F376067

General Info

Members Datasets Scaffolds Average Seq Length
269 188 538 121

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100379299|Ga0070686_1003792992
Length 150
Sequence MRRPPNGRFGAASAPRLREDDRASMRAYFGSYTTVGSVILAGLGFIVVAFTAARLVRPQRPGREKYLTYECGIDPVGVGWSQTQIRYYVFAFLFVIFDVESVFLFPFANVLNAFTRAGNGGPVFVEMVVFVAILLVGLVYAWKKKVLEWV

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
53 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
99 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
171 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
178 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
179 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
180 2818991459 Paenibacillus sp. 597 Isolate Unclassified
181 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
182 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
183 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
184 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
185 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
186 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
187 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
188 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 0
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.75
Nodule 0
Rhizoplane 2.6
Rhizosphere 76.58
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100379299 3300005544 Bacteria 1070
2 JGI25151J46595_10041932 3300003187 Bacteria 1656
3 Ga0055535_1009623 3300003761 Bacteria 1648
4 Ga0055541_1002509 3300003841 Bacteria 3651
5 Ga0055541_1012880 3300003841 Bacteria 1188
6 Ga0070676_10882917 3300005328 Bacteria 665
7 Ga0070690_100132638 3300005330 Bacteria 1684
8 Ga0070670_100226825 3300005331 Bacteria 1626
9 Ga0070670_100460234 3300005331 Bacteria 1128
10 Ga0068868_100379018 3300005338 Bacteria 1217
11 Ga0070687_100928364 3300005343 Bacteria 626
12 Ga0070692_10929884 3300005345 Unclassified 603
13 Ga0070668_101611070 3300005347 Bacteria 595
14 Ga0070675_100926640 3300005354 Bacteria 799
15 Ga0070675_101096720 3300005354 Bacteria 732
16 Ga0070671_100000397 3300005355 Bacteria 29950
17 Ga0070671_100425178 3300005355 Bacteria 1138
18 Ga0070674_100131748 3300005356 Bacteria 1865
19 Ga0070673_100878698 3300005364 Bacteria 830
20 Ga0070688_100096957 3300005365 Bacteria 1938
21 Ga0070700_100083896 3300005441 Bacteria 2064
22 Ga0070708_100312623 3300005445 Bacteria 1480
23 Ga0070663_100257562 3300005455 Bacteria 1383
24 Ga0070663_101203264 3300005455 Bacteria 666
25 Ga0070678_100215920 3300005456 Bacteria 1592
26 Ga0070706_100712554 3300005467 Bacteria 930
27 Ga0070698_102155463 3300005471 Bacteria 511
28 Ga0070699_100429268 3300005518 Bacteria 1197
29 Ga0070697_100209248 3300005536 Bacteria 1660
30 Ga0070672_100469276 3300005543 Bacteria 1086
31 Ga0070686_100422392 3300005544 Bacteria 1019
32 Ga0070693_101565861 3300005547 Bacteria 517
