F376288

General Info

Members Datasets Scaffolds Average Seq Length
269 176 269 248

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10096598|Ga0265338_100965983
Length 270
Sequence VDKSSFGGVFVALGGILLGLVLEGGKIGQILQPTAALIVFGGTLGAVMLQFPLPIMLEAFGSLARVFFETGEDPRLVLKEMIGYAQKARKSGIVSLDDDLEEIEEPFLKKTLMLAVDGTEPAELRSIMQLELDNRADHDDNIPRVFESAGGFSPTIGIIGAVLGLIQVMQHLDNIGEVGRGIAVAFVATIYGVGAANLFFLPASGKLKLRYREEQLRHEIILEGVVSILEGMNPRMLETKLLSFISERQQKAEQKAGKSEQKEATRAFQS

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 7.43
Rhizosphere 91.08
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10011223 3300003316 Bacteria 3381
2 Ga0070658_10160078 3300005327 Bacteria 1888
3 Ga0070658_10162803 3300005327 Bacteria 1872
4 Ga0070670_100329304 3300005331 Bacteria 1339
5 Ga0070670_100752654 3300005331 Bacteria 878
6 Ga0070680_100090186 3300005336 Bacteria 2537
7 Ga0070680_100100105 3300005336 Bacteria 2405
8 Ga0070680_100150720 3300005336 Bacteria 1952
9 Ga0068868_100052795 3300005338 Bacteria 3200
10 Ga0070660_100042996 3300005339 Bacteria 3451
11 Ga0070660_100148414 3300005339 Bacteria 1884
12 Ga0070661_100023683 3300005344 Bacteria 4403
13 Ga0070671_100001640 3300005355 Bacteria 16908
14 Ga0070667_100075748 3300005367 Bacteria 2873
15 Ga0070714_100151412 3300005435 Bacteria 2091
16 Ga0070713_100112328 3300005436 Bacteria 2377
17 Ga0070713_100197302 3300005436 Bacteria 1816
18 Ga0070678_100333394 3300005456 Bacteria 1299
19 Ga0070662_100031409 3300005457 Bacteria 3727
20 Ga0070681_10043221 3300005458 Bacteria 4514
21 Ga0070681_10254226 3300005458 Bacteria 1669
22 Ga0068867_100148817 3300005459 Bacteria 1837
23 Ga0070679_100006946 3300005530 Bacteria 10559
24 Ga0070679_100165465 3300005530 Bacteria 2185
25 Ga0068853_100215271 3300005539 Bacteria 1752
26 Ga0070665_100012812 3300005548 Bacteria 8443
27 Ga0070665_100035113 3300005548 Bacteria 5041
28 Ga0070664_100397509 3300005564 Bacteria 1260
29 Ga0068856_100110697 3300005614 Bacteria 2743
30 Ga0068852_100027603 3300005616 Bacteria 4629
31 Ga0068864_100073071 3300005618 Bacteria 2990
32 Ga0068851_10079466 3300005834 Bacteria 1710
33 Ga0068863_100018128 3300005841 Bacteria 6741
34 Ga0068858_100020517 3300005842 Bacteria 6175
35 Ga0068860_100048541 3300005843 Bacteria 4045
36 Ga0068862_100048378 3300005844 Bacteria 3630
37 Ga0081540_1021290 3300005983 Bacteria 3868
38 Ga0070717_10296230 3300006028 Bacteria 1437
39 Ga0070712_100067486 3300006175 Bacteria 2545
40 Ga0097621_100040506 3300006237 Bacteria 3746
41 Ga0068871_100002024 3300006358 Bacteria 13726
42 Ga0105240_10195724 3300009093 Bacteria 2374
43 Ga0105240_10547286 3300009093 Bacteria 1281
44 Ga0105245_10002914 3300009098 Bacteria 15354
45 Ga0105243_10042411 3300009148 Bacteria 3562
46 Ga0105241_10002023 3300009174 Bacteria 15325
47 Ga0105241_10156717 3300009174 Bacteria 1868
48 Ga0105241_10166478 3300009174 Bacteria 1817
49 Ga0105242_10079012 3300009176 Bacteria 2747
50 Ga0105248_10000006 3300009177 Bacteria 595060
51 Ga0105248_10001945 3300009177 Bacteria 22950
52 Ga0105248_10011206 3300009177 Bacteria 9889
53 Ga0105248_10064976 3300009177 Bacteria 4096
54 Ga0105248_10374777 3300009177 Bacteria 1602
55 Ga0105237_10205973 3300009545 Bacteria 1967
56 Ga0105237_10854205 3300009545 Unclassified 917
57 Ga0105238_10640493 3300009551 Bacteria 1073
58 Ga0105239_10760452 3300010375 Bacteria 1109
59 Ga0157373_10002384 3300013100 Bacteria 14270
60 Ga0157373_10078621 3300013100 Bacteria 2326
61 Ga0157371_10245307 3300013102 Bacteria 1289
62 Ga0157369_10046702 3300013105 Bacteria 4706
63 Ga0157369_10074328 3300013105 Bacteria 3645
64 Ga0157374_10107753 3300013296 Bacteria 2678
65 Ga0157374_10256840 3300013296 Bacteria 1720
66 Ga0157374_10321184 3300013296 Bacteria 1534
67 Ga0157378_10001149 3300013297 Bacteria 24055
68 Ga0157378_10406633 3300013297 Bacteria 1342
69 Ga0163162_10193815 3300013306 Bacteria 2160
70 Ga0163162_10219507 3300013306 Bacteria 2031
71 Ga0163162_10252860 3300013306 Bacteria 1894
72 Ga0163162_10289406 3300013306 Bacteria 1770
73 Ga0157372_10004805 3300013307 Bacteria 14358
74 Ga0157375_10519321 3300013308 Bacteria 1354
75 Ga0163163_10019530 3300014325 Bacteria 6365
76 Ga0163163_10086277 3300014325 Bacteria 3148
77 Ga0182008_10025972 3300014497 Bacteria 2972
