F376216

General Info

Members Datasets Scaffolds Average Seq Length
269 189 258 424

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000085|Ga0163163_1000008532
Length 501
Sequence MSVLFRPRDLGIHYILDIRLAIPVQGKAKSLPTVKHLARLTLSSSIRQFAPIMILPAWKILRSLVLTALWMAVIYIASRSSSLAAESGEKLAENKPPHLLIPSGVFDAEVGKIQQGWVVLVTNKTISAVGPRSEVQAPANAINIQLPEMTLLAGLMDIHSHIFLHPYNEVLWNDQVLKEPVAYRTVAAVNHLKNTLMAGFTLLRDLGTEGAGFSDVAVKRAVEEGMIPGPRLIVVTKAIVATASYGPGPSGFAENVILPKGAQEASGIPEIIKAVREQAGAGADWIKVYADFARGPGGAEVPTFSSEELRALTAESHSAGRLVAAHATTAEGMRRAIEAGVDTIEHGYGGNEEVFRLMASKGVGYLPTLAAAEAYAEYFDRYKPGKGPMPPQLERAVKAFKLALENKVIIGLGSDVGVFAHGTNYRELEWMVRGGMTPVQALQAATAVNAKILRMEKQLGQIRPGYYADLIGVPGNPTKDIQTIRNVSFVMKDGQIYTQPK

