | 6112 |
| 183 | Ga0265342_10034135 | 3300031712 | Bacteria | 3122 |
| 184 | Ga0265342_10219409 | 3300031712 | Bacteria | 1025 |
| 185 | Ga0316583_10033834 | 3300032133 | Bacteria | 1815 |
| 186 | Ga0373926_0111285 | 3300035083 | Bacteria | 1029 |
| 187 | Ga0373936_0173099 | 3300035113 | Bacteria | 944 |
| 188 | Ga0373931_0010192 | 3300035691 | Bacteria | 4513 |
| 189 | Ga0373927_0262312 | 3300035695 | Bacteria | 1136 |
| 190 | Ga0373925_0059290 | 3300037068 | Bacteria | 2871 |
| 191 | Ga0395900_0052051 | 3300037418 | Bacteria | 4216 |
| 192 | Ga0436360_0638428 | 3300039438 | Bacteria | 11768 |
| 193 | Ga0436360_1346785 | 3300039438 | Bacteria | 1461 |
| 194 | Ga0436361_0133332 | 3300039447 | Bacteria | 25694 |
| 195 | Ga0436361_0409396 | 3300039447 | Bacteria | 31269 |
| 196 | Ga0436361_0709256 | 3300039447 | Bacteria | 999 |
| 197 | Ga0436361_0796719 | 3300039447 | Bacteria | 1737 |
| 198 | Ga0436361_0847263 | 3300039447 | Bacteria | 7057 |
| 199 | Ga0436361_1061564 | 3300039447 | Bacteria | 8919 |
| 200 | Ga0466964_0028394 | 3300044706 | Bacteria | 2204 |
| 201 | Ga0466967_0005600 | 3300045976 | Bacteria | 8735 |
| 202 | Ga0495651_0005607 | 3300046462 | Bacteria | 9568 |
| 203 | Ga0495653_0072672 | 3300046463 | Bacteria | 2568 |
| 204 | Ga0495650_0020222 | 3300046471 | Bacteria | 3251 |
| 205 | Ga0495580_0042287 | 3300046472 | Bacteria | 3247 |
| 206 | Ga0495580_0062255 | 3300046472 | Bacteria | 2618 |
| 207 | Ga0495585_0024073 | 3300046492 | Bacteria | 3493 |
| 208 | Ga0495594_0061645 | 3300046499 | Bacteria | 2076 |
| 209 | Ga0495583_0094773 | 3300046506 | Bacteria | 1281 |
| 210 | Ga0495606_0114219 | 3300046507 | Bacteria | 1625 |
| 211 | Ga0495608_0281912 | 3300046511 | Bacteria | 1031 |
| 212 | Ga0495630_0025947 | 3300046517 | Bacteria | 4336 |
| 213 | Ga0495631_0018698 | 3300046518 | Bacteria | 3259 |
| 214 | Ga0495643_0024925 | 3300046522 | Bacteria | 3389 |
| 215 | Ga0495644_0000269 | 3300046523 | Bacteria | 23871 |
| 216 | Ga0495665_0001586 | 3300046531 | Bacteria | 12163 |
| 217 | Ga0495586_0007810 | 3300046535 | Bacteria | 5705 |
| 218 | Ga0495609_0110110 | 3300046538 | Bacteria | 1189 |
| 219 | Ga0495633_0102615 | 3300046558 | Bacteria | 1327 |
| 220 | Ga0495625_0015473 | 3300046660 | Bacteria | 6042 |
| 221 | Ga0495625_0021047 | 3300046660 | Bacteria | 5028 |
| 222 | Ga0495625_0073368 | 3300046660 | Bacteria | 2399 |
| 223 | Ga0495657_0016404 | 3300046675 | Bacteria | 5397 |
| 224 | Ga0495599_0197639 | 3300046678 | Bacteria | 1236 |
| 225 | Ga0495669_0037658 | 3300046684 | Bacteria | 2141 |
| 226 | Ga0495613_0037798 | 3300046689 | Bacteria | 3579 |
| 227 | Ga0495624_0241677 | 3300046690 | Bacteria | 1093 |
| 228 | Ga0495649_0035209 | 3300046694 | Bacteria | 2754 |
| 229 | Ga0495604_0007573 | 3300047317 | Bacteria | 8593 |
| 230 | Ga0495674_0025824 | 3300047319 | Bacteria | 5378 |
| 231 | Ga0495683_0033846 | 3300047323 | Bacteria | 2599 |
| 232 | Ga0495675_0073916 | 3300047444 | Bacteria | 2149 |
| 233 | Ga0495684_0354936 | 3300047471 | Bacteria | 1040 |
| 234 | Ga0495602_0027409 | 3300048088 | Bacteria | 5474 |
| 235 | Ga0496100_0128956 | 3300048903 | Bacteria | 1779 |
| 236 | Ga0496102_0000525 | 3300048905 | Bacteria | 41568 |
| 237 | Ga0496102_0097471 | 3300048905 | Bacteria | 2727 |
| 238 | Ga0496102_0201572 | 3300048905 | Bacteria | 1876 |