78 Ga0157379_10030283 3300014968 Bacteria 4816
79 Ga0157376_10039173 3300014969 Bacteria 3863
80 Ga0157376_10157679 3300014969 Bacteria 2054
81 Ga0213872_10081122 3300021361 Bacteria 1457
82 Ga0213871_10000428 3300021441 Bacteria 5634
83 Ga0224572_1019600 3300024225 Unclassified 1300
84 Ga0228598_1000165 3300024227 Bacteria 11648
85 Ga0207680_10069258 3300025903 Bacteria 2179
86 Ga0207647_10013077 3300025904 Bacteria 5767
87 Ga0207654_10002153 3300025911 Bacteria 10086
88 Ga0207654_10103601 3300025911 Bacteria 1757
89 Ga0207707_10208312 3300025912 Bacteria 1704
90 Ga0207695_10042423 3300025913 Bacteria 4859
91 Ga0207695_10044413 3300025913 Bacteria 4727
92 Ga0207671_10122828 3300025914 Bacteria 1986
93 Ga0207660_10060866 3300025917 Bacteria 2716
94 Ga0207660_10177672 3300025917 Bacteria 1651
95 Ga0207657_10001059 3300025919 Bacteria 29185
96 Ga0207657_10054273 3300025919 Bacteria 3466
97 Ga0207649_10253981 3300025920 Bacteria 1267
98 Ga0207652_10060225 3300025921 Unclassified 3275
99 Ga0207652_10170364 3300025921 Bacteria 1954
100 Ga0207652_10223374 3300025921 Unclassified 1697
101 Ga0207650_10673253 3300025925 Bacteria 873
102 Ga0207700_10213228 3300025928 Bacteria 1634
103 Ga0207664_10013934 3300025929 Bacteria 5794
104 Ga0207664_10130896 3300025929 Bacteria 2112
105 Ga0207644_10020587 3300025931 Bacteria 4487
106 Ga0207706_10046846 3300025933 Bacteria 3827
107 Ga0207709_10112305 3300025935 Bacteria 1824
108 Ga0207711_10000007 3300025941 Bacteria 759410
109 Ga0207711_10130821 3300025941 Bacteria 2250
110 Ga0207667_10003154 3300025949 Bacteria 20397
111 Ga0207658_10117231 3300025986 Bacteria 2116
112 Ga0207658_10395406 3300025986 Bacteria 1214
113 Ga0207677_10041165 3300026023 Bacteria 3053
114 Ga0207703_10303805 3300026035 Bacteria 1456
115 Ga0207639_10090709 3300026041 Bacteria 2445
116 Ga0207702_10080297 3300026078 Bacteria 2829
117 Ga0207702_10868490 3300026078 Unclassified 893
118 Ga0207641_10015395 3300026088 Bacteria 6266
119 Ga0207676_10062346 3300026095 Bacteria 2957
120 Ga0207674_10413323 3300026116 Bacteria 1304
121 Ga0209179_1018332 3300027512 Bacteria 1336
122 Ga0265356_1005072 3300028017 Bacteria 1587
123 Ga0268266_10056662 3300028379 Bacteria 3371
124 Ga0268265_10024571 3300028380 Bacteria 4265
125 Ga0268264_10029173 3300028381 Bacteria 4518
126 Ga0265319_1002179 3300028563 Bacteria 10911
127 Ga0265334_10026345 3300028573 Bacteria 2347
128 Ga0265318_10000195 3300028577 Bacteria 53122
129 Ga0265318_10000373 3300028577 Bacteria 35154
130 Ga0265318_10011236 3300028577 Bacteria 3862
131 Ga0265338_10001159 3300028800 Bacteria 43561
132 Ga0265338_10010307 3300028800 Bacteria 10981
133 Ga0265338_10020637 3300028800 Bacteria 6918
134 Ga0265338_10031937 3300028800 Bacteria 5151
135 Ga0265338_10096598 3300028800 Bacteria 2423
136 Ga0265338_10227273 3300028800 Bacteria 1390
137 Ga0265338_10244665 3300028800 Bacteria 1326
138 Ga0265338_10450721 3300028800 Unclassified 911
139 Ga0265762_1000279 3300030760 Bacteria 8515
140 Ga0265770_1004513 3300030878 Bacteria 1901
141 Ga0265760_10001627 3300031090 Bacteria 6602
142 Ga0265330_10000194 3300031235 Bacteria 47211
143 Ga0265332_10012002 3300031238 Bacteria 3847
144 Ga0265332_10029749 3300031238 Bacteria 2387
145 Ga0265328_10002414 3300031239 Bacteria 8385
146 Ga0265328_10034802 3300031239 Bacteria 1864
147 Ga0265328_10087155 3300031239 Bacteria 1153
148 Ga0265320_10000070 3300031240 Bacteria 90235
149 Ga0265320_10001141 3300031240 Bacteria 19544
150 Ga0265320_10016032 3300031240 Bacteria 4212
151 Ga0265325_10000805 3300031241 Bacteria 22687
152 Ga0265325_10003067 3300031241 Bacteria 11035
153 Ga0265325_10009940 3300031241 Bacteria 5533
154 Ga0265325_10012164 3300031241 Bacteria 4926
155 Ga0265325_10116796 3300031241 Bacteria 1290
156 Ga0265329_10000495 3300031242 Bacteria 20369
157 Ga0265329_10004749 3300031242 Bacteria 5593
158 Ga0265329_10018080 3300031242 Bacteria 2414
159 Ga0265340_10000490 3300031247 Bacteria 21639
160 Ga0265340_10006662 3300031247 Bacteria 6332
161 Ga0265340_10117450 3300031247 Bacteria 1225
162 Ga0265339_10004730 3300031249 Bacteria 9222
163 Ga0265339_10008222 3300031249 Bacteria 6652
164 Ga0265339_10019442 3300031249 Bacteria 3988
165 Ga0265339_10085121 3300031249 Bacteria 1665