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541357 Duganella sp. GV053 Isolate Unclassified
5 2738543003 Duganella sp. GV066 Isolate Unclassified
6 2738543026 Duganella sp. GV089 Isolate Unclassified
7 2738543029 Duganella sp. GV039 Isolate Unclassified
8 2739367700 Dyella sp. YR388 Isolate Unclassified
9 2821131069 Duganella sp. 1224 Isolate Unclassified
10 2842711865 Duganella sp. R-73148 Isolate Unclassified
11 2857558681 Duganella sp. R-74565 Isolate Unclassified
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.91
Metatranscriptomes 0
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.16
Nodule 0
Rhizoplane 2.23
Rhizosphere 67.29
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000407 3300001989 Bacteria 14948
2 JGI24738J21930_10000012 3300002075 Bacteria 36302
3 JGI25162J39368_1000163 3300002737 Bacteria 74121
4 JGI25152J39213_1000005 3300002773 Bacteria 160019
5 JGI25150J39212_1000655 3300002774 Bacteria 12871
6 JGI25159J45721_1000430 3300002987 Bacteria 19355
7 rootH1_10044045 3300003316 Bacteria 4378
8 rootH2_10013258 3300003320 Bacteria 22046
9 rootL2_10130404 3300003322 Bacteria 4549
10 rootH1_10205323 3300003323 Bacteria 2168
11 JGI25161J50226_1000182 3300003374 Bacteria 42010
12 JGI25161J50226_1001694 3300003374 Bacteria 6306
13 Ga0055529_1000068 3300003763 Bacteria 163911
14 Ga0055526_1000780 3300003771 Bacteria 23749
15 Ga0055526_1002186 3300003771 Bacteria 13404
16 Ga0055537_1000039 3300003773 Bacteria 92151
17 Ga0055537_1001912 3300003773 Bacteria 7469
18 Ga0055537_1003971 3300003773 Bacteria 4371
19 Ga0055524_1000187 3300003775 Bacteria 68927
20 Ga0055524_1000526 3300003775 Bacteria 29329
21 Ga0055524_1009240 3300003775 Bacteria 4031
22 Ga0055534_1001322 3300003784 Bacteria 9954
23 Ga0055534_1002892 3300003784 Bacteria 5697
24 Ga0055528_1000066 3300003790 Bacteria 84724
25 Ga0055530_10000946 3300003791 Bacteria 23742
26 Ga0055530_10006211 3300003791 Bacteria 5398
27 Ga0055530_10023632 3300003791 Bacteria 1761
28 Ga0055531_10012050 3300003794 Bacteria 4103
29 Ga0055531_10031361 3300003794 Bacteria 1761
30 Ga0055543_1000112 3300004625 Bacteria 69589
31 Ga0055543_1011336 3300004625 Bacteria 1828
32 Ga0065165_1000005 3300005262 Bacteria 370361
33 Ga0065165_1001050 3300005262 Bacteria 33276
34 Ga0065165_1001863 3300005262 Bacteria 20484
35 Ga0070689_100016454 3300005340 Bacteria 5413
36 Ga0070714_100013475 3300005435 Bacteria 6553
37 Ga0070714_100134846 3300005435 Bacteria 2210
38 Ga0070711_100104229 3300005439 Bacteria 2069
39 Ga0070711_100235233 3300005439 Bacteria 1430
40 Ga0070663_100039436 3300005455 Bacteria 3300
41 Ga0070681_10002014 3300005458 Bacteria 18391
42 Ga0070681_10014820 3300005458 Bacteria 7752
43 Ga0070679_100003267 3300005530 Bacteria 14822
44 Ga0068853_100002558 3300005539 Bacteria 13658
45 Ga0070686_100000544 3300005544 Bacteria 22500
46 Ga0070695_100021238 3300005545 Bacteria 3970
47 Ga0068855_100070929 3300005563 Bacteria 4052
48 Ga0068857_100032701 3300005577 Unclassified 4598
49 Ga0068863_100055655 3300005841 Bacteria 3745
50 Ga0081455_10004387 3300005937 Bacteria 15892
51 Ga0081540_1002263 3300005983 Bacteria 15830
52 Ga0070717_10001180 3300006028 Bacteria 17675
53 Ga0097621_100041425 3300006237 Unclassified 3707
54 Ga0068865_100084712 3300006881 Bacteria 2285
55 Ga0105244_10021853 3300009036 Bacteria 3529
56 Ga0105240_10001417 3300009093 Bacteria 41135
57 Ga0105240_10112532 3300009093 Bacteria 3290
58 Ga0105241_10191545 3300009174 Bacteria 1703
59 Ga0105241_10252586 3300009174 Bacteria 1495
60 Ga0105237_10115765 3300009545 Bacteria 2674
61 Ga0105238_10124192 3300009551 Bacteria 2561
62 Ga0105249_10021457 3300009553 Bacteria 5782
63 Ga0105239_10000030 3300010375 Bacteria 233669
64 Ga0105239_10006526 3300010375 Bacteria 13521
65 Ga0157374_10003664 3300013296 Bacteria 12915
66 Ga0163163_10000085 3300014325 Bacteria 103280
67 Ga0182006_1000319 3300015261 Bacteria 42157
68 Ga0183368_1002 3300015687 Bacteria 1865598
69 Ga0213872_10000032 3300021361 Bacteria 138939
70 Ga0228598_1004129 3300024227 Bacteria 3086
71 Ga0209436_101261 3300025208 Bacteria 9087
72 Ga0209436_103532 3300025208 Bacteria 4119
73 Ga0209672_100614 3300025228 Bacteria 18541
74 Ga0207425_1000001 3300025245 Bacteria 2525432
75 Ga0209129_1000003 3300025258 Bacteria 903689
76 Ga0209565_1000003 3300025263 Bacteria 1099648
77 Ga0209565_1001217 3300025263 Bacteria 12138
78 Ga0209565_1001907 3300025263 Bacteria 8265
79 Ga0209565_1008745 3300025263 Bacteria 2625
80 Ga0209565_1014162 3300025263 Bacteria 1841
81 Ga0209455_1002746 3300025272 Bacteria 6608
82 Ga0209673_1000003 3300025273 Bacteria 980859
83 Ga0209130_1000084 3300025284 Bacteria 160070
84 Ga0209130_1000237 3300025284 Bacteria 70739
85 Ga0209130_1004253 3300025284 Bacteria 5551
86 Ga0209675_1000003 3300025291 Bacteria 1003982
87 Ga0209675_1004244 3300025291 Bacteria 6459
88 Ga0209564_1000002 3300025295 Bacteria 1636803