| 239 | Ga0496103_0039966 | 3300048906 | Bacteria | 2883 |
| 240 | Ga0496104_0021470 | 3300048907 | Bacteria | 5927 |
| 241 | Ga0496104_0173009 | 3300048907 | Bacteria | 2070 |
| 242 | Ga0496104_0272596 | 3300048907 | Bacteria | 1605 |
| 243 | Ga0496105_0134795 | 3300048908 | Bacteria | 2035 |
| 244 | Ga0496106_0143171 | 3300048909 | Bacteria | 1881 |
| 245 | Ga0496107_0133352 | 3300048910 | Bacteria | 1834 |
| 246 | Ga0496107_0162233 | 3300048910 | Bacteria | 1657 |
| 247 | Ga0496108_0021134 | 3300048911 | Bacteria | 5348 |
| 248 | Ga0496110_0057290 | 3300048913 | Bacteria | 3430 |
| 249 | Ga0496111_0032608 | 3300048914 | Bacteria | 3714 |
| 250 | Ga0496112_0064807 | 3300048915 | Bacteria | 3606 |
| 251 | Ga0496112_0725085 | 3300048915 | Bacteria | 921 |
| 252 | Ga0496112_0881392 | 3300048915 | Unclassified | 817 |
| 253 | Ga0496113_0181319 | 3300048916 | Bacteria | 1669 |
| 254 | Ga0496113_0349635 | 3300048916 | Bacteria | 1186 |
| 255 | Ga0501032_0044219 | 3300049569 | Bacteria | 3015 |
| 256 | Ga0501033_0010077 | 3300049570 | Bacteria | 7251 |
| 257 | Ga0501034_0008246 | 3300049571 | Bacteria | 11032 |
| 258 | Ga0501036_0001526 | 3300049572 | Bacteria | 17871 |
| 259 | Ga0501039_0131529 | 3300049575 | Bacteria | 1964 |
| 260 | Ga0501043_0004236 | 3300049579 | Bacteria | 11695 |
| 261 | Ga0501046_0012194 | 3300049580 | Bacteria | 7324 |
| 262 | Ga0501047_0018666 | 3300049581 | Bacteria | 6650 |
| 263 | Ga0501070_0180225 | 3300049586 | Bacteria | 1739 |
| 264 | Ga0501073_0091991 | 3300049589 | Bacteria | 2108 |
| 265 | Ga0501074_0099384 | 3300049590 | Bacteria | 2083 |
| 266 | Ga0501035_0009621 | 3300049822 | Bacteria | 8989 |
| 267 | Ga0500651_0000004 | 3300053093 | Bacteria | 389879 |
| 268 | Ga0500595_053627 | 3300053119 | Bacteria | 1240 |
| 269 | Ga0500661_007095 | 3300055283 | Bacteria | 2078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10001159 | Ga0265338_1000115919 | 209 |
| 2 | 3300031711 | Ga0265314_10002761 | Ga0265314_100027615 | 209 |
| 3 | 3300009174 | Ga0105241_10166478 | Ga0105241_101664782 | 212 |
| 4 | 3300009545 | Ga0105237_10854205 | Ga0105237_108542052 | 212 |
| 5 | 3300013297 | Ga0157378_10406633 | Ga0157378_104066331 | 212 |
| 6 | 3300014968 | Ga0157379_10030283 | Ga0157379_100302832 | 212 |
| 7 | 3300025911 | Ga0207654_10103601 | Ga0207654_101036012 | 212 |
| 8 | 3300048905 | Ga0496102_0000525 | Ga0496102_0000525_18770_19555 | 212 |
| 9 | 3300048906 | Ga0496103_0039966 | Ga0496103_0039966_1318_2103 | 212 |
| 10 | 3300048907 | Ga0496104_0021470 | Ga0496104_0021470_714_1499 | 212 |
| 11 | 3300048909 | Ga0496106_0143171 | Ga0496106_0143171_281_1066 | 212 |
| 12 | 3300048910 | Ga0496107_0133352 | Ga0496107_0133352_344_1129 | 212 |
| 13 | 3300031712 | Ga0265342_10219409 | Ga0265342_102194091 | 213 |
| 14 | 3300009174 | Ga0105241_10156717 | Ga0105241_101567172 | 219 |
| 15 | 3300048916 | Ga0496113_0349635 | Ga0496113_0349635_26_706 | 219 |
| 16 | 3300037418 | Ga0395900_0052051 | Ga0395900_0052051_3266_4072 | 222 |
| 17 | 3300005338 | Ga0068868_100052795 | Ga0068868_1000527953 | 223 |
| 18 | 3300005843 | Ga0068860_100048541 | Ga0068860_1000485413 | 223 |
| 19 | 3300006237 | Ga0097621_100040506 | Ga0097621_1000405063 | 223 |
| 20 | 3300006358 | Ga0068871_100002024 | Ga0068871_1000020243 | 223 |