33 Ga0070702_100123074 3300005615 Bacteria 1627
34 Ga0068852_102178647 3300005616 Bacteria 576
35 Ga0068864_100456987 3300005618 Bacteria 1222
36 Ga0068864_102185409 3300005618 Bacteria 560
37 Ga0068858_100032587 3300005842 Bacteria 4839
38 Ga0081455_10122101 3300005937 Bacteria 2051
39 Ga0081455_10225001 3300005937 Bacteria 1388
40 Ga0075365_10194967 3300006038 Bacteria 1418
41 Ga0075365_10852768 3300006038 Bacteria 643
42 Ga0075363_100191792 3300006048 Bacteria 1166
43 Ga0075364_10197321 3300006051 Bacteria 1364
44 Ga0075364_10453994 3300006051 Bacteria 875
45 Ga0075432_10415039 3300006058 Bacteria 584
46 Ga0075362_10749142 3300006177 Bacteria 512
47 Ga0075367_10457496 3300006178 Bacteria 809
48 Ga0075367_10545981 3300006178 Bacteria 736
49 Ga0075369_10081859 3300006186 Bacteria 1433
50 Ga0097621_100891341 3300006237 Bacteria 828
51 Ga0075370_10439482 3300006353 Bacteria 785
52 Ga0075370_10999473 3300006353 Bacteria 513
53 Ga0068871_100244272 3300006358 Bacteria 1562
54 Ga0075428_100416270 3300006844 Bacteria 1440
55 Ga0075431_101105523 3300006847 Bacteria 757
56 Ga0068865_101627531 3300006881 Bacteria 581
57 Ga0075435_100033960 3300007076 Bacteria 4038
58 Ga0111539_10048404 3300009094 Bacteria 5075
59 Ga0105245_10626489 3300009098 Bacteria 1104
60 Ga0114129_12236826 3300009147 Bacteria 657
61 Ga0105243_10004392 3300009148 Bacteria 11154
62 Ga0105243_11304050 3300009148 Bacteria 743
63 Ga0105248_10565396 3300009177 Bacteria 1283
64 Ga0105249_10034281 3300009553 Bacteria 4599
65 Ga0157319_1041661 3300012497 Bacteria 539
66 Ga0157342_1052329 3300012507 Bacteria 578
67 Ga0157375_10034145 3300013308 Bacteria 4843
68 Ga0157375_11546928 3300013308 Bacteria 783
69 Ga0163163_10633293 3300014325 Bacteria 1133
70 Ga0157380_10091678 3300014326 Bacteria 2509
71 Ga0157380_10221389 3300014326 Bacteria 1693
72 Ga0157380_12207546 3300014326 Bacteria 614
73 Ga0157380_12424727 3300014326 Unclassified 590
74 Ga0157379_10523111 3300014968 Bacteria 1101
75 Ga0163161_10008305 3300017792 Bacteria 7189
76 Ga0213872_10271649 3300021361 Unclassified 710
77 Ga0209784_104192 3300025224 Bacteria 1069
78 Ga0209566_100112 3300025225 Bacteria 111585
79 Ga0209566_100158 3300025225 Bacteria 76076
80 Ga0209258_101698 3300025242 Bacteria 6920
81 Ga0209675_1010172 3300025291 Bacteria 3238
82 Ga0209676_1003730 3300025292 Bacteria 9065
83 Ga0209025_1004883 3300025294 Bacteria 11296
84 Ga0207682_10064890 3300025893 Bacteria 1536
85 Ga0207682_10431612 3300025893 Bacteria 623
86 Ga0207692_11107395 3300025898 Bacteria 525
87 Ga0207688_10302012 3300025901 Bacteria 979
88 Ga0207645_10454107 3300025907 Bacteria 865
89 Ga0207684_10528366 3300025910 Bacteria 1010
90 Ga0207650_10081758 3300025925 Bacteria 2451
91 Ga0207687_10936113 3300025927 Bacteria 742
92 Ga0207664_10696493 3300025929 Bacteria 913
93 Ga0207644_10017869 3300025931 Bacteria 4795
94 Ga0207709_10248021 3300025935 Bacteria 1299