166 Ga0265339_10100281 3300031249 Bacteria 1508
167 Ga0265331_10000198 3300031250 Bacteria 73807
168 Ga0265331_10000527 3300031250 Bacteria 35289
169 Ga0265331_10078419 3300031250 Unclassified 1538
170 Ga0265316_10002424 3300031344 Bacteria 19382
171 Ga0265316_10002535 3300031344 Bacteria 18875
172 Ga0265316_10036158 3300031344 Unclassified 3994
173 Ga0265316_10040634 3300031344 Unclassified 3727
174 Ga0265316_10137186 3300031344 Bacteria 1840
175 Ga0265313_10001765 3300031595 Bacteria 19817
176 Ga0265313_10002197 3300031595 Bacteria 17268
177 Ga0265313_10074286 3300031595 Bacteria 1559
178 Ga0265314_10002761 3300031711 Bacteria 17542
179 Ga0265314_10092329 3300031711 Unclassified 1968
180 Ga0265342_10000433 3300031712 Bacteria 45864
181 Ga0265342_10002718 3300031712 Bacteria 15059
182 Ga0265342_10011332 3300031712 Bacteria 6112
183 Ga0265342_10034135 3300031712 Bacteria 3122
184 Ga0265342_10219409 3300031712 Bacteria 1025
185 Ga0316583_10033834 3300032133 Bacteria 1815
186 Ga0373926_0111285 3300035083 Bacteria 1029
187 Ga0373936_0173099 3300035113 Bacteria 944
188 Ga0373931_0010192 3300035691 Bacteria 4513
189 Ga0373927_0262312 3300035695 Bacteria 1136
190 Ga0373925_0059290 3300037068 Bacteria 2871
191 Ga0395900_0052051 3300037418 Bacteria 4216
192 Ga0436360_0638428 3300039438 Bacteria 11768
193 Ga0436360_1346785 3300039438 Bacteria 1461
194 Ga0436361_0133332 3300039447 Bacteria 25694
195 Ga0436361_0409396 3300039447 Bacteria 31269
196 Ga0436361_0709256 3300039447 Bacteria 999
197 Ga0436361_0796719 3300039447 Bacteria 1737
198 Ga0436361_0847263 3300039447 Bacteria 7057
199 Ga0436361_1061564 3300039447 Bacteria 8919
200 Ga0466964_0028394 3300044706 Bacteria 2204
201 Ga0466967_0005600 3300045976 Bacteria 8735
202 Ga0495651_0005607 3300046462 Bacteria 9568
203 Ga0495653_0072672 3300046463 Bacteria 2568
204 Ga0495650_0020222 3300046471 Bacteria 3251
205 Ga0495580_0042287 3300046472 Bacteria 3247
206 Ga0495580_0062255 3300046472 Bacteria 2618
207 Ga0495585_0024073 3300046492 Bacteria 3493
208 Ga0495594_0061645 3300046499 Bacteria 2076
209 Ga0495583_0094773 3300046506 Bacteria 1281
210 Ga0495606_0114219 3300046507 Bacteria 1625
211 Ga0495608_0281912 3300046511 Bacteria 1031
212 Ga0495630_0025947 3300046517 Bacteria 4336
213 Ga0495631_0018698 3300046518 Bacteria 3259
214 Ga0495643_0024925 3300046522 Bacteria 3389
215 Ga0495644_0000269 3300046523 Bacteria 23871
216 Ga0495665_0001586 3300046531 Bacteria 12163
217 Ga0495586_0007810 3300046535 Bacteria 5705
218 Ga0495609_0110110 3300046538 Bacteria 1189
219 Ga0495633_0102615 3300046558 Bacteria 1327
220 Ga0495625_0015473 3300046660 Bacteria 6042
221 Ga0495625_0021047 3300046660 Bacteria 5028
222 Ga0495625_0073368 3300046660 Bacteria 2399
223 Ga0495657_0016404 3300046675 Bacteria 5397
224 Ga0495599_0197639 3300046678 Bacteria 1236
225 Ga0495669_0037658 3300046684 Bacteria 2141
226 Ga0495613_0037798 3300046689 Bacteria 3579
227 Ga0495624_0241677 3300046690 Bacteria 1093
228 Ga0495649_0035209 3300046694 Bacteria 2754
229 Ga0495604_0007573 3300047317 Bacteria 8593
230 Ga0495674_0025824 3300047319 Bacteria 5378
231 Ga0495683_0033846 3300047323 Bacteria 2599
232 Ga0495675_0073916 3300047444 Bacteria 2149
233 Ga0495684_0354936 3300047471 Bacteria 1040
234 Ga0495602_0027409 3300048088 Bacteria 5474
235 Ga0496100_0128956 3300048903 Bacteria 1779
236 Ga0496102_0000525 3300048905 Bacteria 41568
237 Ga0496102_0097471 3300048905 Bacteria 2727
238 Ga0496102_0201572 3300048905 Bacteria 1876
239 Ga0496103_0039966 3300048906 Bacteria 2883
240 Ga0496104_0021470 3300048907 Bacteria 5927
241 Ga0496104_0173009 3300048907 Bacteria 2070
242 Ga0496104_0272596 3300048907 Bacteria 1605
243 Ga0496105_0134795 3300048908 Bacteria 2035
244 Ga0496106_0143171 3300048909 Bacteria 1881
245 Ga0496107_0133352 3300048910 Bacteria 1834
246 Ga0496107_0162233 3300048910 Bacteria 1657
247 Ga0496108_0021134 3300048911 Bacteria 5348
248 Ga0496110_0057290 3300048913 Bacteria 3430
249 Ga0496111_0032608 3300048914 Bacteria 3714
250 Ga0496112_0064807 3300048915 Bacteria 3606
251 Ga0496112_0725085 3300048915 Bacteria 921
252 Ga0496112_0881392 3300048915 Unclassified 817
253 Ga0496113_0181319 3300048916 Bacteria 1669