| 21 | 3300009098 | Ga0105245_10002914 | Ga0105245_100029148 | 223 |
| 22 | 3300009176 | Ga0105242_10079012 | Ga0105242_100790122 | 223 |
| 23 | 3300013297 | Ga0157378_10001149 | Ga0157378_1000114918 | 223 |
| 24 | 3300013308 | Ga0157375_10519321 | Ga0157375_105193212 | 223 |
| 25 | 3300014969 | Ga0157376_10039173 | Ga0157376_100391733 | 223 |
| 26 | 3300026023 | Ga0207677_10041165 | Ga0207677_100411653 | 223 |
| 27 | 3300028381 | Ga0268264_10029173 | Ga0268264_100291733 | 223 |
| 28 | 3300028800 | Ga0265338_10010307 | Ga0265338_100103079 | 223 |
| 29 | 3300031249 | Ga0265339_10004730 | Ga0265339_100047308 | 223 |
| 30 | 3300031344 | Ga0265316_10036158 | Ga0265316_100361584 | 223 |
| 31 | 3300013102 | Ga0157371_10245307 | Ga0157371_102453072 | 225 |
| 32 | 3300013105 | Ga0157369_10074328 | Ga0157369_100743283 | 225 |
| 33 | 3300028563 | Ga0265319_1002179 | Ga0265319_10021798 | 227 |
| 34 | 3300028577 | Ga0265318_10000373 | Ga0265318_100003737 | 227 |
| 35 | 3300028800 | Ga0265338_10227273 | Ga0265338_102272731 | 227 |
| 36 | 3300031240 | Ga0265320_10001141 | Ga0265320_100011417 | 227 |
| 37 | 3300031242 | Ga0265329_10000495 | Ga0265329_100004958 | 227 |
| 38 | 3300031249 | Ga0265339_10019442 | Ga0265339_100194422 | 227 |
| 39 | 3300031250 | Ga0265331_10000527 | Ga0265331_1000052732 | 227 |
| 40 | 3300031344 | Ga0265316_10002535 | Ga0265316_1000253520 | 227 |
| 41 | 3300031595 | Ga0265313_10002197 | Ga0265313_100021978 | 227 |
| 42 | 3300031712 | Ga0265342_10002718 | Ga0265342_100027188 | 227 |
| 43 | 3300005842 | Ga0068858_100020517 | Ga0068858_1000205173 | 228 |
| 44 | 3300026035 | Ga0207703_10303805 | Ga0207703_103038051 | 228 |
| 45 | 3300026041 | Ga0207639_10090709 | Ga0207639_100907092 | 228 |
| 46 | 3300014969 | Ga0157376_10157679 | Ga0157376_101576793 | 229 |
| 47 | 3300028573 | Ga0265334_10026345 | Ga0265334_100263452 | 229 |
| 48 | 3300028577 | Ga0265318_10011236 | Ga0265318_100112363 | 229 |
| 49 | 3300028800 | Ga0265338_10020637 | Ga0265338_100206373 | 229 |
| 50 | 3300031235 | Ga0265330_10000194 | Ga0265330_1000019434 | 229 |
| 51 | 3300031238 | Ga0265332_10012002 | Ga0265332_100120023 | 229 |
| 52 | 3300031239 | Ga0265328_10002414 | Ga0265328_100024144 | 229 |
| 53 | 3300031240 | Ga0265320_10016032 | Ga0265320_100160323 | 229 |
| 54 | 3300031241 | Ga0265325_10000805 | Ga0265325_1000080516 | 229 |
| 55 | 3300031242 | Ga0265329_10004749 | Ga0265329_100047494 | 229 |
| 56 | 3300031247 | Ga0265340_10000490 | Ga0265340_100004907 | 229 |
| 57 | 3300031249 | Ga0265339_10008222 | Ga0265339_100082226 | 229 |
| 58 | 3300031250 | Ga0265331_10078419 | Ga0265331_100784191 | 229 |
| 59 | 3300031344 | Ga0265316_10002424 | Ga0265316_100024245 | 229 |
| 60 | 3300031595 | Ga0265313_10001765 | Ga0265313_1000176515 | 229 |
| 61 | 3300031712 | Ga0265342_10034135 | Ga0265342_100341353 | 229 |
| 62 | 3300039438 | Ga0436360_1346785 | Ga0436360_1346785_616_1389 | 232 |
| 63 | 3300032133 | Ga0316583_10033834 | Ga0316583_100338342 | 234 |
| 64 | 3300005327 | Ga0070658_10162803 | Ga0070658_101628032 | 235 |
| 65 | 3300005983 | Ga0081540_1021290 | Ga0081540_10212904 | 235 |
| 66 | 3300009148 | Ga0105243_10042411 | Ga0105243_100424112 | 235 |
| 67 | 3300025935 | Ga0207709_10112305 | Ga0207709_101123053 | 235 |
| 68 | 3300030878 | Ga0265770_1004513 | Ga0265770_10045133 | 235 |