89 Ga0209564_1000012 3300025295 Bacteria 792078
90 Ga0209564_1000311 3300025295 Bacteria 95587
91 Ga0209564_1004642 3300025295 Bacteria 8265
92 Ga0209758_1000041 3300025297 Bacteria 410328
93 Ga0209050_1000011 3300025298 Bacteria 914037
94 Ga0209050_1000164 3300025298 Bacteria 154628
95 Ga0209050_1000280 3300025298 Bacteria 108968
96 Ga0209050_1000664 3300025298 Bacteria 52795
97 Ga0209256_1000068 3300025299 Bacteria 246064
98 Ga0209256_1000395 3300025299 Bacteria 69343
99 Ga0209256_1000660 3300025299 Bacteria 46727
100 Ga0209256_1000702 3300025299 Bacteria 44556
101 Ga0207426_1008559 3300025302 Bacteria 4116
102 Ga0207426_1008940 3300025302 Bacteria 3997
103 Ga0209257_1000003 3300025304 Bacteria 1702593
104 Ga0209257_1005947 3300025304 Bacteria 8195
105 Ga0207699_10008419 3300025906 Bacteria 5090
106 Ga0207707_10000002 3300025912 Bacteria 1142054
107 Ga0207707_10003173 3300025912 Bacteria 14592
108 Ga0207695_10001438 3300025913 Bacteria 39963
109 Ga0207695_10001749 3300025913 Bacteria 34474
110 Ga0207663_10003643 3300025916 Bacteria 7566
111 Ga0207663_10066822 3300025916 Bacteria 2303
112 Ga0207660_10000069 3300025917 Bacteria 53883
113 Ga0207652_10000299 3300025921 Bacteria 51311
114 Ga0207694_10023987 3300025924 Bacteria 4633
115 Ga0207700_10058819 3300025928 Bacteria 2905
116 Ga0207700_10148200 3300025928 Bacteria 1937
117 Ga0207664_10010563 3300025929 Bacteria 6522
118 Ga0207664_10081408 3300025929 Bacteria 2635
119 Ga0207670_10000772 3300025936 Bacteria 16832
120 Ga0207665_10039514 3300025939 Bacteria 3145
121 Ga0207667_10114441 3300025949 Bacteria 2780
122 Ga0207678_10074717 3300026067 Bacteria 2904
123 Ga0207648_10068400 3300026089 Unclassified 3094
124 Ga0207674_10106058 3300026116 Unclassified 2788
125 Ga0265318_10000474 3300028577 Bacteria 29639
126 Ga0265338_10000007 3300028800 Bacteria 498229
127 Ga0265325_10000001 3300031241 Bacteria 726814
128 Ga0265340_10016153 3300031247 Bacteria 3869
129 Ga0265339_10003276 3300031249 Bacteria 11337
130 Ga0265331_10031778 3300031250 Bacteria 2621
131 Ga0307408_100000490 3300031548 Bacteria 34547
132 Ga0307408_100023608 3300031548 Bacteria 4191
133 Ga0307408_100158440 3300031548 Bacteria 1795
134 Ga0265313_10001083 3300031595 Bacteria 26319
135 Ga0265314_10037412 3300031711 Bacteria 3516
136 Ga0307414_10100928 3300032004 Bacteria 2171
137 Ga0373932_0014224 3300035112 Bacteria 1997
138 Ga0373945_0007846 3300035116 Bacteria 3463
139 Ga0373955_0082700 3300035172 Bacteria 1817
140 Ga0373931_0037929 3300035691 Bacteria 2518
141 Ga0373935_0002578 3300035692 Bacteria 10410
142 Ga0373927_0089891 3300035695 Bacteria 1994
143 Ga0373933_0016242 3300035724 Bacteria 4160
144 Ga0373937_0001197 3300036401 Bacteria 21800
145 Ga0373937_0021594 3300036401 Bacteria 5776
146 Ga0373925_0013310 3300037068 Bacteria 5953
147 Ga0395905_0161792 3300037471 Bacteria 2104
148 Ga0436361_0008254 3300039447 Bacteria 11524
149 Ga0436361_0168778 3300039447 Bacteria 51987
150 Ga0450908_001950 3300042184 Bacteria 4038
151 Ga0451577_0059200 3300042876 Bacteria 3416
152 Ga0495592_0087567 3300046454 Bacteria 2240
153 Ga0495638_0012112 3300046460 Bacteria 5923
154 Ga0495653_0000096 3300046463 Bacteria 73391
155 Ga0495650_0000066 3300046471 Bacteria 272883
156 Ga0495650_0001268 3300046471 Bacteria 26031
157 Ga0495650_0008833 3300046471 Bacteria 5820
158 Ga0495580_0033421 3300046472 Bacteria 3706
159 Ga0495582_0009171 3300046473 Bacteria 5458
160 Ga0495605_0026043 3300046474 Bacteria 3042
161 Ga0495662_0049018 3300046476 Bacteria 2039
162 Ga0495664_0016367 3300046477 Bacteria 4223
163 Ga0495584_0000995 3300046491 Bacteria 17781
164 Ga0495585_0001481 3300046492 Bacteria 18333
165 Ga0495585_0082326 3300046492 Bacteria 1742
166 Ga0495607_0004217 3300046501 Bacteria 10669
167 Ga0495607_0031914 3300046501 Bacteria 3221
168 Ga0495607_0035919 3300046501 Bacteria 2992
169 Ga0495583_0000021 3300046506 Bacteria 287046
170 Ga0495606_0000125 3300046507 Bacteria 130102
171 Ga0495606_0000128 3300046507 Bacteria 128179
172 Ga0495606_0001352 3300046507 Bacteria 33283
173 Ga0495610_0000008 3300046512 Bacteria 622732
174 Ga0495610_0004794 3300046512 Bacteria 9869
175 Ga0495610_0006848 3300046512 Bacteria 7726
176 Ga0495616_0004796 3300046513 Bacteria 8468
177 Ga0495630_0000136 3300046517 Bacteria 57957
178 Ga0495630_0004801 3300046517 Bacteria 9482
179 Ga0495637_0000067 3300046520 Bacteria 86002
180 Ga0495637_0001897 3300046520 Bacteria 11922
181 Ga0495643_0000022 3300046522 Bacteria 289691
182 Ga0495644_0002052 3300046523 Bacteria 8123
183 Ga0495648_0000223 3300046524 Bacteria 64966
184 Ga0495648_0022686 3300046524 Bacteria 4314
185 Ga0495648_0045158 3300046524 Bacteria 2743
186 Ga0495666_0023828 3300046526 Bacteria 3027
187 Ga0495654_0000002 3300046530 Bacteria 1021205
188 Ga0495654_0002388 3300046530 Bacteria 12111
189 Ga0495586_0000018 3300046535 Bacteria 112658
190 Ga0495587_0022611 3300046536 Bacteria 3870
