F376221

General Info

Members Datasets Scaffolds Average Seq Length
269 150 260 353

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10045367|Ga0157379_100453672
Length 397
Sequence MYKKHWAHYISDNDDCIKTMSHLGMKNKFLMICFLFGMTISFFSCANKKNDPMNGPPPPAAVNAEIAERGKAVYFDEYPATVAALNQNDLRAQVTGYITGIYFKDGQRVQQGQKLYDIDKRQYQASLDQAVANLNVTKANLAKAQQDADRYADLLKQDAVARQLYDHAKADLETAKMQMEAANSGVSNAQTTVKYSTIYAPFTGTIGISQVKIGVLVTANQTLLNTISSDDPMAVDIAVDQRDIARFVQLQNNSSARNDSVFVLKLPGNFTYPQPGKVSLIDRAVDPQTGTIKTRLVFSNPESMLKPGMNVNVRIKNNSADSSMLMIPYRAVIEQMGEYFVFVVNDSSRAIQQKLSLGPRINDKVVVRQGLNEGDKIITEGFQRLRDSAKVNVTMSK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
144 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 0.37
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000968 3300001979 Bacteria 12786
2 JGI24740J21852_10003566 3300001979 Bacteria 6812
3 JGI24737J22298_10003011 3300001990 Bacteria 5976
4 JGI24737J22298_10005613 3300001990 Bacteria 4323
5 JGI25162J39368_1000017 3300002737 Bacteria 281385
6 JGI25154J39366_1000007 3300002738 Bacteria 335932
7 JGI25153J46596_10001828 3300003215 Bacteria 12620
8 rootH1_10065085 3300003316 Bacteria 4897
9 rootH2_10013162 3300003320 Bacteria 43068
10 rootH2_10027560 3300003320 Unclassified 3222
11 rootH2_10030616 3300003320 Bacteria 10703
12 rootL2_10188775 3300003322 Bacteria 3780
13 rootH1_10001790 3300003323 Bacteria 63047
14 rootH1_10016730 3300003323 Bacteria 2237
15 rootH1_10084943 3300003323 Bacteria 5571
16 Ga0055535_1002902 3300003761 Bacteria 5342
17 Ga0055542_1004157 3300003762 Bacteria 3634
18 Ga0070676_10096251 3300005328 Unclassified 1822
19 Ga0070683_100007696 3300005329 Bacteria 9117
20 Ga0070683_100017685 3300005329 Bacteria 6299
21 Ga0070670_100033285 3300005331 Bacteria 4439
22 Ga0070670_100065914 3300005331 Bacteria 3107
23 Ga0068869_100001850 3300005334 Bacteria 12717
24 Ga0068869_100031781 3300005334 Bacteria 3715
25 Ga0070666_10013926 3300005335 Bacteria 5111
26 Ga0070666_10031204 3300005335 Bacteria 3517
27 Ga0070689_100004423 3300005340 Bacteria 9490
28 Ga0070689_100145508 3300005340 Bacteria 1909
29 Ga0070689_100275532 3300005340 Bacteria 1394
30 Ga0070691_10032967 3300005341 Unclassified 2435
31 Ga0070691_10078225 3300005341 Unclassified 1615
32 Ga0070668_100065599 3300005347 Unclassified 2816
33 Ga0070671_100017559 3300005355 Bacteria 5797
34 Ga0070673_100059044 3300005364 Bacteria 3035
35 Ga0070688_100011482 3300005365 Bacteria 4922
36 Ga0070688_100020356 3300005365 Bacteria 3857
37 Ga0070659_100006728 3300005366 Bacteria 8311
38 Ga0070659_100017040 3300005366 Bacteria 5461
39 Ga0070667_100144373 3300005367 Bacteria 2086
40 Ga0070662_100016070 3300005457 Bacteria 5021
41 Ga0070681_10008290 3300005458 Bacteria 10175
42 Ga0070685_10031888 3300005466 Unclassified 2948
43 Ga0070679_100261411 3300005530 Bacteria 1686
44 Ga0070684_100008088 3300005535 Bacteria 8210
45 Ga0070684_100054484 3300005535 Unclassified 3485
46 Ga0068853_100046009 3300005539 Bacteria 3740
47 Ga0068853_100061845 3300005539 Bacteria 3239
48 Ga0068853_100120669 3300005539 Bacteria 2338
49 Ga0070665_100000009 3300005548 Bacteria 562640
50 Ga0070665_100061377 3300005548 Unclassified 3768
51 Ga0068855_100000998 3300005563 Bacteria 35254
52 Ga0068855_100236439 3300005563 Bacteria 2043
53 Ga0070664_100008138 3300005564 Bacteria 8477
54 Ga0070664_100084133 3300005564 Unclassified 2746
55 Ga0070664_100088582 3300005564 Unclassified 2676
56 Ga0070664_100259644 3300005564 Bacteria 1563
57 Ga0068857_100020057 3300005577 Bacteria 5877
58 Ga0068857_100042838 3300005577 Unclassified 4016
59 Ga0068857_100047350 3300005577 Unclassified 3817
60 Ga0068857_100144039 3300005577 Bacteria 2155
61 Ga0068854_100025480 3300005578 Bacteria 4059
62 Ga0068854_100068540 3300005578 Bacteria 2587
63 Ga0068854_100083764 3300005578 Bacteria 2358
64 Ga0068854_100137706 3300005578 Bacteria 1870
65 Ga0068856_100004713 3300005614 Bacteria 13539
66 Ga0068856_100174378 3300005614 Bacteria 2163
67 Ga0068852_100005446 3300005616 Bacteria 9101
68 Ga0068852_100128194 3300005616 Bacteria 2333
69 Ga0068864_100004874 3300005618 Bacteria 10986
70 Ga0068866_10012361 3300005718 Bacteria 3718
71 Ga0068861_100037406 3300005719 Bacteria 3608