95 Ga0207709_10579072 3300025935 Bacteria 886
96 Ga0207669_10104923 3300025937 Bacteria 1879
97 Ga0207669_10198189 3300025937 Bacteria 1455
98 Ga0207665_10438388 3300025939 Bacteria 1000
99 Ga0207691_10232481 3300025940 Bacteria 1596
100 Ga0207661_10610343 3300025944 Bacteria 1002
101 Ga0207667_10366524 3300025949 Bacteria 1469
102 Ga0207651_10084183 3300025960 Bacteria 2303
103 Ga0207712_10111217 3300025961 Bacteria 2055
104 Ga0207668_11108566 3300025972 Bacteria 710
105 Ga0207703_11076145 3300026035 Bacteria 772
106 Ga0207641_11151025 3300026088 Bacteria 775
107 Ga0207676_10388472 3300026095 Bacteria 1301
108 Ga0207676_11405343 3300026095 Bacteria 694
109 Ga0207675_100994240 3300026118 Bacteria 857
110 Ga0207683_10813948 3300026121 Bacteria 867
111 Ga0316576_10055926 3300031727 Bacteria 2881
112 Ga0316576_10184411 3300031727 Bacteria 1574
113 Ga0316576_10900668 3300031727 Bacteria 633
114 Ga0316578_10158599 3300031728 Bacteria 1363
115 Ga0316577_10699599 3300031733 Bacteria 576
116 Ga0307413_10015550 3300031824 Bacteria 3903
117 Ga0307407_10177378 3300031903 Bacteria 1409
118 Ga0307409_100090989 3300031995 Bacteria 2499
119 Ga0307409_100938134 3300031995 Bacteria 881
120 Ga0307411_10101041 3300032005 Bacteria 2040
121 Ga0307411_11346455 3300032005 Bacteria 652
122 Ga0307415_100401455 3300032126 Bacteria 1170
123 Ga0307415_100919347 3300032126 Bacteria 808
124 Ga0373930_0003764 3300034816 Bacteria 2431
125 Ga0373930_0075510 3300034816 Bacteria 772
126 Ga0373948_0005722 3300034817 Bacteria 2025
127 Ga0373928_0075048 3300035084 Bacteria 843
128 Ga0373929_0005237 3300035085 Bacteria 2333
129 Ga0373932_0000085 3300035112 Bacteria 24383
130 Ga0373932_0203035 3300035112 Bacteria 705
131 Ga0373946_0763852 3300035171 Bacteria 508
132 Ga0316574_0038554 3300035398 Bacteria 2934
133 Ga0316574_0040872 3300035398 Bacteria 2856
134 Ga0316574_0256499 3300035398 Bacteria 1117
135 Ga0316574_0894854 3300035398 Bacteria 537
136 Ga0373931_0000003 3300035691 Bacteria 560286
137 Ga0373931_0000313 3300035691 Bacteria 20504
138 Ga0316582_0012593 3300036647 Bacteria 4728
139 Ga0316582_0250293 3300036647 Bacteria 1214
140 Ga0316584_0000786 3300036712 Bacteria 17822
141 Ga0316584_0403534 3300036712 Bacteria 973
142 Ga0436364_1078844 3300037853 Unclassified 814
143 Ga0436365_0125065 3300039437 Bacteria 3904
144 Ga0436360_0230811 3300039438 Bacteria 2019
145 Ga0436361_0806032 3300039447 Bacteria 1893
146 Ga0436363_1710562 3300039450 Bacteria 553
147 Ga0436362_0177431 3300039453 Bacteria 3577
148 Ga0436362_0419802 3300039453 Bacteria 910
149 Ga0436362_0735814 3300039453 Bacteria 621
150 Ga0436362_1125993 3300039453 Bacteria 1402
151 Ga0451791_0891576 3300041451 Bacteria 858
152 Ga0451791_0940731 3300041451 Bacteria 937
153 Ga0451793_0728966 3300041452 Bacteria 552
154 Ga0451835_0089671 3300041492 Bacteria 705