| 69 | 3300009177 | Ga0105248_10000006 | Ga0105248_10000006427 | 236 |
| 70 | 3300009177 | Ga0105248_10001945 | Ga0105248_1000194518 | 236 |
| 71 | 3300013306 | Ga0163162_10219507 | Ga0163162_102195072 | 236 |
| 72 | 3300025941 | Ga0207711_10000007 | Ga0207711_10000007257 | 236 |
| 73 | 3300025941 | Ga0207711_10130821 | Ga0207711_101308213 | 236 |
| 74 | 3300046506 | Ga0495583_0094773 | Ga0495583_0094773_24_746 | 236 |
| 75 | 3300053119 | Ga0500595_053627 | Ga0500595_053627_216_989 | 236 |
| 76 | 3300005336 | Ga0070680_100090186 | Ga0070680_1000901862 | 237 |
| 77 | 3300005339 | Ga0070660_100042996 | Ga0070660_1000429962 | 237 |
| 78 | 3300005530 | Ga0070679_100006946 | Ga0070679_1000069469 | 237 |
| 79 | 3300005616 | Ga0068852_100027603 | Ga0068852_1000276036 | 237 |
| 80 | 3300025917 | Ga0207660_10060866 | Ga0207660_100608664 | 237 |
| 81 | 3300025921 | Ga0207652_10223374 | Ga0207652_102233742 | 237 |
| 82 | 3300026116 | Ga0207674_10413323 | Ga0207674_104133232 | 237 |
| 83 | 3300031249 | Ga0265339_10100281 | Ga0265339_101002812 | 237 |
| 84 | 3300005336 | Ga0070680_100100105 | Ga0070680_1001001053 | 238 |
| 85 | 3300005459 | Ga0068867_100148817 | Ga0068867_1001488172 | 238 |
| 86 | 3300025917 | Ga0207660_10177672 | Ga0207660_101776722 | 238 |
| 87 | 3300025921 | Ga0207652_10060225 | Ga0207652_100602253 | 238 |
| 88 | 3300031241 | Ga0265325_10003067 | Ga0265325_1000306713 | 238 |
| 89 | 3300048907 | Ga0496104_0272596 | Ga0496104_0272596_531_1322 | 238 |
| 90 | 3300048915 | Ga0496112_0725085 | Ga0496112_0725085_15_806 | 238 |
| 91 | 3300035083 | Ga0373926_0111285 | Ga0373926_0111285_18_800 | 239 |
| 92 | 3300046462 | Ga0495651_0005607 | Ga0495651_0005607_5326_6108 | 239 |
| 93 | 3300046463 | Ga0495653_0072672 | Ga0495653_0072672_278_1060 | 239 |
| 94 | 3300046511 | Ga0495608_0281912 | Ga0495608_0281912_223_1005 | 239 |
| 95 | 3300046517 | Ga0495630_0025947 | Ga0495630_0025947_496_1278 | 239 |
| 96 | 3300046531 | Ga0495665_0001586 | Ga0495665_0001586_10399_11181 | 239 |
| 97 | 3300046535 | Ga0495586_0007810 | Ga0495586_0007810_381_1163 | 239 |
| 98 | 3300046675 | Ga0495657_0016404 | Ga0495657_0016404_11_793 | 239 |
| 99 | 3300046689 | Ga0495613_0037798 | Ga0495613_0037798_2451_3233 | 239 |
| 100 | 3300046690 | Ga0495624_0241677 | Ga0495624_0241677_217_999 | 239 |
| 101 | 3300047317 | Ga0495604_0007573 | Ga0495604_0007573_7642_8424 | 239 |
| 102 | 3300047319 | Ga0495674_0025824 | Ga0495674_0025824_4302_5084 | 239 |
| 103 | 3300047444 | Ga0495675_0073916 | Ga0495675_0073916_1206_1988 | 239 |
| 104 | 3300047471 | Ga0495684_0354936 | Ga0495684_0354936_173_955 | 239 |
| 105 | 3300048088 | Ga0495602_0027409 | Ga0495602_0027409_200_982 | 239 |
| 106 | 3300005327 | Ga0070658_10160078 | Ga0070658_101600783 | 240 |
| 107 | 3300005336 | Ga0070680_100150720 | Ga0070680_1001507201 | 240 |
| 108 | 3300005458 | Ga0070681_10043221 | Ga0070681_100432215 | 240 |
| 109 | 3300013105 | Ga0157369_10046702 | Ga0157369_100467022 | 240 |
| 110 | 3300025913 | Ga0207695_10042423 | Ga0207695_100424234 | 240 |
| 111 | 3300025919 | Ga0207657_10054273 | Ga0207657_100542732 | 240 |
| 112 | 3300025949 | Ga0207667_10003154 | Ga0207667_1000315412 | 240 |
| 113 | 3300046678 | Ga0495599_0197639 | Ga0495599_0197639_100_873 | 240 |