72 Ga0068863_100227625 3300005841 Bacteria 1798
73 Ga0068860_100000033 3300005843 Bacteria 245461
74 Ga0068860_100004407 3300005843 Bacteria 14381
75 Ga0097621_100110992 3300006237 Bacteria 2317
76 Ga0097621_100420295 3300006237 Bacteria 1200
77 Ga0068871_100056513 3300006358 Bacteria 3190
78 Ga0105240_10011665 3300009093 Bacteria 12213
79 Ga0105240_10014277 3300009093 Bacteria 10849
80 Ga0105240_10023672 3300009093 Bacteria 8113
81 Ga0105240_10064407 3300009093 Bacteria 4555
82 Ga0105240_10131280 3300009093 Bacteria 3004
83 Ga0105241_10003981 3300009174 Bacteria 10919
84 Ga0105241_10020278 3300009174 Bacteria 4911
85 Ga0105242_10008719 3300009176 Bacteria 7782
86 Ga0105237_10003021 3300009545 Bacteria 20301
87 Ga0105237_10005763 3300009545 Bacteria 13915
88 Ga0105237_10017644 3300009545 Bacteria 7396
89 Ga0105237_10036096 3300009545 Bacteria 5000
90 Ga0105237_10046582 3300009545 Bacteria 4361
91 Ga0105237_10089615 3300009545 Bacteria 3065
92 Ga0105238_10006738 3300009551 Bacteria 11470
93 Ga0105238_10043410 3300009551 Bacteria 4550
94 Ga0105238_10119716 3300009551 Unclassified 2613
95 Ga0105239_10001380 3300010375 Bacteria 32568
96 Ga0105239_10011392 3300010375 Bacteria 9919
97 Ga0105239_10026720 3300010375 Bacteria 6354
98 Ga0105239_10120810 3300010375 Bacteria 2909
99 Ga0105239_10150779 3300010375 Unclassified 2595
100 Ga0105239_10178600 3300010375 Bacteria 2375
101 Ga0105239_10249415 3300010375 Bacteria 1994
102 Ga0105239_10249482 3300010375 Bacteria 1993
103 Ga0105246_10027023 3300011119 Bacteria 3756
104 Ga0157373_10000661 3300013100 Bacteria 27028
105 Ga0157373_10107206 3300013100 Bacteria 1964
106 Ga0157371_10000622 3300013102 Bacteria 42231
107 Ga0157371_10001349 3300013102 Bacteria 25843
108 Ga0157370_10000405 3300013104 Bacteria 54383
109 Ga0157370_10003763 3300013104 Bacteria 17707
110 Ga0157370_10011017 3300013104 Bacteria 9485
111 Ga0157370_10046885 3300013104 Unclassified 4143
112 Ga0157374_10001178 3300013296 Bacteria 22309
113 Ga0157374_10003276 3300013296 Bacteria 13602
114 Ga0157374_10016837 3300013296 Bacteria 6431
115 Ga0163162_10004829 3300013306 Bacteria 13007
116 Ga0163162_10005781 3300013306 Bacteria 11969
117 Ga0163162_10014811 3300013306 Bacteria 7616
118 Ga0157372_10001219 3300013307 Bacteria 27839
119 Ga0157372_10001355 3300013307 Bacteria 26492
120 Ga0157372_10005956 3300013307 Bacteria 12962
121 Ga0157372_10026621 3300013307 Bacteria 6294
122 Ga0157372_10026793 3300013307 Bacteria 6275
123 Ga0157372_10387822 3300013307 Bacteria 1628
124 Ga0157375_10122206 3300013308 Bacteria 2715
125 Ga0163163_10000803 3300014325 Bacteria 26650
126 Ga0163163_10020169 3300014325 Bacteria 6274
127 Ga0157377_10009333 3300014745 Bacteria 4807
128 Ga0157377_10152298 3300014745 Bacteria 1430
129 Ga0157379_10045367 3300014968 Bacteria 3922
130 Ga0157379_10077166 3300014968 Bacteria 2983
131 Ga0157376_10019467 3300014969 Bacteria 5233
132 Ga0157376_10055133 3300014969 Bacteria 3316
133 Ga0163161_10015385 3300017792 Bacteria 5333
134 Ga0209437_100024 3300025233 Bacteria 592878
135 Ga0209258_100219 3300025242 Bacteria 108974
136 Ga0209646_1000002 3300025246 Bacteria 1425781
137 Ga0209026_1001015 3300025250 Bacteria 13857
138 Ga0209148_1000283 3300025254 Bacteria 77780
139 Ga0209233_1002165 3300025261 Bacteria 7364
140 Ga0209130_1002280 3300025284 Bacteria 9860
141 Ga0209758_1005513 3300025297 Bacteria 9676
142 Ga0207426_1000341 3300025302 Bacteria 87735
143 Ga0207426_1000850 3300025302 Bacteria 32126
144 Ga0207680_10019826 3300025903 Bacteria 3606
145 Ga0207647_10000492 3300025904 Bacteria 31644
146 Ga0207647_10014974 3300025904 Bacteria 5330
147 Ga0207647_10025154 3300025904 Bacteria 3918
148 Ga0207645_10032490 3300025907 Bacteria 3354
149 Ga0207654_10008319 3300025911 Bacteria 5242
150 Ga0207654_10030725 3300025911 Bacteria 2951
151 Ga0207707_10027756 3300025912 Bacteria 4949
152 Ga0207695_10000128 3300025913 Bacteria 226098
153 Ga0207695_10007519 3300025913 Bacteria 13821
154 Ga0207695_10008461 3300025913 Bacteria 12883
155 Ga0207695_10054281 3300025913 Bacteria 4186
156 Ga0207695_10118937 3300025913 Bacteria 2613
157 Ga0207695_10239783 3300025913 Bacteria 1715