254 Ga0496113_0349635 3300048916 Bacteria 1186
255 Ga0501032_0044219 3300049569 Bacteria 3015
256 Ga0501033_0010077 3300049570 Bacteria 7251
257 Ga0501034_0008246 3300049571 Bacteria 11032
258 Ga0501036_0001526 3300049572 Bacteria 17871
259 Ga0501039_0131529 3300049575 Bacteria 1964
260 Ga0501043_0004236 3300049579 Bacteria 11695
261 Ga0501046_0012194 3300049580 Bacteria 7324
262 Ga0501047_0018666 3300049581 Bacteria 6650
263 Ga0501070_0180225 3300049586 Bacteria 1739
264 Ga0501073_0091991 3300049589 Bacteria 2108
265 Ga0501074_0099384 3300049590 Bacteria 2083
266 Ga0501035_0009621 3300049822 Bacteria 8989
267 Ga0500651_0000004 3300053093 Bacteria 389879
268 Ga0500595_053627 3300053119 Bacteria 1240
269 Ga0500661_007095 3300055283 Bacteria 2078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10001159 Ga0265338_1000115919 209
2 3300031711 Ga0265314_10002761 Ga0265314_100027615 209
3 3300009174 Ga0105241_10166478 Ga0105241_101664782 212
4 3300009545 Ga0105237_10854205 Ga0105237_108542052 212
5 3300013297 Ga0157378_10406633 Ga0157378_104066331 212
6 3300014968 Ga0157379_10030283 Ga0157379_100302832 212
7 3300025911 Ga0207654_10103601 Ga0207654_101036012 212
8 3300048905 Ga0496102_0000525 Ga0496102_0000525_18770_19555 212
9 3300048906 Ga0496103_0039966 Ga0496103_0039966_1318_2103 212
10 3300048907 Ga0496104_0021470 Ga0496104_0021470_714_1499 212
11 3300048909 Ga0496106_0143171 Ga0496106_0143171_281_1066 212
12 3300048910 Ga0496107_0133352 Ga0496107_0133352_344_1129 212
13 3300031712 Ga0265342_10219409 Ga0265342_102194091 213
14 3300009174 Ga0105241_10156717 Ga0105241_101567172 219
15 3300048916 Ga0496113_0349635 Ga0496113_0349635_26_706 219
16 3300037418 Ga0395900_0052051 Ga0395900_0052051_3266_4072 222
17 3300005338 Ga0068868_100052795 Ga0068868_1000527953 223
18 3300005843 Ga0068860_100048541 Ga0068860_1000485413 223
19 3300006237 Ga0097621_100040506 Ga0097621_1000405063 223
20 3300006358 Ga0068871_100002024 Ga0068871_1000020243 223
21 3300009098 Ga0105245_10002914 Ga0105245_100029148 223
22 3300009176 Ga0105242_10079012 Ga0105242_100790122 223
23 3300013297 Ga0157378_10001149 Ga0157378_1000114918 223
24 3300013308 Ga0157375_10519321 Ga0157375_105193212 223
25 3300014969 Ga0157376_10039173 Ga0157376_100391733 223
26 3300026023 Ga0207677_10041165 Ga0207677_100411653 223
27 3300028381 Ga0268264_10029173 Ga0268264_100291733 223
28 3300028800 Ga0265338_10010307 Ga0265338_100103079 223
29 3300031249 Ga0265339_10004730 Ga0265339_100047308 223
30 3300031344 Ga0265316_10036158 Ga0265316_100361584 223
31 3300013102 Ga0157371_10245307 Ga0157371_102453072 225
32 3300013105 Ga0157369_10074328 Ga0157369_100743283 225
33 3300028563 Ga0265319_1002179 Ga0265319_10021798 227
34 3300028577 Ga0265318_10000373 Ga0265318_100003737 227
35 3300028800 Ga0265338_10227273 Ga0265338_102272731 227
36 3300031240 Ga0265320_10001141 Ga0265320_100011417 227
37 3300031242 Ga0265329_10000495 Ga0265329_100004958 227
38 3300031249 Ga0265339_10019442 Ga0265339_100194422 227
39 3300031250 Ga0265331_10000527 Ga0265331_1000052732 227
40 3300031344 Ga0265316_10002535 Ga0265316_1000253520 227
41 3300031595 Ga0265313_10002197 Ga0265313_100021978 227
42 3300031712 Ga0265342_10002718 Ga0265342_100027188 227
43 3300005842 Ga0068858_100020517 Ga0068858_1000205173 228
44 3300026035 Ga0207703_10303805 Ga0207703_103038051 228
45 3300026041 Ga0207639_10090709 Ga0207639_100907092 228
46 3300014969 Ga0157376_10157679 Ga0157376_101576793 229
47 3300028573 Ga0265334_10026345 Ga0265334_100263452 229
48 3300028577 Ga0265318_10011236 Ga0265318_100112363 229
49 3300028800 Ga0265338_10020637 Ga0265338_100206373 229
50 3300031235 Ga0265330_10000194 Ga0265330_1000019434 229
51 3300031238 Ga0265332_10012002 Ga0265332_100120023 229
52 3300031239 Ga0265328_10002414 Ga0265328_100024144 229
53 3300031240 Ga0265320_10016032 Ga0265320_100160323 229
54 3300031241 Ga0265325_10000805 Ga0265325_1000080516 229
55 3300031242 Ga0265329_10004749 Ga0265329_100047494 229
56 3300031247 Ga0265340_10000490 Ga0265340_100004907 229
57 3300031249 Ga0265339_10008222 Ga0265339_100082226 229
58 3300031250 Ga0265331_10078419 Ga0265331_100784191 229
59 3300031344 Ga0265316_10002424 Ga0265316_100024245 229
60 3300031595 Ga0265313_10001765 Ga0265313_1000176515 229