155 Ga0451837_1715693 3300041494 Bacteria 816
156 Ga0451845_0902803 3300041501 Bacteria 967
157 Ga0451855_1042274 3300041511 Bacteria 596
158 Ga0451853_2870277 3300041512 Bacteria 1110
159 Ga0451853_3369081 3300041512 Bacteria 1171
160 Ga0439434_0123677 3300042435 Bacteria 845
161 Ga0439434_0260470 3300042435 Bacteria 594
162 Ga0495659_0387543 3300046664 Bacteria 602
163 Ga0495672_0005230 3300047320 Bacteria 10337
164 Ga0495676_0170996 3300047321 Bacteria 1529
165 Ga0496101_0653586 3300048904 Bacteria 831
166 Ga0496110_0002174 3300048913 Bacteria 14645
167 Ga0496114_0139286 3300048917 Bacteria 2100
168 Ga0496114_0502902 3300048917 Bacteria 1072
169 Ga0496116_0041312 3300048919 Bacteria 3165
170 Ga0501031_0446884 3300049568 Bacteria 835
171 Ga0501032_0839193 3300049569 Bacteria 580
172 Ga0501033_0497218 3300049570 Bacteria 844
173 Ga0501036_0094617 3300049572 Bacteria 2525
174 Ga0501036_0330107 3300049572 Bacteria 1274
175 Ga0501038_0390120 3300049574 Bacteria 1079
176 Ga0501038_0491861 3300049574 Bacteria 939
177 Ga0501039_0252509 3300049575 Bacteria 1386
178 Ga0501039_1270184 3300049575 Bacteria 568
179 Ga0501040_0575046 3300049576 Bacteria 814
180 Ga0501040_0623120 3300049576 Bacteria 779
181 Ga0501040_0754010 3300049576 Bacteria 704
182 Ga0501041_0036965 3300049577 Bacteria 2958
183 Ga0501041_0258473 3300049577 Bacteria 1095
184 Ga0501041_0424074 3300049577 Bacteria 844
185 Ga0501042_0052232 3300049578 Bacteria 2915
186 Ga0501042_0636810 3300049578 Bacteria 775
187 Ga0501043_0494783 3300049579 Bacteria 914
188 Ga0501046_0460312 3300049580 Bacteria 914
189 Ga0501046_0970322 3300049580 Bacteria 591
190 Ga0501047_0126544 3300049581 Bacteria 2436
191 Ga0501048_0266015 3300049582 Bacteria 1218
192 Ga0501067_0180026 3300049583 Bacteria 1177
193 Ga0501068_0014903 3300049584 Bacteria 4453
194 Ga0501068_0449063 3300049584 Bacteria 834
195 Ga0501068_0560612 3300049584 Bacteria 743
196 Ga0501069_0042473 3300049585 Bacteria 2515
197 Ga0501069_0132496 3300049585 Bacteria 1428
198 Ga0501070_0301691 3300049586 Bacteria 1305
199 Ga0501071_0189461 3300049587 Bacteria 1542
200 Ga0501071_0520290 3300049587 Bacteria 913
201 Ga0501072_0001973 3300049588 Bacteria 15290
202 Ga0501072_0113810 3300049588 Bacteria 2154
203 Ga0501072_1027870 3300049588 Bacteria 642
204 Ga0501073_1018785 3300049589 Bacteria 570
205 Ga0501074_0184068 3300049590 Bacteria 1490
206 Ga0501074_1141037 3300049590 Bacteria 547
207 Ga0501075_0050258 3300049591 Bacteria 3134
208 Ga0501075_0072969 3300049591 Bacteria 2595
209 Ga0501075_0109223 3300049591 Bacteria 2103
210 Ga0501076_0092211 3300049592 Bacteria 2437
211 Ga0501076_0871370 3300049592 Bacteria 743
212 Ga0501076_0928919 3300049592 Bacteria 717
213 Ga0501076_1341406 3300049592 Bacteria 588
214 Ga0501077_0696063 3300049593 Bacteria 653
215 Ga0501077_0749325 3300049593 Bacteria 628
216 Ga0501207_110069 3300049654 Bacteria 562