158 Ga0207671_10006532 3300025914 Bacteria 10364
159 Ga0207671_10006681 3300025914 Bacteria 10219
160 Ga0207671_10011200 3300025914 Bacteria 7319
161 Ga0207671_10020410 3300025914 Bacteria 5043
162 Ga0207660_10117233 3300025917 Bacteria 2012
163 Ga0207649_10108636 3300025920 Unclassified 1849
164 Ga0207652_10000350 3300025921 Bacteria 47780
165 Ga0207652_10230567 3300025921 Bacteria 1669
166 Ga0207694_10015736 3300025924 Bacteria 5707
167 Ga0207694_10041349 3300025924 Bacteria 3552
168 Ga0207694_10248836 3300025924 Bacteria 1454
169 Ga0207659_10017079 3300025926 Bacteria 4735
170 Ga0207690_10012852 3300025932 Bacteria 5016
171 Ga0207706_10027500 3300025933 Bacteria 5085
172 Ga0207706_10241665 3300025933 Unclassified 1578
173 Ga0207691_10080520 3300025940 Bacteria 2929
174 Ga0207691_10171283 3300025940 Bacteria 1901
175 Ga0207689_10004660 3300025942 Bacteria 12400
176 Ga0207689_10008354 3300025942 Bacteria 9014
177 Ga0207661_10007258 3300025944 Bacteria 7882
178 Ga0207661_10041072 3300025944 Bacteria 3640
179 Ga0207679_10001099 3300025945 Bacteria 17218
180 Ga0207679_10098829 3300025945 Unclassified 2277
181 Ga0207679_10211248 3300025945 Bacteria 1627
182 Ga0207667_10000610 3300025949 Bacteria 46234
183 Ga0207667_10001471 3300025949 Bacteria 29532
184 Ga0207667_10001886 3300025949 Bacteria 26373
185 Ga0207667_10060847 3300025949 Bacteria 3952
186 Ga0207668_10063895 3300025972 Bacteria 2599
187 Ga0207640_10052074 3300025981 Bacteria 2665
188 Ga0207640_10065743 3300025981 Unclassified 2420
189 Ga0207640_10073362 3300025981 Bacteria 2312
190 Ga0207640_10077868 3300025981 Bacteria 2255
191 Ga0207677_10025286 3300026023 Bacteria 3702
192 Ga0207677_10160741 3300026023 Bacteria 1745
193 Ga0207703_10134417 3300026035 Unclassified 2139
194 Ga0207702_10106303 3300026078 Bacteria 2487
195 Ga0207702_10141248 3300026078 Bacteria 2179
196 Ga0207641_10086286 3300026088 Bacteria 2737
197 Ga0207676_10010000 3300026095 Bacteria 6750
198 Ga0207674_10022550 3300026116 Bacteria 6759
199 Ga0207674_10025146 3300026116 Bacteria 6354
200 Ga0207674_10027591 3300026116 Bacteria 6003
201 Ga0207674_10144789 3300026116 Bacteria 2335
202 Ga0207675_100021658 3300026118 Bacteria 5983
203 Ga0207698_10017062 3300026142 Bacteria 4916
204 Ga0207698_10140811 3300026142 Bacteria 2078
205 Ga0268266_10000014 3300028379 Bacteria 644033
206 Ga0268266_10081426 3300028379 Bacteria 2823
207 Ga0268264_10000013 3300028381 Bacteria 513859
208 Ga0268264_10002568 3300028381 Bacteria 15916
209 Ga0268264_10190763 3300028381 Bacteria 1868
210 Ga0265327_10000146 3300031251 Bacteria 154436
211 Ga0307510_10001022 3300033180 Bacteria 29641
212 Ga0373936_0046216 3300035113 Bacteria 1755
213 Ga0395899_0045562 3300037312 Bacteria 3267
214 Ga0395900_0025616 3300037418 Bacteria 6037
215 Ga0395900_0110922 3300037418 Bacteria 2818
216 Ga0395898_0011037 3300037466 Bacteria 9411
217 Ga0395901_0016919 3300038443 Bacteria 7433
218 Ga0395901_0172691 3300038443 Bacteria 2268
219 Ga0466969_0000445 3300044656 Bacteria 22630
220 Ga0466972_0000270 3300044658 Bacteria 32742
221 Ga0466972_0003967 3300044658 Bacteria 7374
222 Ga0466972_0029509 3300044658 Bacteria 2700
223 Ga0466965_0093325 3300044683 Bacteria 1533
224 Ga0466966_0000144 3300044684 Bacteria 45151
225 Ga0466968_0009046 3300044735 Bacteria 3830
226 Ga0466957_0001227 3300044842 Bacteria 13383
227 Ga0466957_0023111 3300044842 Bacteria 3672
228 Ga0466960_0049194 3300044901 Unclassified 2029
229 Ga0466959_0000045 3300045049 Bacteria 89773
230 Ga0495638_0041258 3300046460 Bacteria 2921
231 Ga0495638_0044276 3300046460 Bacteria 2804
232 Ga0495606_0011528 3300046507 Bacteria 7201
233 Ga0495643_0036640 3300046522 Bacteria 2694
234 Ga0495648_0002439 3300046524 Bacteria 17207
235 Ga0495611_0000154 3300046648 Bacteria 49174
236 Ga0495672_0017121 3300047320 Bacteria 4854
237 Ga0495686_0000256 3300047472 Bacteria 95552
238 Ga0496110_0046802 3300048913 Bacteria 3785
239 Ga0501037_0071185 3300049573 Bacteria 2530
240 Ga0501047_0043490 3300049581 Bacteria 4339
241 Ga0501047_0078931 3300049581 Bacteria 3165
242 Ga0501225_0000212 3300049705 Bacteria 18288
243 Ga0501035_0112471 3300049822 Bacteria 2386
244 Ga0501044_0005156 3300049823 Bacteria 14565