191 Ga0495609_0004354 3300046538 Bacteria 7777
192 Ga0495609_0054656 3300046538 Bacteria 1772
193 Ga0495597_0000107 3300046542 Bacteria 73749
194 Ga0495645_0068524 3300046543 Bacteria 2561
195 Ga0495622_0000009 3300046557 Bacteria 224622
196 Ga0495633_0000024 3300046558 Bacteria 225077
197 Ga0495667_0116943 3300046559 Bacteria 1722
198 Ga0495668_0000006 3300046616 Bacteria 553404
199 Ga0495668_0001010 3300046616 Bacteria 30202
200 Ga0495668_0002385 3300046616 Bacteria 15576
201 Ga0495634_0003475 3300046642 Bacteria 12619
202 Ga0495611_0005186 3300046648 Bacteria 5585
203 Ga0495611_0005326 3300046648 Bacteria 5504
204 Ga0495625_0041347 3300046660 Bacteria 3356
205 Ga0495625_0052498 3300046660 Bacteria 2919
206 Ga0495625_0083673 3300046660 Bacteria 2217
207 Ga0495659_0000161 3300046664 Bacteria 30006
208 Ga0495659_0012149 3300046664 Bacteria 2784
209 Ga0495661_0005218 3300046665 Bacteria 9246
210 Ga0495599_0026444 3300046678 Unclassified 3637
211 Ga0495613_0020845 3300046689 Bacteria 4887
212 Ga0495670_0000152 3300046691 Bacteria 30850
213 Ga0495670_0020723 3300046691 Bacteria 3241
214 Ga0495649_0035119 3300046694 Bacteria 2757
215 Ga0495649_0063655 3300046694 Bacteria 1981
216 Ga0495660_0004699 3300046810 Bacteria 8238
217 Ga0495581_0029997 3300047315 Unclassified 3153
218 Ga0495636_0000594 3300047318 Bacteria 13305
219 Ga0495636_0000599 3300047318 Bacteria 13258
220 Ga0495636_0008542 3300047318 Bacteria 4041
221 Ga0495674_0003387 3300047319 Bacteria 15486
222 Ga0495672_0000095 3300047320 Bacteria 143883
223 Ga0495672_0008167 3300047320 Bacteria 7764
224 Ga0495672_0032072 3300047320 Bacteria 3272
225 Ga0495676_0080632 3300047321 Bacteria 2470
226 Ga0495683_0023812 3300047323 Bacteria 3145
227 Ga0495687_019511 3300047443 Bacteria 3324
228 Ga0495677_0015708 3300047445 Bacteria 2749
229 Ga0495679_009105 3300047446 Bacteria 3998
230 Ga0495685_000099 3300047447 Bacteria 31691
231 Ga0495673_0000005 3300047469 Bacteria 943364
232 Ga0495673_0000059 3300047469 Bacteria 233234
233 Ga0495673_0000064 3300047469 Bacteria 225793
234 Ga0495673_0009172 3300047469 Bacteria 5491
235 Ga0495686_0000462 3300047472 Bacteria 61070
236 Ga0496100_0062968 3300048903 Bacteria 2450
237 Ga0496104_0270382 3300048907 Bacteria 1612
238 Ga0496111_0130812 3300048914 Bacteria 1857
239 Ga0496114_0182131 3300048917 Bacteria 1835
240 Ga0496115_0027466 3300048918 Bacteria 4451
241 Ga0496115_0032578 3300048918 Bacteria 4111
242 Ga0496121_0041071 3300048924 Bacteria 4049
243 Ga0496126_0026271 3300048929 Bacteria 5585
244 Ga0495678_000588 3300049459 Bacteria 34196
245 Ga0495678_001787 3300049459 Bacteria 15903
246 Ga0495682_0000302 3300049460 Bacteria 37440
247 Ga0495682_0005251 3300049460 Bacteria 5412
248 Ga0501032_0139765 3300049569 Bacteria 1595
249 Ga0501047_0132605 3300049581 Bacteria 2371
250 Ga0501070_0054173 3300049586 Bacteria 3326
251 Ga0501079_0188538 3300049741 Bacteria 1609
252 Ga0501080_0284957 3300049742 Bacteria 1501
253 Ga0501044_0173459 3300049823 Bacteria 2126
254 Ga0500618_000137 3300053125 Bacteria 61561
255 Ga0500586_007231 3300053145 Bacteria 2947
256 Ga0500636_0058452 3300053177 Bacteria 2254
257 Ga0501084_0000096 3300054114 Bacteria 65139
258 Ga0501082_0000029 3300060353 Bacteria 100004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10130404 rootL2_101304043 356
2 iso_pu_bacteria 2842711865 2842717545 377
3 iso_pu_bacteria 2857558681 2857561958 377
4 3300025284 Ga0209130_1000084 Ga0209130_100008435 378
5 3300046520 Ga0495637_0000067 Ga0495637_0000067_37861_39006 381
6 3300046520 Ga0495637_0001897 Ga0495637_0001897_5695_6840 381
7 3300046530 Ga0495654_0000002 Ga0495654_0000002_725453_726598 381
8 3300047469 Ga0495673_0000059 Ga0495673_0000059_36522_37667 381
9 3300031250 Ga0265331_10031778 Ga0265331_100317783 383
10 3300003374 JGI25161J50226_1001694 JGI25161J50226_10016943 385
11 3300028800 Ga0265338_10000007 Ga0265338_10000007301 388
12 3300031241 Ga0265325_10000001 Ga0265325_10000001485 388
13 3300031249 Ga0265339_10003276 Ga0265339_1000327612 388
14 3300031595 Ga0265313_10001083 Ga0265313_1000108329 388
15 3300005937 Ga0081455_10004387 Ga0081455_1000438711 390
16 3300028577 Ga0265318_10000474 Ga0265318_100004744 390
17 3300009036 Ga0105244_10021853 Ga0105244_100218533 393
18 3300046471 Ga0495650_0000066 Ga0495650_0000066_201758_202939 393
19 3300046507 Ga0495606_0000125 Ga0495606_0000125_64883_66064 393
20 3300046616 Ga0495668_0002385 Ga0495668_0002385_4938_6119 393
21 3300046507 Ga0495606_0001352 Ga0495606_0001352_1633_2817 394
22 3300046524 Ga0495648_0045158 Ga0495648_0045158_1128_2327 395
23 3300025272 Ga0209455_1002746 Ga0209455_10027463 397
24 3300031711 Ga0265314_10037412 Ga0265314_100374125 397
25 3300054114 Ga0501084_0000096 Ga0501084_0000096_9229_10428 397
26 3300031247 Ga0265340_10016153 Ga0265340_100161535 399
27 3300039447 Ga0436361_0168778 Ga0436361_0168778_29700_30899 399