61 3300031712 Ga0265342_10034135 Ga0265342_100341353 229
62 3300039438 Ga0436360_1346785 Ga0436360_1346785_616_1389 232
63 3300032133 Ga0316583_10033834 Ga0316583_100338342 234
64 3300005327 Ga0070658_10162803 Ga0070658_101628032 235
65 3300005983 Ga0081540_1021290 Ga0081540_10212904 235
66 3300009148 Ga0105243_10042411 Ga0105243_100424112 235
67 3300025935 Ga0207709_10112305 Ga0207709_101123053 235
68 3300030878 Ga0265770_1004513 Ga0265770_10045133 235
69 3300009177 Ga0105248_10000006 Ga0105248_10000006427 236
70 3300009177 Ga0105248_10001945 Ga0105248_1000194518 236
71 3300013306 Ga0163162_10219507 Ga0163162_102195072 236
72 3300025941 Ga0207711_10000007 Ga0207711_10000007257 236
73 3300025941 Ga0207711_10130821 Ga0207711_101308213 236
74 3300046506 Ga0495583_0094773 Ga0495583_0094773_24_746 236
75 3300053119 Ga0500595_053627 Ga0500595_053627_216_989 236
76 3300005336 Ga0070680_100090186 Ga0070680_1000901862 237
77 3300005339 Ga0070660_100042996 Ga0070660_1000429962 237
78 3300005530 Ga0070679_100006946 Ga0070679_1000069469 237
79 3300005616 Ga0068852_100027603 Ga0068852_1000276036 237
80 3300025917 Ga0207660_10060866 Ga0207660_100608664 237
81 3300025921 Ga0207652_10223374 Ga0207652_102233742 237
82 3300026116 Ga0207674_10413323 Ga0207674_104133232 237
83 3300031249 Ga0265339_10100281 Ga0265339_101002812 237
84 3300005336 Ga0070680_100100105 Ga0070680_1001001053 238
85 3300005459 Ga0068867_100148817 Ga0068867_1001488172 238
86 3300025917 Ga0207660_10177672 Ga0207660_101776722 238
87 3300025921 Ga0207652_10060225 Ga0207652_100602253 238
88 3300031241 Ga0265325_10003067 Ga0265325_1000306713 238
89 3300048907 Ga0496104_0272596 Ga0496104_0272596_531_1322 238
90 3300048915 Ga0496112_0725085 Ga0496112_0725085_15_806 238
91 3300035083 Ga0373926_0111285 Ga0373926_0111285_18_800 239
92 3300046462 Ga0495651_0005607 Ga0495651_0005607_5326_6108 239
93 3300046463 Ga0495653_0072672 Ga0495653_0072672_278_1060 239
94 3300046511 Ga0495608_0281912 Ga0495608_0281912_223_1005 239
95 3300046517 Ga0495630_0025947 Ga0495630_0025947_496_1278 239
96 3300046531 Ga0495665_0001586 Ga0495665_0001586_10399_11181 239
97 3300046535 Ga0495586_0007810 Ga0495586_0007810_381_1163 239
98 3300046675 Ga0495657_0016404 Ga0495657_0016404_11_793 239
99 3300046689 Ga0495613_0037798 Ga0495613_0037798_2451_3233 239
100 3300046690 Ga0495624_0241677 Ga0495624_0241677_217_999 239
101 3300047317 Ga0495604_0007573 Ga0495604_0007573_7642_8424 239
102 3300047319 Ga0495674_0025824 Ga0495674_0025824_4302_5084 239
103 3300047444 Ga0495675_0073916 Ga0495675_0073916_1206_1988 239
104 3300047471 Ga0495684_0354936 Ga0495684_0354936_173_955 239
105 3300048088 Ga0495602_0027409 Ga0495602_0027409_200_982 239
106 3300005327 Ga0070658_10160078 Ga0070658_101600783 240
107 3300005336 Ga0070680_100150720 Ga0070680_1001507201 240
108 3300005458 Ga0070681_10043221 Ga0070681_100432215 240
109 3300013105 Ga0157369_10046702 Ga0157369_100467022 240
110 3300025913 Ga0207695_10042423 Ga0207695_100424234 240
111 3300025919 Ga0207657_10054273 Ga0207657_100542732 240
112 3300025949 Ga0207667_10003154 Ga0207667_1000315412 240
113 3300046678 Ga0495599_0197639 Ga0495599_0197639_100_873 240
114 3300005331 Ga0070670_100329304 Ga0070670_1003293043 241
115 3300005548 Ga0070665_100035113 Ga0070665_1000351132 241
116 3300031239 Ga0265328_10034802 Ga0265328_100348022 241
117 3300031247 Ga0265340_10006662 Ga0265340_100066625 241
118 3300031249 Ga0265339_10085121 Ga0265339_100851212 241
119 3300031712 Ga0265342_10011332 Ga0265342_100113323 241
120 3300039447 Ga0436361_1061564 Ga0436361_1061564_4370_5161 241
121 3300044706 Ga0466964_0028394 Ga0466964_0028394_835_1626 241
122 3300005435 Ga0070714_100151412 Ga0070714_1001514121 242
123 3300005436 Ga0070713_100197302 Ga0070713_1001973023 242
124 3300005844 Ga0068862_100048378 Ga0068862_1000483783 242
125 3300006028 Ga0070717_10296230 Ga0070717_102962302 242
126 3300013296 Ga0157374_10256840 Ga0157374_102568403 242
127 3300013306 Ga0163162_10193815 Ga0163162_101938152 242
128 3300025928 Ga0207700_10213228 Ga0207700_102132281 242
129 3300025929 Ga0207664_10130896 Ga0207664_101308961 242
130 3300028380 Ga0268265_10024571 Ga0268265_100245713 242