245 Ga0501044_0034223 3300049823 Bacteria 5331
246 Ga0500578_0000184 3300053086 Bacteria 75675
247 Ga0500644_0000279 3300053088 Bacteria 28337
248 Ga0500583_0000709 3300053092 Bacteria 9682
249 Ga0500583_0004699 3300053092 Bacteria 4487
250 Ga0500641_0013144 3300053096 Bacteria 3039
251 Ga0500564_029498 3300053138 Bacteria 2527
252 Ga0500568_0001732 3300053139 Bacteria 13529
253 Ga0500568_0016148 3300053139 Bacteria 3326
254 Ga0500588_0085818 3300053146 Bacteria 1062
255 Ga0500622_0000991 3300053156 Bacteria 23992
256 Ga0500622_0002062 3300053156 Bacteria 14972
257 Ga0500622_0043346 3300053156 Bacteria 2334
258 Ga0500637_0079122 3300053178 Unclassified 1898
259 Ga0466962_0033075 3300061719 Bacteria 2474
260 Ga0466962_0105615 3300061719 Bacteria 1354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0013144 Ga0500641_0013144_346_1476 256
2 3300053139 Ga0500568_0001732 Ga0500568_0001732_5050_6180 259
3 3300053146 Ga0500588_0085818 Ga0500588_0085818_15_959 266
4 3300013306 Ga0163162_10005781 Ga0163162_100057815 278
5 3300005334 Ga0068869_100031781 Ga0068869_1000317812 279
6 3300005347 Ga0070668_100065599 Ga0070668_1000655992 279
7 3300005719 Ga0068861_100037406 Ga0068861_1000374063 279
8 3300006237 Ga0097621_100110992 Ga0097621_1001109922 279
9 3300025942 Ga0207689_10004660 Ga0207689_100046605 280
10 3300025972 Ga0207668_10063895 Ga0207668_100638952 280
11 3300026118 Ga0207675_100021658 Ga0207675_1000216585 280
12 3300005367 Ga0070667_100144373 Ga0070667_1001443732 282
13 3300003322 rootL2_10188775 rootL2_101887752 287
14 3300047320 Ga0495672_0017121 Ga0495672_0017121_2356_3459 287
15 3300025917 Ga0207660_10117233 Ga0207660_101172332 289
16 3300025921 Ga0207652_10000350 Ga0207652_100003502 289
17 3300013104 Ga0157370_10000405 Ga0157370_1000040537 290
18 3300046524 Ga0495648_0002439 Ga0495648_0002439_15808_16809 297
19 3300003320 rootH2_10030616 rootH2_100306166 300
20 3300003323 rootH1_10016730 rootH1_100167303 300
21 3300053156 Ga0500622_0000991 Ga0500622_0000991_10385_11569 300
22 3300013104 Ga0157370_10003763 Ga0157370_1000376312 301
23 3300046522 Ga0495643_0036640 Ga0495643_0036640_1348_2484 302
24 3300005331 Ga0070670_100033285 Ga0070670_1000332852 305
25 3300035113 Ga0373936_0046216 Ga0373936_0046216_490_1653 305
26 3300005530 Ga0070679_100261411 Ga0070679_1002614112 306
27 3300005539 Ga0068853_100120669 Ga0068853_1001206692 306
28 3300005563 Ga0068855_100000998 Ga0068855_10000099822 306
29 3300005841 Ga0068863_100227625 Ga0068863_1002276252 306
30 3300006237 Ga0097621_100420295 Ga0097621_1004202951 306
31 3300013102 Ga0157371_10001349 Ga0157371_1000134917 306
32 3300013307 Ga0157372_10005956 Ga0157372_100059566 306
33 3300025921 Ga0207652_10230567 Ga0207652_102305672 306
34 3300025949 Ga0207667_10060847 Ga0207667_100608473 306
35 3300031251 Ga0265327_10000146 Ga0265327_1000014653 306
36 3300037312 Ga0395899_0045562 Ga0395899_0045562_1722_2828 306
37 3300037418 Ga0395900_0025616 Ga0395900_0025616_3444_4550 306
38 3300037466 Ga0395898_0011037 Ga0395898_0011037_1956_3062 306
39 3300038443 Ga0395901_0016919 Ga0395901_0016919_2083_3189 306
40 3300005458 Ga0070681_10008290 Ga0070681_100082902 307
41 3300025912 Ga0207707_10027756 Ga0207707_100277562 307
42 3300033180 Ga0307510_10001022 Ga0307510_1000102215 307
43 3300001990 JGI24737J22298_10003011 JGI24737J22298_100030112 308
44 3300001990 JGI24737J22298_10005613 JGI24737J22298_100056131 308
45 3300005366 Ga0070659_100006728 Ga0070659_1000067282 308
46 3300005577 Ga0068857_100144039 Ga0068857_1001440391 308
47 3300013100 Ga0157373_10000661 Ga0157373_1000066120 308
48 3300013102 Ga0157371_10000622 Ga0157371_1000062233 308
49 3300013307 Ga0157372_10001219 Ga0157372_1000121914 308
50 3300014745 Ga0157377_10009333 Ga0157377_100093335 308
51 3300025261 Ga0209233_1002165 Ga0209233_10021652 308
52 3300025904 Ga0207647_10000492 Ga0207647_100004921 308
53 3300025932 Ga0207690_10012852 Ga0207690_100128522 308
54 3300026116 Ga0207674_10144789 Ga0207674_101447893 308
55 3300038443 Ga0395901_0172691 Ga0395901_0172691_539_1720 308
56 3300002737 JGI25162J39368_1000017 JGI25162J39368_1000017119 309
57 3300005563 Ga0068855_100236439 Ga0068855_1002364392 309