217 Ga0501233_148271 3300049668 Bacteria 653
218 Ga0501079_0820026 3300049741 Bacteria 733
219 Ga0501080_0200699 3300049742 Bacteria 1831
220 Ga0501080_0292874 3300049742 Bacteria 1478
221 Ga0501080_0880690 3300049742 Bacteria 781
222 Ga0501080_1701656 3300049742 Bacteria 532
223 Ga0501081_0102008 3300049743 Bacteria 2029
224 Ga0501081_0375272 3300049743 Bacteria 1050
225 Ga0501081_1294406 3300049743 Bacteria 553
226 Ga0501279_064153 3300049775 Bacteria 607
227 Ga0501035_0215767 3300049822 Bacteria 1640
228 Ga0501044_0005201 3300049823 Bacteria 14481
229 Ga0501045_0039035 3300049824 Bacteria 3455
230 Ga0501045_0175521 3300049824 Bacteria 1596
231 Ga0501045_0724253 3300049824 Bacteria 734
232 nmdc:mga03683_554076_c1 3300050489 Bacteria 560
233 nmdc:mga03n38_524934_c1 3300050490 Bacteria 667
234 nmdc:mga00v17_187244_c1 3300050491 Bacteria 1336
235 nmdc:mga00v17_436931_c1 3300050491 Bacteria 850
236 nmdc:mga0yw44_165796_c1 3300050492 Bacteria 1448
237 nmdc:mga0yw44_717052_c1 3300050492 Bacteria 679
238 nmdc:mga0yw44_726136_c1 3300050492 Bacteria 675
239 nmdc:mga0yw44_961238_c1 3300050492 Bacteria 579
240 nmdc:mga06z11_486866_c1 3300050494 Bacteria 747
241 nmdc:mga07m45_699482_c1 3300050496 Bacteria 583
242 nmdc:mga05p37_1186008_c1 3300050507 Bacteria 790
243 nmdc:mga08y16_579008_c1 3300050511 Bacteria 1133
244 Ga0500566_0000081 3300053094 Bacteria 47157
245 Ga0500593_152609 3300053117 Bacteria 894
246 Ga0500628_095013 3300053129 Bacteria 782
247 Ga0500568_0000029 3300053139 Bacteria 159927
248 Ga0500616_0000171 3300053153 Bacteria 108118
249 Ga0501084_0268615 3300054114 Bacteria 1440
250 Ga0501084_1190014 3300054114 Bacteria 639
251 Ga0501082_0109138 3300060353 Bacteria 2395
252 Ga0501082_0351545 3300060353 Bacteria 1285
253 Ga0501082_0549559 3300060353 Bacteria 1010
254 Ga0501082_1191576 3300060353 Bacteria 666
255 Ga0501082_1571981 3300060353 Bacteria 574
256 Ga0501082_1895700 3300060353 Bacteria 520
257 Ga0530510_0811123 3300061734 Bacteria 714
258 2587743570 2585428059 Bacteria 8696589
259 2595320301 2593339198 Bacteria 7267884
260 2644423864 2643221676 Bacteria 8119172
261 2819675668 2818991459 Bacteria 8736032
262 2857460415 2857453340 Bacteria 8090534
263 2904762841 2904755435 Bacteria 7986759
264 2919430619 2919425241 Bacteria 8055701
265 2925329266 2925326138 Bacteria 9652120
266 2929206975 2929206907 Bacteria 5918291
267 2971416658 2971410472 Bacteria 8311090
268 2980128011 2980125574 Bacteria 5567337
269 8056536001 8056533031 Bacteria 8964429
270 Ga0070686_100379299
271 JGI25151J46595_10041932
272 Ga0055535_1009623
273 Ga0055541_1002509
274 Ga0055541_1012880
275 Ga0070676_10882917
276 Ga0070690_100132638
277 Ga0070670_100226825
278 Ga0070670_100460234
279 Ga0068868_100379018
280 Ga0070687_100928364
281 Ga0070692_10929884
282 Ga0070668_101611070
283 Ga0070675_100926640
284 Ga0070675_101096720
285 Ga0070671_100000397
