F376056

General Info

Members Datasets Scaffolds Average Seq Length
269 159 538 376

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100043539|Ga0070699_1000435392
Length 420
Sequence MLERFGWQANLWSCWGVLLVNPESRIPNPETQAWDLELGIWVLGFMFTVYSDVMPLDVAAIQESLRSDGLDAWLLYDFHGSNPIAARLAGLNNGAHMTTRRWYYLIPASGSPRALVHAIERHNLDALPGNKQTRRVAMEYSPQGAIPYLSRVDAGTAELIRSRGVEIVSSGDLVQRFEAAWTPAQLETHMRASDALYRIKDRAFDRARSALERRERITEYDLQQQMVKWFEEEGLVSDSAPDVALGANAGNPHYLPSKDHSAVITPGQVLLLDLWGKVEQPGAVFADITWVGFTGSRAPDEAIRAFAVALVEEAALTGRELHGWEVDRAARGVLEQSGYGDHILHRTGHSLGETVHGNGVHLDDYETHDDRRILPGTGFTVEPGLYFDTFGVRTEINVFRGDRDVAVSGPRQVALVTLGT

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 3.72
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100043539 3300005518 Bacteria 3885
2 JGI25406J46586_10001064 3300003203 Bacteria 12880
3 Ga0065704_10002321 3300005289 Bacteria 10889
4 Ga0065712_10095856 3300005290 Bacteria 2204
5 Ga0065712_10126564 3300005290 Unclassified 1600
6 Ga0065715_10090507 3300005293 Bacteria 6886
7 Ga0065707_10001199 3300005295 Bacteria 7554
8 Ga0065707_10098652 3300005295 Bacteria 3069
9 Ga0070676_10050921 3300005328 Bacteria 2429
10 Ga0070683_100000059 3300005329 Bacteria 81605
11 Ga0070690_100002481 3300005330 Bacteria 9920
12 Ga0070670_100042098 3300005331 Bacteria 3925
13 Ga0070666_10012814 3300005335 Bacteria 5301
14 Ga0070666_10016365 3300005335 Bacteria 4744
15 Ga0070666_10027416 3300005335 Bacteria 3731
16 Ga0068868_100014035 3300005338 Bacteria 5894
17 Ga0070661_100010179 3300005344 Bacteria 6532
18 Ga0070669_100003334 3300005353 Bacteria 11544
19 Ga0070675_100000853 3300005354 Bacteria 21624
20 Ga0070671_100002079 3300005355 Bacteria 15417
21 Ga0070674_100091587 3300005356 Bacteria 2196
22 Ga0070674_100115020 3300005356 Unclassified 1982
23 Ga0070673_100042585 3300005364 Bacteria 3502
24 Ga0070673_100213388 3300005364 Bacteria 1668
25 Ga0070688_100004223 3300005365 Bacteria 7466
26 Ga0070713_100033350 3300005436 Unclassified 4123
27 Ga0070701_10075939 3300005438 Bacteria 1807
28 Ga0070700_100015829 3300005441 Bacteria 4286
29 Ga0070694_100168833 3300005444 Bacteria 1610
30 Ga0070663_100066081 3300005455 Bacteria 2620
31 Ga0070678_100096229 3300005456 Bacteria 2283
32 Ga0070662_100006570 3300005457 Bacteria 7506
33 Ga0070681_10007503 3300005458 Bacteria 10661
34 Ga0070707_100074435 3300005468 Bacteria 3275
35 Ga0070698_100003997 3300005471 Bacteria 16234
36 Ga0070699_100000319 3300005518 Bacteria 46500
37 Ga0070699_100055142 3300005518 Bacteria 3442
38 Ga0070684_100000164 3300005535 Bacteria 45706
39 Ga0070684_100011570 3300005535 Bacteria 7031
40 Ga0070697_100038274 3300005536 Bacteria 3875
41 Ga0070672_100152192 3300005543 Bacteria 1914
42 Ga0070672_100214485 3300005543 Bacteria 1613
43 Ga0070696_100015617 3300005546 Bacteria 5102
44 Ga0070665_100184415 3300005548 Unclassified 2088
45 Ga0070664_100001256 3300005564 Bacteria 20301
46 Ga0070664_100001294 3300005564 Bacteria 20026
47 Ga0070664_100056402 3300005564 Bacteria 3338
48 Ga0070664_100149916 3300005564 Bacteria 2058
49 Ga0068859_100043285 3300005617 Bacteria 4525