131 3300048910 Ga0496107_0162233 Ga0496107_0162233_55_810 243
132 3300048915 Ga0496112_0881392 Ga0496112_0881392_38_793 243
133 3300009093 Ga0105240_10195724 Ga0105240_101957242 246
134 3300025913 Ga0207695_10044413 Ga0207695_100444132 246
135 3300024225 Ga0224572_1019600 Ga0224572_10196003 247
136 3300024227 Ga0228598_1000165 Ga0228598_10001657 247
137 3300028800 Ga0265338_10450721 Ga0265338_104507212 247
138 3300049569 Ga0501032_0044219 Ga0501032_0044219_619_1398 250
139 3300049570 Ga0501033_0010077 Ga0501033_0010077_6360_7139 250
140 3300049571 Ga0501034_0008246 Ga0501034_0008246_9589_10368 250
141 3300049572 Ga0501036_0001526 Ga0501036_0001526_12107_12886 250
142 3300049575 Ga0501039_0131529 Ga0501039_0131529_117_896 250
143 3300049579 Ga0501043_0004236 Ga0501043_0004236_10619_11398 250
144 3300049580 Ga0501046_0012194 Ga0501046_0012194_6433_7212 250
145 3300049581 Ga0501047_0018666 Ga0501047_0018666_3231_4010 250
146 3300049586 Ga0501070_0180225 Ga0501070_0180225_607_1386 250
147 3300049589 Ga0501073_0091991 Ga0501073_0091991_666_1445 250
148 3300049590 Ga0501074_0099384 Ga0501074_0099384_341_1120 250
149 3300049822 Ga0501035_0009621 Ga0501035_0009621_5573_6352 250
150 3300028577 Ga0265318_10000195 Ga0265318_1000019524 251
151 3300028800 Ga0265338_10031937 Ga0265338_100319374 251
152 3300031238 Ga0265332_10029749 Ga0265332_100297492 251
153 3300031239 Ga0265328_10087155 Ga0265328_100871552 251
154 3300031240 Ga0265320_10000070 Ga0265320_1000007011 251
155 3300031241 Ga0265325_10009940 Ga0265325_100099405 251
156 3300031242 Ga0265329_10018080 Ga0265329_100180802 251
157 3300031247 Ga0265340_10117450 Ga0265340_101174502 251
158 3300031250 Ga0265331_10000198 Ga0265331_1000019857 251
159 3300031344 Ga0265316_10040634 Ga0265316_100406343 251
160 3300031344 Ga0265316_10137186 Ga0265316_101371861 251
161 3300031711 Ga0265314_10092329 Ga0265314_100923292 251
162 3300031712 Ga0265342_10000433 Ga0265342_1000043329 251
163 3300003316 rootH1_10011223 rootH1_100112233 255
164 3300005331 Ga0070670_100752654 Ga0070670_1007526541 255
165 3300005339 Ga0070660_100148414 Ga0070660_1001484142 255
166 3300005344 Ga0070661_100023683 Ga0070661_1000236836 255
167 3300005355 Ga0070671_100001640 Ga0070671_10000164010 255
168 3300005367 Ga0070667_100075748 Ga0070667_1000757483 255
169 3300005436 Ga0070713_100112328 Ga0070713_1001123283 255
170 3300005456 Ga0070678_100333394 Ga0070678_1003333942 255
171 3300005457 Ga0070662_100031409 Ga0070662_1000314093 255
172 3300005458 Ga0070681_10254226 Ga0070681_102542263 255
173 3300005530 Ga0070679_100165465 Ga0070679_1001654653 255
174 3300005539 Ga0068853_100215271 Ga0068853_1002152712 255
175 3300005548 Ga0070665_100012812 Ga0070665_1000128123 255
176 3300005564 Ga0070664_100397509 Ga0070664_1003975092 255
177 3300005614 Ga0068856_100110697 Ga0068856_1001106971 255
178 3300005618 Ga0068864_100073071 Ga0068864_1000730712 255
179 3300005834 Ga0068851_10079466 Ga0068851_100794662 255
180 3300005841 Ga0068863_100018128 Ga0068863_1000181281 255
181 3300006175 Ga0070712_100067486 Ga0070712_1000674861 255
182 3300009093 Ga0105240_10547286 Ga0105240_105472862 255
183 3300009174 Ga0105241_10002023 Ga0105241_1000202310 255
184 3300009177 Ga0105248_10011206 Ga0105248_1001120610 255
185 3300009177 Ga0105248_10064976 Ga0105248_100649764 255
186 3300009177 Ga0105248_10374777 Ga0105248_103747773 255
187 3300009545 Ga0105237_10205973 Ga0105237_102059732 255
188 3300009551 Ga0105238_10640493 Ga0105238_106404931 255
189 3300010375 Ga0105239_10760452 Ga0105239_107604522 255
190 3300013100 Ga0157373_10002384 Ga0157373_100023848 255
191 3300013100 Ga0157373_10078621 Ga0157373_100786212 255
192 3300013296 Ga0157374_10107753 Ga0157374_101077532 255
193 3300013296 Ga0157374_10321184 Ga0157374_103211842 255
194 3300013306 Ga0163162_10252860 Ga0163162_102528601 255
195 3300013306 Ga0163162_10289406 Ga0163162_102894062 255
196 3300013307 Ga0157372_10004805 Ga0157372_100048056 255
197 3300014325 Ga0163163_10019530 Ga0163163_100195302 255
198 3300014325 Ga0163163_10086277 Ga0163163_100862774 255
199 3300014497 Ga0182008_10025972 Ga0182008_100259723 255
200 3300021361 Ga0213872_10081122 Ga0213872_100811222 255
201 3300021441 Ga0213871_10000428 Ga0213871_100004285 255