| 114 | 3300005331 | Ga0070670_100329304 | Ga0070670_1003293043 | 241 |
| 115 | 3300005548 | Ga0070665_100035113 | Ga0070665_1000351132 | 241 |
| 116 | 3300031239 | Ga0265328_10034802 | Ga0265328_100348022 | 241 |
| 117 | 3300031247 | Ga0265340_10006662 | Ga0265340_100066625 | 241 |
| 118 | 3300031249 | Ga0265339_10085121 | Ga0265339_100851212 | 241 |
| 119 | 3300031712 | Ga0265342_10011332 | Ga0265342_100113323 | 241 |
| 120 | 3300039447 | Ga0436361_1061564 | Ga0436361_1061564_4370_5161 | 241 |
| 121 | 3300044706 | Ga0466964_0028394 | Ga0466964_0028394_835_1626 | 241 |
| 122 | 3300005435 | Ga0070714_100151412 | Ga0070714_1001514121 | 242 |
| 123 | 3300005436 | Ga0070713_100197302 | Ga0070713_1001973023 | 242 |
| 124 | 3300005844 | Ga0068862_100048378 | Ga0068862_1000483783 | 242 |
| 125 | 3300006028 | Ga0070717_10296230 | Ga0070717_102962302 | 242 |
| 126 | 3300013296 | Ga0157374_10256840 | Ga0157374_102568403 | 242 |
| 127 | 3300013306 | Ga0163162_10193815 | Ga0163162_101938152 | 242 |
| 128 | 3300025928 | Ga0207700_10213228 | Ga0207700_102132281 | 242 |
| 129 | 3300025929 | Ga0207664_10130896 | Ga0207664_101308961 | 242 |
| 130 | 3300028380 | Ga0268265_10024571 | Ga0268265_100245713 | 242 |
| 131 | 3300048910 | Ga0496107_0162233 | Ga0496107_0162233_55_810 | 243 |
| 132 | 3300048915 | Ga0496112_0881392 | Ga0496112_0881392_38_793 | 243 |
| 133 | 3300009093 | Ga0105240_10195724 | Ga0105240_101957242 | 246 |
| 134 | 3300025913 | Ga0207695_10044413 | Ga0207695_100444132 | 246 |
| 135 | 3300024225 | Ga0224572_1019600 | Ga0224572_10196003 | 247 |
| 136 | 3300024227 | Ga0228598_1000165 | Ga0228598_10001657 | 247 |
| 137 | 3300028800 | Ga0265338_10450721 | Ga0265338_104507212 | 247 |
| 138 | 3300049569 | Ga0501032_0044219 | Ga0501032_0044219_619_1398 | 250 |
| 139 | 3300049570 | Ga0501033_0010077 | Ga0501033_0010077_6360_7139 | 250 |
| 140 | 3300049571 | Ga0501034_0008246 | Ga0501034_0008246_9589_10368 | 250 |
| 141 | 3300049572 | Ga0501036_0001526 | Ga0501036_0001526_12107_12886 | 250 |
| 142 | 3300049575 | Ga0501039_0131529 | Ga0501039_0131529_117_896 | 250 |
| 143 | 3300049579 | Ga0501043_0004236 | Ga0501043_0004236_10619_11398 | 250 |
| 144 | 3300049580 | Ga0501046_0012194 | Ga0501046_0012194_6433_7212 | 250 |
| 145 | 3300049581 | Ga0501047_0018666 | Ga0501047_0018666_3231_4010 | 250 |
| 146 | 3300049586 | Ga0501070_0180225 | Ga0501070_0180225_607_1386 | 250 |
| 147 | 3300049589 | Ga0501073_0091991 | Ga0501073_0091991_666_1445 | 250 |
| 148 | 3300049590 | Ga0501074_0099384 | Ga0501074_0099384_341_1120 | 250 |
| 149 | 3300049822 | Ga0501035_0009621 | Ga0501035_0009621_5573_6352 | 250 |
| 150 | 3300028577 | Ga0265318_10000195 | Ga0265318_1000019524 | 251 |
| 151 | 3300028800 | Ga0265338_10031937 | Ga0265338_100319374 | 251 |
| 152 | 3300031238 | Ga0265332_10029749 | Ga0265332_100297492 | 251 |
| 153 | 3300031239 | Ga0265328_10087155 | Ga0265328_100871552 | 251 |
| 154 | 3300031240 | Ga0265320_10000070 | Ga0265320_1000007011 | 251 |
| 155 | 3300031241 | Ga0265325_10009940 | Ga0265325_100099405 | 251 |
| 156 | 3300031242 | Ga0265329_10018080 | Ga0265329_100180802 | 251 |
| 157 | 3300031247 | Ga0265340_10117450 | Ga0265340_101174502 | 251 |
| 158 | 3300031250 | Ga0265331_10000198 | Ga0265331_1000019857 | 251 |
| 159 | 3300031344 | Ga0265316_10040634 | Ga0265316_100406343 | 251 |