50 Ga0068864_100067614 3300005618 Bacteria 3103
51 Ga0068864_100180810 3300005618 Bacteria 1928
52 Ga0068861_100118729 3300005719 Unclassified 2130
53 Ga0068870_10006406 3300005840 Bacteria 5187
54 Ga0068858_100073082 3300005842 Bacteria 3183
55 Ga0068862_100000843 3300005844 Bacteria 30153
56 Ga0081539_10000142 3300005985 Bacteria 165444
57 Ga0081539_10004906 3300005985 Bacteria 14258
58 Ga0075432_10047882 3300006058 Bacteria 1503
59 Ga0068871_100189297 3300006358 Bacteria 1772
60 Ga0075428_100000547 3300006844 Bacteria 38422
61 Ga0075428_100001164 3300006844 Bacteria 28182
62 Ga0075428_100003166 3300006844 Bacteria 17984
63 Ga0075428_100004584 3300006844 Bacteria 15284
64 Ga0075428_100008919 3300006844 Bacteria 11128
65 Ga0075428_100009085 3300006844 Bacteria 11030
66 Ga0075430_100000059 3300006846 Bacteria 58299
67 Ga0075430_100043110 3300006846 Bacteria 3813
68 Ga0075430_100073270 3300006846 Bacteria 2872
69 Ga0075431_100004882 3300006847 Bacteria 13206
70 Ga0075431_100014725 3300006847 Bacteria 7917
71 Ga0075431_100014827 3300006847 Bacteria 7891
72 Ga0075431_100032849 3300006847 Bacteria 5349
73 Ga0075431_100328853 3300006847 Bacteria 1540
74 Ga0075433_10000845 3300006852 Bacteria 21490
75 Ga0075433_10001029 3300006852 Bacteria 19893
76 Ga0075433_10017459 3300006852 Bacteria 5943
77 Ga0075433_10018969 3300006852 Bacteria 5725
78 Ga0075433_10172249 3300006852 Bacteria 1926
79 Ga0075434_100004612 3300006871 Bacteria 12444
80 Ga0075434_100008468 3300006871 Bacteria 9568
81 Ga0075434_100024969 3300006871 Bacteria 5844
82 Ga0075434_100056069 3300006871 Unclassified 3916
83 Ga0075434_100074045 3300006871 Bacteria 3399
84 Ga0075429_100003622 3300006880 Bacteria 13167
85 Ga0075429_100004149 3300006880 Bacteria 12395
86 Ga0075429_100046538 3300006880 Bacteria 3775
87 Ga0068865_100023107 3300006881 Bacteria 4067
88 Ga0097620_100043287 3300006931 Bacteria 4525
89 Ga0075435_100018250 3300007076 Bacteria 5329
90 Ga0111539_10000328 3300009094 Bacteria 58065
91 Ga0111539_10000523 3300009094 Bacteria 48534
92 Ga0111539_10001426 3300009094 Bacteria 31862
93 Ga0111539_10002412 3300009094 Bacteria 24866
94 Ga0111539_10003197 3300009094 Bacteria 21674
95 Ga0111539_10042387 3300009094 Bacteria 5466
96 Ga0111539_10047911 3300009094 Bacteria 5105
97 Ga0114129_10001386 3300009147 Bacteria 32637
98 Ga0114129_10008137 3300009147 Bacteria 14948
99 Ga0114129_10019570 3300009147 Bacteria 9636
100 Ga0114129_10028615 3300009147 Bacteria 7895
101 Ga0114129_10031267 3300009147 Bacteria 7528
102 Ga0114129_10055706 3300009147 Bacteria 5540
103 Ga0114129_10062569 3300009147 Bacteria 5198
104 Ga0114129_10062639 3300009147 Bacteria 5195
105 Ga0114129_10339819 3300009147 Unclassified 1992
106 Ga0105248_10033455 3300009177 Bacteria 5743
107 Ga0105246_10014046 3300011119 Bacteria 5030
108 Ga0157378_10138768 3300013297 Unclassified 2256
109 Ga0163162_10016434 3300013306 Bacteria 7230
110 Ga0157375_10084234 3300013308 Bacteria 3227
111 Ga0163163_10004691 3300014325 Bacteria 11703
112 Ga0157380_10001910 3300014326 Bacteria 13832
113 Ga0157380_10007078 3300014326 Bacteria 7942