28 3300046512 Ga0495610_0004794 Ga0495610_0004794_6581_7783 400
29 3300046522 Ga0495643_0000022 Ga0495643_0000022_118168_119370 400
30 3300046538 Ga0495609_0054656 Ga0495609_0054656_123_1325 400
31 3300046542 Ga0495597_0000107 Ga0495597_0000107_49075_50277 400
32 3300046660 Ga0495625_0041347 Ga0495625_0041347_113_1315 400
33 3300046694 Ga0495649_0035119 Ga0495649_0035119_1155_2357 400
34 3300047318 Ga0495636_0008542 Ga0495636_0008542_682_1983 400
35 3300047320 Ga0495672_0000095 Ga0495672_0000095_72175_73377 400
36 3300048914 Ga0496111_0130812 Ga0496111_0130812_143_1345 400
37 3300049459 Ga0495678_000588 Ga0495678_000588_5659_6861 400
38 3300035112 Ga0373932_0014224 Ga0373932_0014224_506_1714 401
39 3300035691 Ga0373931_0037929 Ga0373931_0037929_394_1602 401
40 3300036401 Ga0373937_0021594 Ga0373937_0021594_2783_3991 401
41 3300047318 Ga0495636_0000599 Ga0495636_0000599_9500_10801 402
42 3300049569 Ga0501032_0139765 Ga0501032_0139765_32_1243 402
43 3300049581 Ga0501047_0132605 Ga0501047_0132605_579_1790 402
44 3300049741 Ga0501079_0188538 Ga0501079_0188538_355_1566 402
45 3300049823 Ga0501044_0173459 Ga0501044_0173459_28_1239 402
46 3300005458 Ga0070681_10002014 Ga0070681_100020146 403
47 3300005530 Ga0070679_100003267 Ga0070679_10000326714 403
48 3300025912 Ga0207707_10000002 Ga0207707_10000002967 403
49 3300025917 Ga0207660_10000069 Ga0207660_1000006944 403
50 3300025921 Ga0207652_10000299 Ga0207652_1000029961 403
51 3300015261 Ga0182006_1000319 Ga0182006_100031933 404
52 3300046471 Ga0495650_0008833 Ga0495650_0008833_1432_2652 404
53 3300046660 Ga0495625_0083673 Ga0495625_0083673_436_1656 404
54 3300046691 Ga0495670_0000152 Ga0495670_0000152_2333_3547 404
55 3300046454 Ga0495592_0087567 Ga0495592_0087567_320_1540 405
56 3300046477 Ga0495664_0016367 Ga0495664_0016367_2489_3709 405
57 3300046543 Ga0495645_0068524 Ga0495645_0068524_1284_2504 405
58 3300046559 Ga0495667_0116943 Ga0495667_0116943_320_1540 405
59 3300021361 Ga0213872_10000032 Ga0213872_1000003280 406
60 3300032004 Ga0307414_10100928 Ga0307414_101009281 406
61 3300047472 Ga0495686_0000462 Ga0495686_0000462_59380_60660 407
62 3300003773 Ga0055537_1000039 Ga0055537_100003933 408
63 3300003784 Ga0055534_1001322 Ga0055534_10013223 408
64 3300003790 Ga0055528_1000066 Ga0055528_100006635 408
65 3300005544 Ga0070686_100000544 Ga0070686_1000005444 408
66 3300025263 Ga0209565_1000003 Ga0209565_1000003331 408
67 3300025273 Ga0209673_1000003 Ga0209673_1000003217 408
68 3300025291 Ga0209675_1000003 Ga0209675_1000003707 408
69 3300025295 Ga0209564_1000012 Ga0209564_1000012515 408
70 3300025299 Ga0209256_1000395 Ga0209256_100039524 408
71 3300046512 Ga0495610_0000008 Ga0495610_0000008_185862_187142 408
72 3300046536 Ga0495587_0022611 Ga0495587_0022611_1504_2796 409
73 3300005458 Ga0070681_10014820 Ga0070681_100148202 410
74 3300005545 Ga0070695_100021238 Ga0070695_1000212385 410
75 3300025912 Ga0207707_10003173 Ga0207707_100031732 410
76 3300025916 Ga0207663_10066822 Ga0207663_100668222 410
77 3300025929 Ga0207664_10081408 Ga0207664_100814083 410
78 3300006237 Ga0097621_100041425 Ga0097621_1000414254 417
79 3300006881 Ga0068865_100084712 Ga0068865_1000847122 417
80 3300009174 Ga0105241_10252586 Ga0105241_102525861 417
81 3300026089 Ga0207648_10068400 Ga0207648_100684002 417
82 3300047315 Ga0495581_0029997 Ga0495581_0029997_176_1480 418
83 3300047321 Ga0495676_0080632 Ga0495676_0080632_952_2400 419
84 3300048918 Ga0496115_0032578 Ga0496115_0032578_1878_3194 419
85 iso_pu_bacteria 2738541297 2738828576 419
86 iso_pu_bacteria 2738541357 2739152372 419
87 iso_pu_bacteria 2738543003 2739194292 419
88 iso_pu_bacteria 2738543026 2739320768 419
89 iso_pu_bacteria 2738543029 2739339009 419
90 iso_pu_bacteria 2821131069 2821132818 419
91 3300003320 rootH2_10013258 rootH2_1001325815 420
92 3300003323 rootH1_10205323 rootH1_102053232 420
93 3300005262 Ga0065165_1000005 Ga0065165_1000005243 421
94 3300025295 Ga0209564_1000002 Ga0209564_1000002950 421
95 3300046501 Ga0495607_0004217 Ga0495607_0004217_1848_3128 421
96 3300046616 Ga0495668_0000006 Ga0495668_0000006_248148_249428 421
97 3300046664 Ga0495659_0012149 Ga0495659_0012149_210_1490 421
98 3300046694 Ga0495649_0063655 Ga0495649_0063655_628_1908 421
99 3300047443 Ga0495687_019511 Ga0495687_019511_74_1354 421
100 3300047446 Ga0495679_009105 Ga0495679_009105_1650_2930 421
101 iso_pu_bacteria 2643221554 2643792157 421
102 iso_pu_bacteria 2643221638 2644212347 421
103 3300003763 Ga0055529_1000068 Ga0055529_100006873 422
104 3300024227 Ga0228598_1004129 Ga0228598_10041293 422
105 3300046460 Ga0495638_0012112 Ga0495638_0012112_3480_4760 422
106 3300046471 Ga0495650_0001268 Ga0495650_0001268_14980_16260 422
107 3300046492 Ga0495585_0001481 Ga0495585_0001481_1065_2345 422
108 3300046524 Ga0495648_0022686 Ga0495648_0022686_1405_2685 422
109 3300046530 Ga0495654_0002388 Ga0495654_0002388_6757_8037 422
110 3300046616 Ga0495668_0001010 Ga0495668_0001010_25468_26748 422