58 3300005578 Ga0068854_100137706 Ga0068854_1001377062 309
59 3300009093 Ga0105240_10064407 Ga0105240_100644072 309
60 3300009093 Ga0105240_10131280 Ga0105240_101312802 309
61 3300010375 Ga0105239_10011392 Ga0105239_100113921 309
62 3300013104 Ga0157370_10011017 Ga0157370_100110172 309
63 3300025233 Ga0209437_100024 Ga0209437_100024195 309
64 3300025913 Ga0207695_10054281 Ga0207695_100542812 309
65 3300005578 Ga0068854_100068540 Ga0068854_1000685402 310
66 3300009545 Ga0105237_10036096 Ga0105237_100360965 310
67 3300009545 Ga0105237_10089615 Ga0105237_100896152 310
68 3300010375 Ga0105239_10120810 Ga0105239_101208102 310
69 3300025913 Ga0207695_10239783 Ga0207695_102397832 310
70 3300025914 Ga0207671_10020410 Ga0207671_100204102 310
71 3300025981 Ga0207640_10052074 Ga0207640_100520742 310
72 3300053138 Ga0500564_029498 Ga0500564_029498_1070_2317 310
73 3300005366 Ga0070659_100017040 Ga0070659_1000170403 312
74 3300005539 Ga0068853_100046009 Ga0068853_1000460091 312
75 3300005564 Ga0070664_100088582 Ga0070664_1000885822 312
76 3300005577 Ga0068857_100047350 Ga0068857_1000473502 312
77 3300013307 Ga0157372_10387822 Ga0157372_103878221 312
78 3300025920 Ga0207649_10108636 Ga0207649_101086362 312
79 3300025945 Ga0207679_10098829 Ga0207679_100988292 312
80 3300026116 Ga0207674_10022550 Ga0207674_100225502 312
81 3300009174 Ga0105241_10020278 Ga0105241_100202782 313
82 3300010375 Ga0105239_10001380 Ga0105239_1000138013 313
83 3300025911 Ga0207654_10030725 Ga0207654_100307252 313
84 3300025949 Ga0207667_10001471 Ga0207667_1000147111 313
85 3300026078 Ga0207702_10141248 Ga0207702_101412482 313
86 3300026116 Ga0207674_10025146 Ga0207674_100251462 313
87 3300005328 Ga0070676_10096251 Ga0070676_100962511 314
88 3300005329 Ga0070683_100007696 Ga0070683_1000076966 314
89 3300005331 Ga0070670_100065914 Ga0070670_1000659142 314
90 3300005334 Ga0068869_100001850 Ga0068869_1000018504 314
91 3300005340 Ga0070689_100145508 Ga0070689_1001455081 314
92 3300005535 Ga0070684_100008088 Ga0070684_1000080883 314
93 3300005564 Ga0070664_100008138 Ga0070664_1000081382 314
94 3300005577 Ga0068857_100020057 Ga0068857_1000200571 314
95 3300005618 Ga0068864_100004874 Ga0068864_1000048744 314
96 3300011119 Ga0105246_10027023 Ga0105246_100270232 314
97 3300013296 Ga0157374_10001178 Ga0157374_1000117819 314
98 3300013308 Ga0157375_10122206 Ga0157375_101222062 314
99 3300014325 Ga0163163_10000803 Ga0163163_1000080312 314
100 3300025904 Ga0207647_10025154 Ga0207647_100251542 314
101 3300025926 Ga0207659_10017079 Ga0207659_100170792 314
102 3300025933 Ga0207706_10027500 Ga0207706_100275005 314
103 3300025940 Ga0207691_10080520 Ga0207691_100805202 314
104 3300025944 Ga0207661_10007258 Ga0207661_100072583 314
105 3300025945 Ga0207679_10001099 Ga0207679_1000109911 314
106 3300026023 Ga0207677_10025286 Ga0207677_100252862 314
107 3300026095 Ga0207676_10010000 Ga0207676_100100005 314
108 3300046648 Ga0495611_0000154 Ga0495611_0000154_21395_22495 317
109 3300005335 Ga0070666_10013926 Ga0070666_100139262 318
110 3300005355 Ga0070671_100017559 Ga0070671_1000175592 318
111 3300005364 Ga0070673_100059044 Ga0070673_1000590442 318
112 3300005457 Ga0070662_100016070 Ga0070662_1000160704 318
113 3300005718 Ga0068866_10012361 Ga0068866_100123614 318
114 3300009176 Ga0105242_10008719 Ga0105242_100087193 318
115 3300013296 Ga0157374_10003276 Ga0157374_100032764 318
116 3300014325 Ga0163163_10020169 Ga0163163_100201692 318
117 3300014968 Ga0157379_10077166 Ga0157379_100771662 318
118 3300014969 Ga0157376_10055133 Ga0157376_100551333 318
119 3300037418 Ga0395900_0110922 Ga0395900_0110922_1016_2149 318
120 3300049705 Ga0501225_0000212 Ga0501225_0000212_789_1949 318
121 3300009545 Ga0105237_10046582 Ga0105237_100465822 319
122 3300010375 Ga0105239_10249415 Ga0105239_102494152 319
123 3300025924 Ga0207694_10015736 Ga0207694_100157362 319
124 3300044842 Ga0466957_0001227 Ga0466957_0001227_6361_7512 319
125 3300046460 Ga0495638_0041258 Ga0495638_0041258_1103_2254 319
126 3300053178 Ga0500637_0079122 Ga0500637_0079122_481_1632 319
127 3300025284 Ga0209130_1002280 Ga0209130_10022805 321
128 3300025302 Ga0207426_1000341 Ga0207426_100034122 321