114 Ga0157380_10052310 3300014326 Bacteria 3233
115 Ga0157377_10001701 3300014745 Bacteria 9596
116 Ga0157379_10132785 3300014968 Bacteria 2241
117 Ga0157376_10032538 3300014969 Bacteria 4188
118 Ga0163161_10029534 3300017792 Bacteria 3898
119 Ga0207697_10001585 3300025315 Bacteria 12290
120 Ga0207688_10003157 3300025901 Bacteria 8990
121 Ga0207680_10065897 3300025903 Unclassified 2225
122 Ga0207645_10000554 3300025907 Bacteria 31020
123 Ga0207643_10000256 3300025908 Bacteria 36971
124 Ga0207649_10006951 3300025920 Bacteria 6150
125 Ga0207646_10096697 3300025922 Bacteria 2646
126 Ga0207681_10072963 3300025923 Bacteria 2399
127 Ga0207659_10002183 3300025926 Bacteria 11624
128 Ga0207659_10207885 3300025926 Unclassified 1567
129 Ga0207700_10085044 3300025928 Unclassified 2482
130 Ga0207644_10020387 3300025931 Bacteria 4507
131 Ga0207706_10008028 3300025933 Bacteria 9740
132 Ga0207706_10032914 3300025933 Bacteria 4612
133 Ga0207669_10002514 3300025937 Bacteria 7827
134 Ga0207704_10004668 3300025938 Bacteria 6279
135 Ga0207691_10000512 3300025940 Bacteria 38493
136 Ga0207691_10041604 3300025940 Bacteria 4241
137 Ga0207689_10013399 3300025942 Bacteria 6999
138 Ga0207661_10005075 3300025944 Bacteria 9239
139 Ga0207679_10003359 3300025945 Bacteria 9879
140 Ga0207679_10010996 3300025945 Bacteria 5840
141 Ga0207651_10037491 3300025960 Bacteria 3176
142 Ga0207651_10055147 3300025960 Bacteria 2728
143 Ga0207651_10194872 3300025960 Bacteria 1619
144 Ga0207712_10043180 3300025961 Bacteria 3109
145 Ga0207668_10016688 3300025972 Bacteria 4588
146 Ga0207658_10034391 3300025986 Bacteria 3623
147 Ga0207658_10081528 3300025986 Bacteria 2481
148 Ga0207677_10076664 3300026023 Bacteria 2381
149 Ga0207703_10106473 3300026035 Unclassified 2385
150 Ga0207678_10093283 3300026067 Bacteria 2572
151 Ga0207708_10009338 3300026075 Bacteria 7259
152 Ga0207708_10192599 3300026075 Unclassified 1624
153 Ga0207676_10114202 3300026095 Bacteria 2265
154 Ga0207676_10157768 3300026095 Bacteria 1962
155 Ga0207676_10204572 3300026095 Bacteria 1747
156 Ga0207674_10219290 3300026116 Bacteria 1850
157 Ga0207674_10339200 3300026116 Unclassified 1453
158 Ga0207675_100003766 3300026118 Bacteria 14775
159 Ga0207675_100050270 3300026118 Bacteria 3890
160 Ga0207683_10012271 3300026121 Bacteria 7313
161 Ga0207698_10013041 3300026142 Bacteria 5469
162 Ga0207428_10000294 3300027907 Bacteria 66640
163 Ga0207428_10000600 3300027907 Bacteria 42629
164 Ga0207428_10003969 3300027907 Bacteria 14191
165 Ga0207428_10007016 3300027907 Bacteria 10313
166 Ga0207428_10020577 3300027907 Bacteria 5603
167 Ga0207428_10191221 3300027907 Unclassified 1543
168 Ga0268265_10032287 3300028380 Bacteria 3792
169 Ga0307408_100068026 3300031548 Bacteria 2621
170 Ga0307408_100069837 3300031548 Bacteria 2592
171 Ga0307405_10132465 3300031731 Unclassified 1725
172 Ga0307410_10012933 3300031852 Bacteria 4848
173 Ga0307409_100009563 3300031995 Bacteria 5966
174 Ga0307416_100027554 3300032002 Bacteria 4210
175 Ga0307411_10012773 3300032005 Bacteria 4601
176 Ga0307411_10128902 3300032005 Unclassified 1845