202 3300025903 Ga0207680_10069258 Ga0207680_100692582 255
203 3300025904 Ga0207647_10013077 Ga0207647_100130773 255
204 3300025911 Ga0207654_10002153 Ga0207654_100021538 255
205 3300025912 Ga0207707_10208312 Ga0207707_102083121 255
206 3300025914 Ga0207671_10122828 Ga0207671_101228283 255
207 3300025919 Ga0207657_10001059 Ga0207657_100010599 255
208 3300025920 Ga0207649_10253981 Ga0207649_102539812 255
209 3300025921 Ga0207652_10170364 Ga0207652_101703643 255
210 3300025925 Ga0207650_10673253 Ga0207650_106732532 255
211 3300025929 Ga0207664_10013934 Ga0207664_100139344 255
212 3300025931 Ga0207644_10020587 Ga0207644_100205874 255
213 3300025933 Ga0207706_10046846 Ga0207706_100468465 255
214 3300025986 Ga0207658_10117231 Ga0207658_101172312 255
215 3300025986 Ga0207658_10395406 Ga0207658_103954062 255
216 3300026078 Ga0207702_10080297 Ga0207702_100802972 255
217 3300026078 Ga0207702_10868490 Ga0207702_108684901 255
218 3300026088 Ga0207641_10015395 Ga0207641_100153952 255
219 3300026095 Ga0207676_10062346 Ga0207676_100623463 255
220 3300027512 Ga0209179_1018332 Ga0209179_10183322 255
221 3300028017 Ga0265356_1005072 Ga0265356_10050721 255
222 3300028379 Ga0268266_10056662 Ga0268266_100566624 255
223 3300028800 Ga0265338_10096598 Ga0265338_100965983 255
224 3300028800 Ga0265338_10244665 Ga0265338_102446652 255
225 3300030760 Ga0265762_1000279 Ga0265762_10002796 255
226 3300031090 Ga0265760_10001627 Ga0265760_100016273 255
227 3300031241 Ga0265325_10012164 Ga0265325_100121645 255
228 3300031241 Ga0265325_10116796 Ga0265325_101167962 255
229 3300031595 Ga0265313_10074286 Ga0265313_100742862 255
230 3300035113 Ga0373936_0173099 Ga0373936_0173099_125_928 255
231 3300035691 Ga0373931_0010192 Ga0373931_0010192_130_930 255
232 3300035695 Ga0373927_0262312 Ga0373927_0262312_196_987 255
233 3300037068 Ga0373925_0059290 Ga0373925_0059290_1542_2345 255
234 3300039438 Ga0436360_0638428 Ga0436360_0638428_7447_8238 255
235 3300039447 Ga0436361_0133332 Ga0436361_0133332_9096_9887 255
236 3300039447 Ga0436361_0409396 Ga0436361_0409396_21230_22021 255
237 3300039447 Ga0436361_0709256 Ga0436361_0709256_94_885 255
238 3300039447 Ga0436361_0796719 Ga0436361_0796719_381_1172 255
239 3300039447 Ga0436361_0847263 Ga0436361_0847263_2183_2974 255
240 3300045976 Ga0466967_0005600 Ga0466967_0005600_3984_4772 255
241 3300046471 Ga0495650_0020222 Ga0495650_0020222_1187_1966 255
242 3300046472 Ga0495580_0042287 Ga0495580_0042287_491_1282 255
243 3300046472 Ga0495580_0062255 Ga0495580_0062255_1572_2351 255
244 3300046492 Ga0495585_0024073 Ga0495585_0024073_2097_2876 255
245 3300046499 Ga0495594_0061645 Ga0495594_0061645_414_1193 255
246 3300046507 Ga0495606_0114219 Ga0495606_0114219_691_1458 255
247 3300046518 Ga0495631_0018698 Ga0495631_0018698_1121_1900 255
248 3300046522 Ga0495643_0024925 Ga0495643_0024925_1622_2389 255
249 3300046523 Ga0495644_0000269 Ga0495644_0000269_3685_4464 255
250 3300046538 Ga0495609_0110110 Ga0495609_0110110_399_1178 255
251 3300046558 Ga0495633_0102615 Ga0495633_0102615_497_1276 255
252 3300046660 Ga0495625_0015473 Ga0495625_0015473_1939_2718 255
253 3300046660 Ga0495625_0021047 Ga0495625_0021047_1490_2266 255
254 3300046660 Ga0495625_0073368 Ga0495625_0073368_31_810 255
255 3300046684 Ga0495669_0037658 Ga0495669_0037658_501_1280 255
256 3300046694 Ga0495649_0035209 Ga0495649_0035209_275_1042 255
257 3300047323 Ga0495683_0033846 Ga0495683_0033846_1527_2306 255
258 3300048903 Ga0496100_0128956 Ga0496100_0128956_138_929 255
259 3300048905 Ga0496102_0097471 Ga0496102_0097471_1592_2383 255
260 3300048905 Ga0496102_0201572 Ga0496102_0201572_867_1667 255
261 3300048907 Ga0496104_0173009 Ga0496104_0173009_863_1654 255
262 3300048908 Ga0496105_0134795 Ga0496105_0134795_202_993 255
263 3300048911 Ga0496108_0021134 Ga0496108_0021134_183_974 255
264 3300048913 Ga0496110_0057290 Ga0496110_0057290_697_1488 255
265 3300048914 Ga0496111_0032608 Ga0496111_0032608_1278_2069 255
266 3300048915 Ga0496112_0064807 Ga0496112_0064807_1898_2698 255
267 3300048916 Ga0496113_0181319 Ga0496113_0181319_144_935 255
268 3300053093 Ga0500651_0000004 Ga0500651_0000004_96526_97305 255
269 3300055283 Ga0500661_007095 Ga0500661_007095_462_1241 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