| 160 | 3300031344 | Ga0265316_10137186 | Ga0265316_101371861 | 251 |
| 161 | 3300031711 | Ga0265314_10092329 | Ga0265314_100923292 | 251 |
| 162 | 3300031712 | Ga0265342_10000433 | Ga0265342_1000043329 | 251 |
| 163 | 3300003316 | rootH1_10011223 | rootH1_100112233 | 255 |
| 164 | 3300005331 | Ga0070670_100752654 | Ga0070670_1007526541 | 255 |
| 165 | 3300005339 | Ga0070660_100148414 | Ga0070660_1001484142 | 255 |
| 166 | 3300005344 | Ga0070661_100023683 | Ga0070661_1000236836 | 255 |
| 167 | 3300005355 | Ga0070671_100001640 | Ga0070671_10000164010 | 255 |
| 168 | 3300005367 | Ga0070667_100075748 | Ga0070667_1000757483 | 255 |
| 169 | 3300005436 | Ga0070713_100112328 | Ga0070713_1001123283 | 255 |
| 170 | 3300005456 | Ga0070678_100333394 | Ga0070678_1003333942 | 255 |
| 171 | 3300005457 | Ga0070662_100031409 | Ga0070662_1000314093 | 255 |
| 172 | 3300005458 | Ga0070681_10254226 | Ga0070681_102542263 | 255 |
| 173 | 3300005530 | Ga0070679_100165465 | Ga0070679_1001654653 | 255 |
| 174 | 3300005539 | Ga0068853_100215271 | Ga0068853_1002152712 | 255 |
| 175 | 3300005548 | Ga0070665_100012812 | Ga0070665_1000128123 | 255 |
| 176 | 3300005564 | Ga0070664_100397509 | Ga0070664_1003975092 | 255 |
| 177 | 3300005614 | Ga0068856_100110697 | Ga0068856_1001106971 | 255 |
| 178 | 3300005618 | Ga0068864_100073071 | Ga0068864_1000730712 | 255 |
| 179 | 3300005834 | Ga0068851_10079466 | Ga0068851_100794662 | 255 |
| 180 | 3300005841 | Ga0068863_100018128 | Ga0068863_1000181281 | 255 |
| 181 | 3300006175 | Ga0070712_100067486 | Ga0070712_1000674861 | 255 |
| 182 | 3300009093 | Ga0105240_10547286 | Ga0105240_105472862 | 255 |
| 183 | 3300009174 | Ga0105241_10002023 | Ga0105241_1000202310 | 255 |
| 184 | 3300009177 | Ga0105248_10011206 | Ga0105248_1001120610 | 255 |
| 185 | 3300009177 | Ga0105248_10064976 | Ga0105248_100649764 | 255 |
| 186 | 3300009177 | Ga0105248_10374777 | Ga0105248_103747773 | 255 |
| 187 | 3300009545 | Ga0105237_10205973 | Ga0105237_102059732 | 255 |
| 188 | 3300009551 | Ga0105238_10640493 | Ga0105238_106404931 | 255 |
| 189 | 3300010375 | Ga0105239_10760452 | Ga0105239_107604522 | 255 |
| 190 | 3300013100 | Ga0157373_10002384 | Ga0157373_100023848 | 255 |
| 191 | 3300013100 | Ga0157373_10078621 | Ga0157373_100786212 | 255 |
| 192 | 3300013296 | Ga0157374_10107753 | Ga0157374_101077532 | 255 |
| 193 | 3300013296 | Ga0157374_10321184 | Ga0157374_103211842 | 255 |
| 194 | 3300013306 | Ga0163162_10252860 | Ga0163162_102528601 | 255 |
| 195 | 3300013306 | Ga0163162_10289406 | Ga0163162_102894062 | 255 |
| 196 | 3300013307 | Ga0157372_10004805 | Ga0157372_100048056 | 255 |
| 197 | 3300014325 | Ga0163163_10019530 | Ga0163163_100195302 | 255 |
| 198 | 3300014325 | Ga0163163_10086277 | Ga0163163_100862774 | 255 |
| 199 | 3300014497 | Ga0182008_10025972 | Ga0182008_100259723 | 255 |
| 200 | 3300021361 | Ga0213872_10081122 | Ga0213872_100811222 | 255 |
| 201 | 3300021441 | Ga0213871_10000428 | Ga0213871_100004285 | 255 |
| 202 | 3300025903 | Ga0207680_10069258 | Ga0207680_100692582 | 255 |
| 203 | 3300025904 | Ga0207647_10013077 | Ga0207647_100130773 | 255 |
| 204 | 3300025911 | Ga0207654_10002153 | Ga0207654_100021538 | 255 |
| 205 | 3300025912 | Ga0207707_10208312 | Ga0207707_102083121 | 255 |