177 Ga0373942_0031177 3300035207 Bacteria 1408
178 Ga0373937_0003467 3300036401 Bacteria 13249
179 Ga0373937_0175114 3300036401 Bacteria 2014
180 Ga0439434_0059222 3300042435 Unclassified 1196
181 Ga0439464_0015665 3300042439 Bacteria 2047
182 Ga0439464_0024859 3300042439 Bacteria 1657
183 Ga0453683_0124079 3300044673 Unclassified 1626
184 Ga0451576_0027983 3300045051 Bacteria 6044
185 Ga0451576_0033424 3300045051 Bacteria 5466
186 Ga0495592_0038603 3300046454 Bacteria 3592
187 Ga0495603_0026610 3300046455 Bacteria 3494
188 Ga0495603_0062957 3300046455 Bacteria 2189
189 Ga0495629_0036225 3300046459 Bacteria 3483
190 Ga0495580_0197644 3300046472 Unclassified 1386
191 Ga0495594_0055301 3300046499 Unclassified 2188
192 Ga0495643_0014791 3300046522 Bacteria 4633
193 Ga0495663_0016955 3300046525 Bacteria 2063
194 Ga0495621_0031043 3300046539 Bacteria 1830
195 Ga0495659_0015633 3300046664 Bacteria 2497
196 Ga0495659_0056199 3300046664 Bacteria 1444
197 Ga0495588_0002136 3300046674 Bacteria 8479
198 Ga0495658_0100923 3300046683 Bacteria 1722
199 Ga0495658_0127845 3300046683 Bacteria 1544
200 Ga0495669_0013214 3300046684 Bacteria 3517
201 Ga0495636_0018834 3300047318 Bacteria 2770
202 Ga0495684_0212729 3300047471 Bacteria 1421
203 Ga0496101_0083485 3300048904 Bacteria 2365
204 Ga0496104_0002343 3300048907 Bacteria 16373
205 Ga0496105_0013564 3300048908 Bacteria 6472
206 Ga0496108_0005701 3300048911 Bacteria 10082
207 Ga0496109_0005557 3300048912 Bacteria 10554
208 Ga0496110_0047282 3300048913 Bacteria 3767
209 Ga0496111_0012243 3300048914 Bacteria 5803
210 Ga0496112_0001977 3300048915 Bacteria 16201
211 Ga0496113_0070400 3300048916 Bacteria 2659
212 Ga0496114_0209976 3300048917 Bacteria 1707
213 Ga0501292_005664 3300049515 Bacteria 1750
214 Ga0501037_0182062 3300049573 Bacteria 1491
215 Ga0501039_0143234 3300049575 Unclassified 1878
216 Ga0501048_0046087 3300049582 Bacteria 3113
217 Ga0501071_0028601 3300049587 Bacteria 3929
218 Ga0501072_0049742 3300049588 Bacteria 3300
219 Ga0501075_0040484 3300049591 Bacteria 3490
220 Ga0501076_0266281 3300049592 Bacteria 1403
221 Ga0501079_0068984 3300049741 Bacteria 2729
222 Ga0501035_0328870 3300049822 Bacteria 1283
223 Ga0501045_0044230 3300049824 Bacteria 3243
224 Ga0501045_0258782 3300049824 Unclassified 1295
225 nmdc:mga05p37_110750_c1 3300050507 Bacteria 3377
226 nmdc:mga05p37_15946_c1 3300050507 Bacteria 9038
227 nmdc:mga05p37_16124_c1 3300050507 Bacteria 8996
228 nmdc:mga05p37_313122_c1 3300050507 Unclassified 1860
229 nmdc:mga05p37_53787_c1 3300050507 Bacteria 4952
230 nmdc:mga05p37_67640_c1 3300050507 Bacteria 4395
231 nmdc:mga05p37_81369_c1 3300050507 Bacteria 3989
232 nmdc:mga05p37_9264_c1 3300050507 Bacteria 11639
233 nmdc:mga09592_26461_c1 3300050508 Bacteria 4806
234 nmdc:mga09592_292683_c1 3300050508 Unclassified 1412
235 nmdc:mga09592_3015_c1 3300050508 Bacteria 13652
236 nmdc:mga09592_51065_c1 3300050508 Bacteria 3488
237 nmdc:mga09592_5602_c1 3300050508 Bacteria 10235
238 nmdc:mga0qj67_422_c1 3300050509 Bacteria 28975
239 nmdc:mga0qj67_42313_c1 3300050509 Bacteria 3586
240 nmdc:mga0qj67_89352_c1 3300050509 Bacteria 2474