286 Ga0070671_100425178
287 Ga0070674_100131748
288 Ga0070673_100878698
289 Ga0070688_100096957
290 Ga0070700_100083896
291 Ga0070708_100312623
292 Ga0070663_100257562
293 Ga0070663_101203264
294 Ga0070678_100215920
295 Ga0070706_100712554
296 Ga0070698_102155463
297 Ga0070699_100429268
298 Ga0070697_100209248
299 Ga0070672_100469276
300 Ga0070686_100422392
301 Ga0070693_101565861
302 Ga0070702_100123074
303 Ga0068852_102178647
304 Ga0068864_100456987
305 Ga0068864_102185409
306 Ga0068858_100032587
307 Ga0081455_10122101
308 Ga0081455_10225001
309 Ga0075365_10194967
310 Ga0075365_10852768
311 Ga0075363_100191792
312 Ga0075364_10197321
313 Ga0075364_10453994
314 Ga0075432_10415039
315 Ga0075362_10749142
316 Ga0075367_10457496
317 Ga0075367_10545981
318 Ga0075369_10081859
319 Ga0097621_100891341
320 Ga0075370_10439482
321 Ga0075370_10999473
322 Ga0068871_100244272
323 Ga0075428_100416270
324 Ga0075431_101105523
325 Ga0068865_101627531
326 Ga0075435_100033960
327 Ga0111539_10048404
328 Ga0105245_10626489
329 Ga0114129_12236826
330 Ga0105243_10004392
331 Ga0105243_11304050
332 Ga0105248_10565396
333 Ga0105249_10034281
334 Ga0157319_1041661
335 Ga0157342_1052329
336 Ga0157375_10034145
337 Ga0157375_11546928
338 Ga0163163_10633293
339 Ga0157380_10091678
340 Ga0157380_10221389
341 Ga0157380_12207546
342 Ga0157380_12424727
343 Ga0157379_10523111
344 Ga0163161_10008305
345 Ga0213872_10271649
346 Ga0209784_104192
347 Ga0209566_100112
348 Ga0209566_100158
349 Ga0209258_101698
350 Ga0209675_1010172
351 Ga0209676_1003730
352 Ga0209025_1004883
353 Ga0207682_10064890
354 Ga0207682_10431612
355 Ga0207692_11107395
356 Ga0207688_10302012
357 Ga0207645_10454107
358 Ga0207684_10528366
359 Ga0207650_10081758
360 Ga0207687_10936113
361 Ga0207664_10696493
362 Ga0207644_10017869
363 Ga0207709_10248021
364 Ga0207709_10579072
365 Ga0207669_10104923
366 Ga0207669_10198189
367 Ga0207665_10438388
368 Ga0207691_10232481
369 Ga0207661_10610343
370 Ga0207667_10366524
371 Ga0207651_10084183
372 Ga0207712_10111217
373 Ga0207668_11108566
374 Ga0207703_11076145
375 Ga0207641_11151025
376 Ga0207676_10388472
377 Ga0207676_11405343
378 Ga0207675_100994240
379 Ga0207683_10813948
380 Ga0316576_10055926
381 Ga0316576_10184411
382 Ga0316576_10900668
383 Ga0316578_10158599
384 Ga0316577_10699599
385 Ga0307413_10015550
386 Ga0307407_10177378
387 Ga0307409_100090989
388 Ga0307409_100938134
389 Ga0307411_10101041
390 Ga0307411_11346455
391 Ga0307415_100401455
392 Ga0307415_100919347
393 Ga0373930_0003764
394 Ga0373930_0075510
395 Ga0373948_0005722
396 Ga0373928_0075048
397 Ga0373929_0005237
398 Ga0373932_0000085
399 Ga0373932_0203035
400 Ga0373946_0763852
401 Ga0316574_0038554
402 Ga0316574_0040872
403 Ga0316574_0256499
404 Ga0316574_0894854
405 Ga0373931_0000003
406 Ga0373931_0000313
407 Ga0316582_0012593
408 Ga0316582_0250293
409 Ga0316584_0000786
410 Ga0316584_0403534