129 3300026088 Ga0207641_10086286 Ga0207641_100862862 321
130 3300049573 Ga0501037_0071185 Ga0501037_0071185_538_1656 322
131 3300049823 Ga0501044_0034223 Ga0501044_0034223_1559_2677 322
132 3300044901 Ga0466960_0049194 Ga0466960_0049194_35_1189 323
133 3300046460 Ga0495638_0044276 Ga0495638_0044276_1369_2448 323
134 3300053092 Ga0500583_0000709 Ga0500583_0000709_3391_4470 323
135 3300053156 Ga0500622_0002062 Ga0500622_0002062_6503_7582 323
136 3300046507 Ga0495606_0011528 Ga0495606_0011528_1632_2786 324
137 3300003323 rootH1_10001790 rootH1_1000179030 326
138 3300009093 Ga0105240_10011665 Ga0105240_1001166510 326
139 3300009174 Ga0105241_10003981 Ga0105241_100039813 326
140 3300009551 Ga0105238_10006738 Ga0105238_100067383 326
141 3300013307 Ga0157372_10026793 Ga0157372_100267935 326
142 3300025911 Ga0207654_10008319 Ga0207654_100083192 326
143 3300025913 Ga0207695_10007519 Ga0207695_1000751911 326
144 3300025914 Ga0207671_10006681 Ga0207671_100066813 326
145 3300047472 Ga0495686_0000256 Ga0495686_0000256_22364_23494 326
146 3300049581 Ga0501047_0043490 Ga0501047_0043490_1379_2527 326
147 3300049822 Ga0501035_0112471 Ga0501035_0112471_102_1250 326
148 3300049823 Ga0501044_0005156 Ga0501044_0005156_2318_3466 326
149 3300003320 rootH2_10013162 rootH2_1001316235 327
150 3300044658 Ga0466972_0029509 Ga0466972_0029509_342_1484 327
151 3300003320 rootH2_10027560 rootH2_100275602 328
152 3300005340 Ga0070689_100004423 Ga0070689_1000044238 328
153 3300005341 Ga0070691_10032967 Ga0070691_100329672 328
154 3300005466 Ga0070685_10031888 Ga0070685_100318882 328
155 3300005578 Ga0068854_100025480 Ga0068854_1000254802 328
156 3300005578 Ga0068854_100083764 Ga0068854_1000837642 328
157 3300005614 Ga0068856_100004713 Ga0068856_1000047138 328
158 3300005616 Ga0068852_100005446 Ga0068852_1000054465 328
159 3300005616 Ga0068852_100128194 Ga0068852_1001281942 328
160 3300005843 Ga0068860_100004407 Ga0068860_1000044075 328
161 3300009545 Ga0105237_10017644 Ga0105237_100176442 328
162 3300009551 Ga0105238_10119716 Ga0105238_101197162 328
163 3300013100 Ga0157373_10107206 Ga0157373_101072062 328
164 3300013307 Ga0157372_10026621 Ga0157372_100266213 328
165 3300025904 Ga0207647_10014974 Ga0207647_100149743 328
166 3300025913 Ga0207695_10118937 Ga0207695_101189372 328
167 3300025914 Ga0207671_10006532 Ga0207671_100065325 328
168 3300025914 Ga0207671_10011200 Ga0207671_100112003 328
169 3300025924 Ga0207694_10041349 Ga0207694_100413492 328
170 3300025981 Ga0207640_10065743 Ga0207640_100657432 328
171 3300026116 Ga0207674_10027591 Ga0207674_100275912 328
172 3300026142 Ga0207698_10017062 Ga0207698_100170622 328
173 3300028381 Ga0268264_10002568 Ga0268264_100025686 328
174 3300048913 Ga0496110_0046802 Ga0496110_0046802_12_1115 328
175 3300005843 Ga0068860_100000033 Ga0068860_1000000339 330
176 3300028381 Ga0268264_10000013 Ga0268264_100000139 330
177 3300053156 Ga0500622_0043346 Ga0500622_0043346_525_1667 331
178 3300005329 Ga0070683_100017685 Ga0070683_1000176856 332
179 3300005535 Ga0070684_100054484 Ga0070684_1000544843 332
180 3300009093 Ga0105240_10023672 Ga0105240_100236723 332
181 3300010375 Ga0105239_10150779 Ga0105239_101507792 332
182 3300025913 Ga0207695_10000128 Ga0207695_10000128107 332
183 3300025944 Ga0207661_10041072 Ga0207661_100410723 332
184 3300025949 Ga0207667_10001886 Ga0207667_100018863 332
185 3300044683 Ga0466965_0093325 Ga0466965_0093325_289_1485 332
186 3300061719 Ga0466962_0105615 Ga0466962_0105615_156_1298 332
187 3300005365 Ga0070688_100011482 Ga0070688_1000114822 333
188 3300005548 Ga0070665_100061377 Ga0070665_1000613772 333
189 3300005564 Ga0070664_100084133 Ga0070664_1000841332 333
190 3300006358 Ga0068871_100056513 Ga0068871_1000565132 333
191 3300010375 Ga0105239_10178600 Ga0105239_101786002 333
192 3300013296 Ga0157374_10016837 Ga0157374_100168375 333
193 3300013306 Ga0163162_10014811 Ga0163162_100148113 333
194 3300014968 Ga0157379_10045367 Ga0157379_100453672 333
195 3300025933 Ga0207706_10241665 Ga0207706_102416652 333
196 3300025940 Ga0207691_10171283 Ga0207691_101712832 333
197 3300025945 Ga0207679_10211248 Ga0207679_102112482 333
198 3300026023 Ga0207677_10160741 Ga0207677_101607412 333