241 nmdc:mga06r32_10215_c1 3300050510 Bacteria 8474
242 nmdc:mga06r32_15685_c2 3300050510 Bacteria 2193
243 nmdc:mga06r32_173950_c1 3300050510 Bacteria 2137
244 nmdc:mga08y16_15621_c1 3300050511 Bacteria 7985
245 nmdc:mga08y16_191296_c1 3300050511 Unclassified 2122
246 nmdc:mga08y16_228327_c1 3300050511 Unclassified 1926
247 nmdc:mga08y16_270141_c1 3300050511 Unclassified 1756
248 nmdc:mga08y16_2736_c1 3300050511 Bacteria 18088
249 nmdc:mga08y16_2810_c1 3300050511 Bacteria 17874
250 nmdc:mga08y16_38622_c1 3300050511 Bacteria 5012
251 nmdc:mga08y16_7885_c1 3300050511 Bacteria 11141
252 nmdc:mga0n895_161348_c1 3300050512 Bacteria 2273
253 nmdc:mga0n895_16856_c1 3300050512 Bacteria 6716
254 nmdc:mga0n895_233454_c1 3300050512 Bacteria 1867
255 nmdc:mga0n895_97558_c1 3300050512 Bacteria 2945
256 nmdc:mga0rr50_161281_c1 3300050513 Bacteria 1820
257 nmdc:mga0a205_104_c1 3300050515 Bacteria 48304
258 nmdc:mga0a205_11942_c1 3300050515 Bacteria 8021
259 nmdc:mga0a205_126_c1 3300050515 Bacteria 46787
260 nmdc:mga0a205_264_c1 3300050515 Bacteria 37774
261 Ga0500646_0006592 3300053090 Bacteria 2954
262 Ga0590071_000633 3300059421 Bacteria 10005
263 Ga0590071_000903 3300059421 Bacteria 8238
264 Ga0590075_000150 3300059424 Bacteria 18667
265 Ga0590075_000269 3300059424 Bacteria 14724
266 Ga0590077_000551 3300059426 Bacteria 10365
267 Ga0590077_001841 3300059426 Bacteria 4713
268 Ga0501082_0029175 3300060353 Bacteria 4753
269 Ga0501082_0060958 3300060353 Bacteria 3248
270 Ga0070699_100043539
271 JGI25406J46586_10001064
272 Ga0065704_10002321
273 Ga0065712_10095856
274 Ga0065712_10126564
275 Ga0065715_10090507
276 Ga0065707_10001199
277 Ga0065707_10098652
278 Ga0070676_10050921
279 Ga0070683_100000059
280 Ga0070690_100002481
281 Ga0070670_100042098
282 Ga0070666_10012814
283 Ga0070666_10016365
284 Ga0070666_10027416
285 Ga0068868_100014035
286 Ga0070661_100010179
287 Ga0070669_100003334
288 Ga0070675_100000853
289 Ga0070671_100002079
290 Ga0070674_100091587
291 Ga0070674_100115020
292 Ga0070673_100042585
293 Ga0070673_100213388
294 Ga0070688_100004223
295 Ga0070713_100033350
296 Ga0070701_10075939
297 Ga0070700_100015829
298 Ga0070694_100168833
299 Ga0070663_100066081
300 Ga0070678_100096229
301 Ga0070662_100006570
302 Ga0070681_10007503
303 Ga0070707_100074435
304 Ga0070698_100003997
305 Ga0070699_100000319
306 Ga0070699_100055142
307 Ga0070684_100000164
308 Ga0070684_100011570
309 Ga0070697_100038274
310 Ga0070672_100152192
311 Ga0070672_100214485
312 Ga0070696_100015617
313 Ga0070665_100184415
314 Ga0070664_100001256
315 Ga0070664_100001294
316 Ga0070664_100056402
317 Ga0070664_100149916
318 Ga0068859_100043285
319 Ga0068864_100067614
320 Ga0068864_100180810
321 Ga0068861_100118729
322 Ga0068870_10006406
323 Ga0068858_100073082
324 Ga0068862_100000843
325 Ga0081539_10000142
326 Ga0081539_10004906
327 Ga0075432_10047882
328 Ga0068871_100189297
329 Ga0075428_100000547
330 Ga0075428_100001164
331 Ga0075428_100003166
332 Ga0075428_100004584
333 Ga0075428_100008919
334 Ga0075428_100009085
335 Ga0075430_100000059
336 Ga0075430_100043110