111 3300046660 Ga0495625_0052498 Ga0495625_0052498_1064_2344 422
112 3300046665 Ga0495661_0005218 Ga0495661_0005218_6366_7646 422
113 3300046810 Ga0495660_0004699 Ga0495660_0004699_405_1685 422
114 3300047469 Ga0495673_0000064 Ga0495673_0000064_167552_168832 422
115 3300049586 Ga0501070_0054173 Ga0501070_0054173_1464_2738 422
116 3300053125 Ga0500618_000137 Ga0500618_000137_20362_21648 422
117 3300053145 Ga0500586_007231 Ga0500586_007231_1010_2290 422
118 3300060353 Ga0501082_0000029 Ga0501082_0000029_79666_80940 422
119 3300009093 Ga0105240_10001417 Ga0105240_100014179 423
120 3300010375 Ga0105239_10000030 Ga0105239_10000030127 423
121 3300025913 Ga0207695_10001438 Ga0207695_100014388 423
122 3300042876 Ga0451577_0059200 Ga0451577_0059200_12_1322 423
123 3300046463 Ga0495653_0000096 Ga0495653_0000096_68183_69472 423
124 3300046507 Ga0495606_0000128 Ga0495606_0000128_59611_60900 423
125 3300047469 Ga0495673_0000005 Ga0495673_0000005_607768_609057 423
126 3300048929 Ga0496126_0026271 Ga0496126_0026271_3846_5135 423
127 3300046473 Ga0495582_0009171 Ga0495582_0009171_276_1598 424
128 3300046476 Ga0495662_0049018 Ga0495662_0049018_151_1473 424
129 3300046517 Ga0495630_0000136 Ga0495630_0000136_7230_8552 424
130 3300046535 Ga0495586_0000018 Ga0495586_0000018_61869_63191 424
131 3300046642 Ga0495634_0003475 Ga0495634_0003475_6358_7680 424
132 3300046689 Ga0495613_0020845 Ga0495613_0020845_1880_3202 424
133 3300047319 Ga0495674_0003387 Ga0495674_0003387_26_1348 424
134 3300002773 JGI25152J39213_1000005 JGI25152J39213_1000005100 425
135 3300002774 JGI25150J39212_1000655 JGI25150J39212_10006558 425
136 3300002987 JGI25159J45721_1000430 JGI25159J45721_100043022 425
137 3300003374 JGI25161J50226_1000182 JGI25161J50226_100018228 425
138 3300003771 Ga0055526_1000780 Ga0055526_100078014 425
139 3300003771 Ga0055526_1002186 Ga0055526_10021869 425
140 3300003773 Ga0055537_1001912 Ga0055537_10019121 425
141 3300003773 Ga0055537_1003971 Ga0055537_10039713 425
142 3300003775 Ga0055524_1000187 Ga0055524_100018715 425
143 3300003775 Ga0055524_1000526 Ga0055524_100052619 425
144 3300003775 Ga0055524_1009240 Ga0055524_10092403 425
145 3300003784 Ga0055534_1002892 Ga0055534_10028923 425
146 3300003791 Ga0055530_10000946 Ga0055530_100009467 425
147 3300003791 Ga0055530_10006211 Ga0055530_100062112 425
148 3300003791 Ga0055530_10023632 Ga0055530_100236321 425
149 3300003794 Ga0055531_10012050 Ga0055531_100120501 425
150 3300003794 Ga0055531_10031361 Ga0055531_100313612 425
151 3300004625 Ga0055543_1000112 Ga0055543_100011255 425
152 3300005262 Ga0065165_1001050 Ga0065165_100105029 425
153 3300005435 Ga0070714_100013475 Ga0070714_1000134752 425
154 3300005435 Ga0070714_100134846 Ga0070714_1001348462 425
155 3300005439 Ga0070711_100235233 Ga0070711_1002352331 425
156 3300005539 Ga0068853_100002558 Ga0068853_1000025588 425
157 3300005563 Ga0068855_100070929 Ga0068855_1000709292 425
158 3300005841 Ga0068863_100055655 Ga0068863_1000556554 425
159 3300006028 Ga0070717_10001180 Ga0070717_1000118013 425
160 3300009545 Ga0105237_10115765 Ga0105237_101157651 425
161 3300009553 Ga0105249_10021457 Ga0105249_100214572 425
162 3300010375 Ga0105239_10006526 Ga0105239_100065268 425
163 3300025208 Ga0209436_101261 Ga0209436_1012613 425
164 3300025208 Ga0209436_103532 Ga0209436_1035324 425
165 3300025245 Ga0207425_1000001 Ga0207425_1000001216 425
166 3300025258 Ga0209129_1000003 Ga0209129_1000003216 425
167 3300025263 Ga0209565_1001217 Ga0209565_10012174 425
168 3300025263 Ga0209565_1001907 Ga0209565_10019074 425
169 3300025263 Ga0209565_1008745 Ga0209565_10087453 425
170 3300025263 Ga0209565_1014162 Ga0209565_10141622 425
171 3300025284 Ga0209130_1000237 Ga0209130_100023728 425
172 3300025284 Ga0209130_1004253 Ga0209130_10042533 425
173 3300025291 Ga0209675_1004244 Ga0209675_10042443 425
174 3300025295 Ga0209564_1000311 Ga0209564_100031130 425
175 3300025295 Ga0209564_1004642 Ga0209564_10046424 425
176 3300025297 Ga0209758_1000041 Ga0209758_1000041164 425
177 3300025298 Ga0209050_1000011 Ga0209050_1000011204 425
178 3300025298 Ga0209050_1000164 Ga0209050_100016450 425
179 3300025298 Ga0209050_1000280 Ga0209050_100028040 425
180 3300025298 Ga0209050_1000664 Ga0209050_100066445 425
181 3300025299 Ga0209256_1000068 Ga0209256_100006893 425
182 3300025299 Ga0209256_1000660 Ga0209256_100066015 425
183 3300025299 Ga0209256_1000702 Ga0209256_100070237 425
184 3300025302 Ga0207426_1008559 Ga0207426_10085593 425
185 3300025304 Ga0209257_1000003 Ga0209257_1000003976 425
186 3300025304 Ga0209257_1005947 Ga0209257_10059477 425
187 3300025906 Ga0207699_10008419 Ga0207699_100084195 425
188 3300025916 Ga0207663_10003643 Ga0207663_100036432 425
189 3300025928 Ga0207700_10058819 Ga0207700_100588192 425
190 3300025928 Ga0207700_10148200 Ga0207700_101482002 425
191 3300025929 Ga0207664_10010563 Ga0207664_100105634 425