99

220

0.95

PF20560

MotA_N

Motility protein A N-terminal

6

92

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ykp-assembly1.cif.gz_C structure of unplugged c. jejuni motab 0.9271 1 244
8gqy-assembly1.cif.gz_A cryoem structure of pentameric mota from aquifex aeolicus 0.9227 1 247
8brd-assembly1.cif.gz_B mechanisms of ion selectivity and rotor coupling in the bacterial flagellar sodium-driven stator unit 0.9089 22 253
8gqy-assembly1.cif.gz_A cryoem structure of pentameric mota from aquifex aeolicus 0.8984 1 247
8brd-assembly1.cif.gz_B mechanisms of ion selectivity and rotor coupling in the bacterial flagellar sodium-driven stator unit 0.8951 22 253
ID Description Score Start End Superfamily
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.8824 107 219 1.20.58.220
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.8109 107 219 1.20.58.220
af_P90947_501_646_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4928 136 247 1.20.120.230
af_Q95QP1_12_303_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4637 141 225 1.20.1070.10
3tulC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4367 96 213 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A7D7X833-F1-model_v4 Flagellar motor protein 0.9866 4 244 GO:0005886
GO:0006935
GO:0015031
GO:0071978
AF-A0A6I1KIQ2-F1-model_v4 Chemotaxis protein 0.9797 27 247 GO:0005886
GO:0006935
GO:0071978
AF-A0A5M8SWP5-F1-model_v4 Flagellar motor protein 0.9759 1 244 GO:0005886
GO:0006935
GO:0015031
GO:0071978
AF-A0A2S5FHG4-F1-model_v4 Flagellar motor protein 0.9756 8 247 GO:0005886
GO:0006935
GO:0015031
GO:0071978
AF-A0A4R6G827-F1-model_v4 Chemotaxis protein MotA 0.9755 1 245 GO:0005886
GO:0006935
GO:0015031
GO:0071978

Feature Viewer

pLDDT pTM Quality
80.14 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map