337 Ga0075430_100073270
338 Ga0075431_100004882
339 Ga0075431_100014725
340 Ga0075431_100014827
341 Ga0075431_100032849
342 Ga0075431_100328853
343 Ga0075433_10000845
344 Ga0075433_10001029
345 Ga0075433_10017459
346 Ga0075433_10018969
347 Ga0075433_10172249
348 Ga0075434_100004612
349 Ga0075434_100008468
350 Ga0075434_100024969
351 Ga0075434_100056069
352 Ga0075434_100074045
353 Ga0075429_100003622
354 Ga0075429_100004149
355 Ga0075429_100046538
356 Ga0068865_100023107
357 Ga0097620_100043287
358 Ga0075435_100018250
359 Ga0111539_10000328
360 Ga0111539_10000523
361 Ga0111539_10001426
362 Ga0111539_10002412
363 Ga0111539_10003197
364 Ga0111539_10042387
365 Ga0111539_10047911
366 Ga0114129_10001386
367 Ga0114129_10008137
368 Ga0114129_10019570
369 Ga0114129_10028615
370 Ga0114129_10031267
371 Ga0114129_10055706
372 Ga0114129_10062569
373 Ga0114129_10062639
374 Ga0114129_10339819
375 Ga0105248_10033455
376 Ga0105246_10014046
377 Ga0157378_10138768
378 Ga0163162_10016434
379 Ga0157375_10084234
380 Ga0163163_10004691
381 Ga0157380_10001910
382 Ga0157380_10007078
383 Ga0157380_10052310
384 Ga0157377_10001701
385 Ga0157379_10132785
386 Ga0157376_10032538
387 Ga0163161_10029534
388 Ga0207697_10001585
389 Ga0207688_10003157
390 Ga0207680_10065897
391 Ga0207645_10000554
392 Ga0207643_10000256
393 Ga0207649_10006951
394 Ga0207646_10096697
395 Ga0207681_10072963
396 Ga0207659_10002183
397 Ga0207659_10207885
398 Ga0207700_10085044
399 Ga0207644_10020387
400 Ga0207706_10008028
401 Ga0207706_10032914
402 Ga0207669_10002514
403 Ga0207704_10004668
404 Ga0207691_10000512
405 Ga0207691_10041604
406 Ga0207689_10013399
407 Ga0207661_10005075
408 Ga0207679_10003359
409 Ga0207679_10010996
410 Ga0207651_10037491
411 Ga0207651_10055147
412 Ga0207651_10194872
413 Ga0207712_10043180
414 Ga0207668_10016688
415 Ga0207658_10034391
416 Ga0207658_10081528
417 Ga0207677_10076664
418 Ga0207703_10106473
419 Ga0207678_10093283
420 Ga0207708_10009338
421 Ga0207708_10192599
422 Ga0207676_10114202
423 Ga0207676_10157768
424 Ga0207676_10204572
425 Ga0207674_10219290
426 Ga0207674_10339200
427 Ga0207675_100003766
428 Ga0207675_100050270
429 Ga0207683_10012271
430 Ga0207698_10013041
431 Ga0207428_10000294
432 Ga0207428_10000600
433 Ga0207428_10003969
434 Ga0207428_10007016
435 Ga0207428_10020577
436 Ga0207428_10191221
437 Ga0268265_10032287
438 Ga0307408_100068026
439 Ga0307408_100069837
440 Ga0307405_10132465
441 Ga0307410_10012933
442 Ga0307409_100009563
443 Ga0307416_100027554
444 Ga0307411_10012773
445 Ga0307411_10128902
446 Ga0373942_0031177
447 Ga0373937_0003467
448 Ga0373937_0175114
449 Ga0439434_0059222
450 Ga0439464_0015665
451 Ga0439464_0024859
452 Ga0453683_0124079
453 Ga0451576_0027983
454 Ga0451576_0033424
455 Ga0495592_0038603
456 Ga0495603_0026610
457 Ga0495603_0062957
458 Ga0495629_0036225
459 Ga0495580_0197644
460 Ga0495594_0055301
461 Ga0495643_0014791
462 Ga0495663_0016955
463 Ga0495621_0031043
464 Ga0495659_0015633
465 Ga0495659_0056199
466 Ga0495588_0002136
467 Ga0495658_0100923
468 Ga0495658_0127845
469 Ga0495669_0013214
470 Ga0495636_0018834