199 3300026035 Ga0207703_10134417 Ga0207703_101344172 333
200 3300028379 Ga0268266_10081426 Ga0268266_100814262 333
201 3300028381 Ga0268264_10190763 Ga0268264_101907632 333
202 iso_pu_bacteria 2738541278 2738726882 333
203 iso_pu_bacteria 2919437846 2919438923 333
204 iso_pu_bacteria 2929177148 2929182801 333
205 3300005340 Ga0070689_100275532 Ga0070689_1002755321 334
206 3300005365 Ga0070688_100020356 Ga0070688_1000203561 334
207 3300005564 Ga0070664_100259644 Ga0070664_1002596442 334
208 3300005614 Ga0068856_100174378 Ga0068856_1001743782 334
209 3300013306 Ga0163162_10004829 Ga0163162_1000482911 334
210 3300014745 Ga0157377_10152298 Ga0157377_101522982 334
211 3300014969 Ga0157376_10019467 Ga0157376_100194672 334
212 3300017792 Ga0163161_10015385 Ga0163161_100153852 334
213 3300025907 Ga0207645_10032490 Ga0207645_100324902 334
214 3300025942 Ga0207689_10008354 Ga0207689_100083542 334
215 3300025981 Ga0207640_10073362 Ga0207640_100733622 334
216 3300003316 rootH1_10065085 rootH1_100650852 335
217 3300005335 Ga0070666_10031204 Ga0070666_100312042 335
218 3300005341 Ga0070691_10078225 Ga0070691_100782251 335
219 3300005539 Ga0068853_100061845 Ga0068853_1000618452 335
220 3300005577 Ga0068857_100042838 Ga0068857_1000428383 335
221 3300009093 Ga0105240_10014277 Ga0105240_100142774 335
222 3300009545 Ga0105237_10005763 Ga0105237_100057639 335
223 3300009551 Ga0105238_10043410 Ga0105238_100434102 335
224 3300010375 Ga0105239_10026720 Ga0105239_100267202 335
225 3300013104 Ga0157370_10046885 Ga0157370_100468852 335
226 3300013307 Ga0157372_10001355 Ga0157372_100013556 335
227 3300025903 Ga0207680_10019826 Ga0207680_100198263 335
228 3300025913 Ga0207695_10008461 Ga0207695_100084619 335
229 3300025924 Ga0207694_10248836 Ga0207694_102488361 335
230 3300025949 Ga0207667_10000610 Ga0207667_100006103 335
231 3300025981 Ga0207640_10077868 Ga0207640_100778682 335
232 3300026078 Ga0207702_10106303 Ga0207702_101063032 335
233 3300026142 Ga0207698_10140811 Ga0207698_101408111 335
234 3300044658 Ga0466972_0003967 Ga0466972_0003967_3889_5043 335
235 iso_pu_bacteria 2945977869 2945978756 335
236 iso_pu_bacteria 2946013367 2946015377 335
237 3300005548 Ga0070665_100000009 Ga0070665_100000009316 336
238 3300009545 Ga0105237_10003021 Ga0105237_100030216 336
239 3300028379 Ga0268266_10000014 Ga0268266_10000014356 336
240 3300044658 Ga0466972_0000270 Ga0466972_0000270_23889_25028 336
241 3300049581 Ga0501047_0078931 Ga0501047_0078931_1502_2647 336
242 3300053086 Ga0500578_0000184 Ga0500578_0000184_10858_12048 336
243 3300053092 Ga0500583_0004699 Ga0500583_0004699_1451_2644 336
244 iso_pu_bacteria 2818991460 2819680508 336
245 iso_pu_bacteria 2884791551 2884798081 336
246 3300044656 Ga0466969_0000445 Ga0466969_0000445_12534_13676 337
247 3300044684 Ga0466966_0000144 Ga0466966_0000144_29009_30157 337
248 3300044735 Ga0466968_0009046 Ga0466968_0009046_1511_2653 337
249 3300045049 Ga0466959_0000045 Ga0466959_0000045_86572_87714 337
250 3300061719 Ga0466962_0033075 Ga0466962_0033075_641_1837 337
251 iso_pu_bacteria 2929921140 2929923401 337
252 iso_pu_bacteria 8003151029 8003152803 337
253 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000766 339
254 3300025246 Ga0209646_1000002 Ga0209646_1000002671 339
255 3300025250 Ga0209026_1001015 Ga0209026_10010158 339
256 3300044842 Ga0466957_0023111 Ga0466957_0023111_727_1881 339
257 3300003215 JGI25153J46596_10001828 JGI25153J46596_100018282 340
258 3300003323 rootH1_10084943 rootH1_100849433 340
259 3300025297 Ga0209758_1005513 Ga0209758_10055137 340
260 3300025302 Ga0207426_1000850 Ga0207426_10008503 340
261 3300053088 Ga0500644_0000279 Ga0500644_0000279_3511_4647 340
262 3300001979 JGI24740J21852_10000968 JGI24740J21852_100009689 341
263 3300001979 JGI24740J21852_10003566 JGI24740J21852_100035666 341
264 3300003761 Ga0055535_1002902 Ga0055535_10029022 341
265 3300003762 Ga0055542_1004157 Ga0055542_10041572 341
266 3300010375 Ga0105239_10249482 Ga0105239_102494822 341
267 3300025242 Ga0209258_100219 Ga0209258_10021993 341
268 3300025254 Ga0209148_1000283 Ga0209148_100028363 341
269 3300053139 Ga0500568_0016148 Ga0500568_0016148_319_1446 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