192 3300025939 Ga0207665_10039514 Ga0207665_100395142 425
193 3300025949 Ga0207667_10114441 Ga0207667_101144412 425
194 3300031548 Ga0307408_100000490 Ga0307408_1000004902 425
195 3300031548 Ga0307408_100023608 Ga0307408_1000236085 425
196 3300031548 Ga0307408_100158440 Ga0307408_1001584402 425
197 3300037471 Ga0395905_0161792 Ga0395905_0161792_246_1532 425
198 3300046512 Ga0495610_0006848 Ga0495610_0006848_1895_3187 425
199 3300046557 Ga0495622_0000009 Ga0495622_0000009_181117_182463 425
200 3300046558 Ga0495633_0000024 Ga0495633_0000024_209742_211034 425
201 3300048903 Ga0496100_0062968 Ga0496100_0062968_745_2034 425
202 3300002075 JGI24738J21930_10000012 JGI24738J21930_1000001212 426
203 3300035172 Ga0373955_0082700 Ga0373955_0082700_294_1586 426
204 3300035724 Ga0373933_0016242 Ga0373933_0016242_392_1684 426
205 3300036401 Ga0373937_0001197 Ga0373937_0001197_17247_18539 426
206 3300039447 Ga0436361_0008254 Ga0436361_0008254_3348_4664 426
207 3300042184 Ga0450908_001950 Ga0450908_001950_1433_2755 426
208 3300046472 Ga0495580_0033421 Ga0495580_0033421_1018_2310 426
209 3300046474 Ga0495605_0026043 Ga0495605_0026043_1175_2488 426
210 3300046491 Ga0495584_0000995 Ga0495584_0000995_5731_7044 426
211 3300046492 Ga0495585_0082326 Ga0495585_0082326_346_1659 426
212 3300046501 Ga0495607_0031914 Ga0495607_0031914_339_1652 426
213 3300046501 Ga0495607_0035919 Ga0495607_0035919_1296_2609 426
214 3300046506 Ga0495583_0000021 Ga0495583_0000021_135030_136343 426
215 3300046513 Ga0495616_0004796 Ga0495616_0004796_5918_7231 426
216 3300046523 Ga0495644_0002052 Ga0495644_0002052_1853_3166 426
217 3300046524 Ga0495648_0000223 Ga0495648_0000223_14164_15477 426
218 3300046538 Ga0495609_0004354 Ga0495609_0004354_1986_3299 426
219 3300046648 Ga0495611_0005186 Ga0495611_0005186_3889_5202 426
220 3300046648 Ga0495611_0005326 Ga0495611_0005326_384_1697 426
221 3300046664 Ga0495659_0000161 Ga0495659_0000161_23941_25254 426
222 3300046691 Ga0495670_0020723 Ga0495670_0020723_20_1333 426
223 3300047318 Ga0495636_0000594 Ga0495636_0000594_7264_8577 426
224 3300047320 Ga0495672_0008167 Ga0495672_0008167_6085_7398 426
225 3300047320 Ga0495672_0032072 Ga0495672_0032072_1593_2906 426
226 3300047323 Ga0495683_0023812 Ga0495683_0023812_1639_2952 426
227 3300047445 Ga0495677_0015708 Ga0495677_0015708_78_1391 426
228 3300047447 Ga0495685_000099 Ga0495685_000099_3210_4523 426
229 3300047469 Ga0495673_0009172 Ga0495673_0009172_3674_4987 426
230 3300049459 Ga0495678_001787 Ga0495678_001787_10487_11800 426
231 3300049460 Ga0495682_0000302 Ga0495682_0000302_25650_26963 426
232 3300049460 Ga0495682_0005251 Ga0495682_0005251_1751_3064 426
233 iso_pu_bacteria 2739367700 2739730296 426
234 3300005577 Ga0068857_100032701 Ga0068857_1000327013 428
235 3300025913 Ga0207695_10001749 Ga0207695_100017495 428
236 3300026116 Ga0207674_10106058 Ga0207674_101060582 428
237 3300035116 Ga0373945_0007846 Ga0373945_0007846_633_2021 428
238 3300035692 Ga0373935_0002578 Ga0373935_0002578_1004_2392 428
239 3300035695 Ga0373927_0089891 Ga0373927_0089891_186_1574 428
240 3300037068 Ga0373925_0013310 Ga0373925_0013310_2831_4219 428
241 3300046517 Ga0495630_0004801 Ga0495630_0004801_289_1677 428
242 3300046526 Ga0495666_0023828 Ga0495666_0023828_327_1715 428
243 3300053177 Ga0500636_0058452 Ga0500636_0058452_345_1637 428
244 3300009174 Ga0105241_10191545 Ga0105241_101915451 429
245 3300014325 Ga0163163_10000085 Ga0163163_1000008532 429
246 3300046678 Ga0495599_0026444 Ga0495599_0026444_2087_3403 429
247 3300048917 Ga0496114_0182131 Ga0496114_0182131_19_1314 429
248 3300002737 JGI25162J39368_1000163 JGI25162J39368_100016332 430
249 3300004625 Ga0055543_1011336 Ga0055543_10113362 430
250 3300005262 Ga0065165_1001863 Ga0065165_10018638 430
251 3300005340 Ga0070689_100016454 Ga0070689_1000164545 430
252 3300005439 Ga0070711_100104229 Ga0070711_1001042292 430
253 3300005455 Ga0070663_100039436 Ga0070663_1000394363 430
254 3300005983 Ga0081540_1002263 Ga0081540_10022636 430
255 3300009551 Ga0105238_10124192 Ga0105238_101241923 430
256 3300015687 Ga0183368_1002 Ga0183368_1002286 430
257 3300025228 Ga0209672_100614 Ga0209672_1006149 430
258 3300025302 Ga0207426_1008940 Ga0207426_10089402 430
259 3300025924 Ga0207694_10023987 Ga0207694_100239872 430
260 3300025936 Ga0207670_10000772 Ga0207670_1000077214 430
261 3300026067 Ga0207678_10074717 Ga0207678_100747174 430
262 3300048907 Ga0496104_0270382 Ga0496104_0270382_177_1496 430
263 3300048918 Ga0496115_0027466 Ga0496115_0027466_2825_4144 430
264 3300048924 Ga0496121_0041071 Ga0496121_0041071_2628_3947 430
265 3300049742 Ga0501080_0284957 Ga0501080_0284957_17_1315 430
266 3300013296 Ga0157374_10003664 Ga0157374_1000366417 431
267 3300003316 rootH1_10044045 rootH1_100440453 432
268 3300009093 Ga0105240_10112532 Ga0105240_101125322 432
269 3300001989 JGI24739J22299_10000407 JGI24739J22299_1000040711 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