411 Ga0436364_1078844
412 Ga0436365_0125065
413 Ga0436360_0230811
414 Ga0436361_0806032
415 Ga0436363_1710562
416 Ga0436362_0177431
417 Ga0436362_0419802
418 Ga0436362_0735814
419 Ga0436362_1125993
420 Ga0451791_0891576
421 Ga0451791_0940731
422 Ga0451793_0728966
423 Ga0451835_0089671
424 Ga0451837_1715693
425 Ga0451845_0902803
426 Ga0451855_1042274
427 Ga0451853_2870277
428 Ga0451853_3369081
429 Ga0439434_0123677
430 Ga0439434_0260470
431 Ga0495659_0387543
432 Ga0495672_0005230
433 Ga0495676_0170996
434 Ga0496101_0653586
435 Ga0496110_0002174
436 Ga0496114_0139286
437 Ga0496114_0502902
438 Ga0496116_0041312
439 Ga0501031_0446884
440 Ga0501032_0839193
441 Ga0501033_0497218
442 Ga0501036_0094617
443 Ga0501036_0330107
444 Ga0501038_0390120
445 Ga0501038_0491861
446 Ga0501039_0252509
447 Ga0501039_1270184
448 Ga0501040_0575046
449 Ga0501040_0623120
450 Ga0501040_0754010
451 Ga0501041_0036965
452 Ga0501041_0258473
453 Ga0501041_0424074
454 Ga0501042_0052232
455 Ga0501042_0636810
456 Ga0501043_0494783
457 Ga0501046_0460312
458 Ga0501046_0970322
459 Ga0501047_0126544
460 Ga0501048_0266015
461 Ga0501067_0180026
462 Ga0501068_0014903
463 Ga0501068_0449063
464 Ga0501068_0560612
465 Ga0501069_0042473
466 Ga0501069_0132496
467 Ga0501070_0301691
468 Ga0501071_0189461
469 Ga0501071_0520290
470 Ga0501072_0001973
471 Ga0501072_0113810
472 Ga0501072_1027870
473 Ga0501073_1018785
474 Ga0501074_0184068
475 Ga0501074_1141037
476 Ga0501075_0050258
477 Ga0501075_0072969
478 Ga0501075_0109223
479 Ga0501076_0092211
480 Ga0501076_0871370
481 Ga0501076_0928919
482 Ga0501076_1341406
483 Ga0501077_0696063
484 Ga0501077_0749325
485 Ga0501207_110069
486 Ga0501233_148271
487 Ga0501079_0820026
488 Ga0501080_0200699
489 Ga0501080_0292874
490 Ga0501080_0880690
491 Ga0501080_1701656
492 Ga0501081_0102008
493 Ga0501081_0375272
494 Ga0501081_1294406
495 Ga0501279_064153
496 Ga0501035_0215767
497 Ga0501044_0005201
498 Ga0501045_0039035
499 Ga0501045_0175521
500 Ga0501045_0724253
501 nmdc:mga03683_554076_c1
502 nmdc:mga03n38_524934_c1
503 nmdc:mga00v17_187244_c1
504 nmdc:mga00v17_436931_c1
505 nmdc:mga0yw44_165796_c1
506 nmdc:mga0yw44_717052_c1
507 nmdc:mga0yw44_726136_c1
508 nmdc:mga0yw44_961238_c1
509 nmdc:mga06z11_486866_c1
510 nmdc:mga07m45_699482_c1
511 nmdc:mga05p37_1186008_c1
512 nmdc:mga08y16_579008_c1
513 Ga0500566_0000081
514 Ga0500593_152609
515 Ga0500628_095013
516 Ga0500568_0000029
517 Ga0500616_0000171
518 Ga0501084_0268615
519 Ga0501084_1190014
520 Ga0501082_0109138
521 Ga0501082_0351545
522 Ga0501082_0549559
523 Ga0501082_1191576
524 Ga0501082_1571981
525 Ga0501082_1895700
526 Ga0530510_0811123
527 2587743570
528 2595320301
529 2644423864
530 2819675668
531 2857460415
532 2904762841
533 2919430619
534 2925329266
535 2929206975
536 2971416658
537 2980128011
538 8056536001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

46

149

0.93

Map