86

135

0.95

PF13437

HlyD_3

HlyD family secretion protein

197

308

0.83

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

80

311

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsk-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.9146 63 168
5vyz-assembly1.cif.gz_C crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.9067 63 167
5vyz-assembly1.cif.gz_D crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.9055 63 167
5vz0-assembly1.cif.gz_D crystal structure of lactococcus lactis pyruvate carboxylase g746a mutant in complex with cyclic-di-amp 0.9054 63 167
7ybu-assembly1.cif.gz_A human propionyl-coenzyme a carboxylase 0.9053 63 167
ID Description Score Start End Superfamily
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9289 60 167 2.40.50.100
3oocA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9272 263 319 2.40.420.20
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9096 60 167 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9021 60 167 2.40.50.100
af_Q9UUE1_1106_1184_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9015 63 167 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A5K7SF47-F1-model_v4 Co/Zn/Cd efflux system membrane fusion protein 0.9189 263 333 GO:0015562
GO:1990281
AF-A0A6M1NFB2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8803 257 331 GO:0015562
GO:1990281
AF-A0A5B8CZW7-F1-model_v4 deleted 0.8358 28 337
AF-A0A3D4TBD7-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8207 116 330 GO:0005886
GO:0022857
GO:0030313
GO:0046677
AF-A0A4P5R3V9-F1-model_v4 MexH family multidrug efflux RND transporter periplasmic adaptor subunit 0.8174 31 340 GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
79.1 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map