471 Ga0495684_0212729
472 Ga0496101_0083485
473 Ga0496104_0002343
474 Ga0496105_0013564
475 Ga0496108_0005701
476 Ga0496109_0005557
477 Ga0496110_0047282
478 Ga0496111_0012243
479 Ga0496112_0001977
480 Ga0496113_0070400
481 Ga0496114_0209976
482 Ga0501292_005664
483 Ga0501037_0182062
484 Ga0501039_0143234
485 Ga0501048_0046087
486 Ga0501071_0028601
487 Ga0501072_0049742
488 Ga0501075_0040484
489 Ga0501076_0266281
490 Ga0501079_0068984
491 Ga0501035_0328870
492 Ga0501045_0044230
493 Ga0501045_0258782
494 nmdc:mga05p37_110750_c1
495 nmdc:mga05p37_15946_c1
496 nmdc:mga05p37_16124_c1
497 nmdc:mga05p37_313122_c1
498 nmdc:mga05p37_53787_c1
499 nmdc:mga05p37_67640_c1
500 nmdc:mga05p37_81369_c1
501 nmdc:mga05p37_9264_c1
502 nmdc:mga09592_26461_c1
503 nmdc:mga09592_292683_c1
504 nmdc:mga09592_3015_c1
505 nmdc:mga09592_51065_c1
506 nmdc:mga09592_5602_c1
507 nmdc:mga0qj67_422_c1
508 nmdc:mga0qj67_42313_c1
509 nmdc:mga0qj67_89352_c1
510 nmdc:mga06r32_10215_c1
511 nmdc:mga06r32_15685_c2
512 nmdc:mga06r32_173950_c1
513 nmdc:mga08y16_15621_c1
514 nmdc:mga08y16_191296_c1
515 nmdc:mga08y16_228327_c1
516 nmdc:mga08y16_270141_c1
517 nmdc:mga08y16_2736_c1
518 nmdc:mga08y16_2810_c1
519 nmdc:mga08y16_38622_c1
520 nmdc:mga08y16_7885_c1
521 nmdc:mga0n895_161348_c1
522 nmdc:mga0n895_16856_c1
523 nmdc:mga0n895_233454_c1
524 nmdc:mga0n895_97558_c1
525 nmdc:mga0rr50_161281_c1
526 nmdc:mga0a205_104_c1
527 nmdc:mga0a205_11942_c1
528 nmdc:mga0a205_126_c1
529 nmdc:mga0a205_264_c1
530 Ga0500646_0006592
531 Ga0590071_000633
532 Ga0590071_000903
533 Ga0590075_000150
534 Ga0590075_000269
535 Ga0590077_000551
536 Ga0590077_001841
537 Ga0501082_0029175
538 Ga0501082_0060958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

192

400

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xev-assembly1.cif.gz_A-2 crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans 0.8943 5 376
5xev-assembly1.cif.gz_A-2 crystal structure of a novel xaa-pro dipeptidase from deinococcus radiodurans 0.874 5 376
1xgs-assembly1.cif.gz_B methionine aminopeptidase from hyperthermophile pyrococcus furiosus 0.7861 138 369
2dfi-assembly1.cif.gz_B crystal structure of pf-map(1-292)-c 0.7794 137 369
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.7777 130 375
ID Description Score Start End Superfamily
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9136 132 377 3.90.230.10
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9098 131 379 3.90.230.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9058 132 377 3.90.230.10
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8946 131 379 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8944 132 378 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7C7LAW6-F1-model_v4 Aminopeptidase P family protein 0.9921 177 380 GO:0004177
AF-A0A6L8GH72-F1-model_v4 M24 family metallopeptidase 0.9912 255 377
AF-A0A2V8BMN5-F1-model_v4 Peptidase M24 domain-containing protein 0.9887 101 380
AF-A0A533Y1T3-F1-model_v4 M24 family metallopeptidase 0.9879 121 380
AF-A0A7C7LAW6-F1-model_v4 Aminopeptidase P family protein 0.9873 177 380 GO:0004177

Map