| 206 | 3300025914 | Ga0207671_10122828 | Ga0207671_101228283 | 255 |
| 207 | 3300025919 | Ga0207657_10001059 | Ga0207657_100010599 | 255 |
| 208 | 3300025920 | Ga0207649_10253981 | Ga0207649_102539812 | 255 |
| 209 | 3300025921 | Ga0207652_10170364 | Ga0207652_101703643 | 255 |
| 210 | 3300025925 | Ga0207650_10673253 | Ga0207650_106732532 | 255 |
| 211 | 3300025929 | Ga0207664_10013934 | Ga0207664_100139344 | 255 |
| 212 | 3300025931 | Ga0207644_10020587 | Ga0207644_100205874 | 255 |
| 213 | 3300025933 | Ga0207706_10046846 | Ga0207706_100468465 | 255 |
| 214 | 3300025986 | Ga0207658_10117231 | Ga0207658_101172312 | 255 |
| 215 | 3300025986 | Ga0207658_10395406 | Ga0207658_103954062 | 255 |
| 216 | 3300026078 | Ga0207702_10080297 | Ga0207702_100802972 | 255 |
| 217 | 3300026078 | Ga0207702_10868490 | Ga0207702_108684901 | 255 |
| 218 | 3300026088 | Ga0207641_10015395 | Ga0207641_100153952 | 255 |
| 219 | 3300026095 | Ga0207676_10062346 | Ga0207676_100623463 | 255 |
| 220 | 3300027512 | Ga0209179_1018332 | Ga0209179_10183322 | 255 |
| 221 | 3300028017 | Ga0265356_1005072 | Ga0265356_10050721 | 255 |
| 222 | 3300028379 | Ga0268266_10056662 | Ga0268266_100566624 | 255 |
| 223 | 3300028800 | Ga0265338_10096598 | Ga0265338_100965983 | 255 |
| 224 | 3300028800 | Ga0265338_10244665 | Ga0265338_102446652 | 255 |
| 225 | 3300030760 | Ga0265762_1000279 | Ga0265762_10002796 | 255 |
| 226 | 3300031090 | Ga0265760_10001627 | Ga0265760_100016273 | 255 |
| 227 | 3300031241 | Ga0265325_10012164 | Ga0265325_100121645 | 255 |
| 228 | 3300031241 | Ga0265325_10116796 | Ga0265325_101167962 | 255 |
| 229 | 3300031595 | Ga0265313_10074286 | Ga0265313_100742862 | 255 |
| 230 | 3300035113 | Ga0373936_0173099 | Ga0373936_0173099_125_928 | 255 |
| 231 | 3300035691 | Ga0373931_0010192 | Ga0373931_0010192_130_930 | 255 |
| 232 | 3300035695 | Ga0373927_0262312 | Ga0373927_0262312_196_987 | 255 |
| 233 | 3300037068 | Ga0373925_0059290 | Ga0373925_0059290_1542_2345 | 255 |
| 234 | 3300039438 | Ga0436360_0638428 | Ga0436360_0638428_7447_8238 | 255 |
| 235 | 3300039447 | Ga0436361_0133332 | Ga0436361_0133332_9096_9887 | 255 |
| 236 | 3300039447 | Ga0436361_0409396 | Ga0436361_0409396_21230_22021 | 255 |
| 237 | 3300039447 | Ga0436361_0709256 | Ga0436361_0709256_94_885 | 255 |
| 238 | 3300039447 | Ga0436361_0796719 | Ga0436361_0796719_381_1172 | 255 |
| 239 | 3300039447 | Ga0436361_0847263 | Ga0436361_0847263_2183_2974 | 255 |
| 240 | 3300045976 | Ga0466967_0005600 | Ga0466967_0005600_3984_4772 | 255 |
| 241 | 3300046471 | Ga0495650_0020222 | Ga0495650_0020222_1187_1966 | 255 |
| 242 | 3300046472 | Ga0495580_0042287 | Ga0495580_0042287_491_1282 | 255 |
| 243 | 3300046472 | Ga0495580_0062255 | Ga0495580_0062255_1572_2351 | 255 |
| 244 | 3300046492 | Ga0495585_0024073 | Ga0495585_0024073_2097_2876 | 255 |
| 245 | 3300046499 | Ga0495594_0061645 | Ga0495594_0061645_414_1193 | 255 |
| 246 | 3300046507 | Ga0495606_0114219 | Ga0495606_0114219_691_1458 | 255 |
| 247 | 3300046518 | Ga0495631_0018698 | Ga0495631_0018698_1121_1900 | 255 |
| 248 | 3300046522 | Ga0495643_0024925 | Ga0495643_0024925_1622_2389 | 255 |
| 249 | 3300046523 | Ga0495644_0000269 | Ga0495644_0000269_3685_4464 | 255 |
| 250 | 3300046538 | Ga0495609_0110110 | Ga0495609_0110110_399_1178 | 255 |
| 251 | 3300046558 | Ga0495633_0102615 | Ga0495633_0102615_497_1276 | 255 |