150

497

0.87

PF07969

Amidohydro_3

Amidohydrolase family

254

497

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qs8-assembly1.cif.gz_A crystal structure of a xaa-pro dipeptidase with bound methionine in the active site 0.8892 24 424
3be7-assembly1.cif.gz_G crystal structure of zn-dependent arginine carboxypeptidase 0.8858 26 425
3be7-assembly1.cif.gz_G crystal structure of zn-dependent arginine carboxypeptidase 0.8814 26 425
2qs8-assembly1.cif.gz_A crystal structure of a xaa-pro dipeptidase with bound methionine in the active site 0.8765 24 424
3n2c-assembly1.cif.gz_A crystal structure of prolidase eah89906 complexed with n-methylphosphonate-l-proline 0.8713 24 425
ID Description Score Start End Superfamily
3gnhA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8978 25 82 2.30.40.10
3be7A01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.882 23 82 2.30.40.10
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8798 24 81 2.30.40.10
4dzhA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8739 24 81 2.30.40.10
3feqK01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.854 24 81 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A534AC24-F1-model_v4 Amidohydrolase family protein 0.993 336 426 GO:0016810
AF-A0A850MTW3-F1-model_v4 deleted 0.991 49 426
AF-A0A536M161-F1-model_v4 Amidohydrolase family protein 0.9886 17 394 GO:0016810
AF-A0A2V7RTL0-F1-model_v4 Amidohydrolase 0.9815 27 425 GO:0016810
AF-A0A850MTW3-F1-model_v4 deleted 0.9807 49 426

Feature Viewer

pLDDT pTM Quality
90.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map