| 252 | 3300046660 | Ga0495625_0015473 | Ga0495625_0015473_1939_2718 | 255 |
| 253 | 3300046660 | Ga0495625_0021047 | Ga0495625_0021047_1490_2266 | 255 |
| 254 | 3300046660 | Ga0495625_0073368 | Ga0495625_0073368_31_810 | 255 |
| 255 | 3300046684 | Ga0495669_0037658 | Ga0495669_0037658_501_1280 | 255 |
| 256 | 3300046694 | Ga0495649_0035209 | Ga0495649_0035209_275_1042 | 255 |
| 257 | 3300047323 | Ga0495683_0033846 | Ga0495683_0033846_1527_2306 | 255 |
| 258 | 3300048903 | Ga0496100_0128956 | Ga0496100_0128956_138_929 | 255 |
| 259 | 3300048905 | Ga0496102_0097471 | Ga0496102_0097471_1592_2383 | 255 |
| 260 | 3300048905 | Ga0496102_0201572 | Ga0496102_0201572_867_1667 | 255 |
| 261 | 3300048907 | Ga0496104_0173009 | Ga0496104_0173009_863_1654 | 255 |
| 262 | 3300048908 | Ga0496105_0134795 | Ga0496105_0134795_202_993 | 255 |
| 263 | 3300048911 | Ga0496108_0021134 | Ga0496108_0021134_183_974 | 255 |
| 264 | 3300048913 | Ga0496110_0057290 | Ga0496110_0057290_697_1488 | 255 |
| 265 | 3300048914 | Ga0496111_0032608 | Ga0496111_0032608_1278_2069 | 255 |
| 266 | 3300048915 | Ga0496112_0064807 | Ga0496112_0064807_1898_2698 | 255 |
| 267 | 3300048916 | Ga0496113_0181319 | Ga0496113_0181319_144_935 | 255 |
| 268 | 3300053093 | Ga0500651_0000004 | Ga0500651_0000004_96526_97305 | 255 |
| 269 | 3300055283 | Ga0500661_007095 | Ga0500661_007095_462_1241 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ykp-assembly1.cif.gz_C | structure of unplugged c. jejuni motab | 0.9271 | 1 | 244 |
| 8gqy-assembly1.cif.gz_A | cryoem structure of pentameric mota from aquifex aeolicus | 0.9227 | 1 | 247 |
| 8brd-assembly1.cif.gz_B | mechanisms of ion selectivity and rotor coupling in the bacterial flagellar sodium-driven stator unit | 0.9089 | 22 | 253 |
| 8gqy-assembly1.cif.gz_A | cryoem structure of pentameric mota from aquifex aeolicus | 0.8984 | 1 | 247 |
| 8brd-assembly1.cif.gz_B | mechanisms of ion selectivity and rotor coupling in the bacterial flagellar sodium-driven stator unit | 0.8951 | 22 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P09348_118_240_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.8824 | 107 | 219 | 1.20.58.220 |
| af_P09348_118_240_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.8109 | 107 | 219 | 1.20.58.220 |
| af_P90947_501_646_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4928 | 136 | 247 | 1.20.120.230 |
| af_Q95QP1_12_303_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4637 | 141 | 225 | 1.20.1070.10 |
| 3tulC00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.4367 | 96 | 213 | 1.20.120.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D7X833-F1-model_v4 | Flagellar motor protein | 0.9866 | 4 | 244 |
GO:0005886
GO:0006935 GO:0015031 GO:0071978 |
| AF-A0A6I1KIQ2-F1-model_v4 | Chemotaxis protein | 0.9797 | 27 | 247 |
GO:0005886
GO:0006935 GO:0071978 |
| AF-A0A5M8SWP5-F1-model_v4 | Flagellar motor protein | 0.9759 | 1 | 244 |
GO:0005886
GO:0006935 GO:0015031 GO:0071978 |
| AF-A0A2S5FHG4-F1-model_v4 | Flagellar motor protein | 0.9756 | 8 | 247 |
GO:0005886
GO:0006935 GO:0015031 GO:0071978 |
| AF-A0A4R6G827-F1-model_v4 | Chemotaxis protein MotA | 0.9755 | 1 | 245 |
GO:0005886
GO:0006935 GO:0015031 GO:0071978 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar