F376047

General Info

Members Datasets Scaffolds Average Seq Length
269 159 538 208

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100316679|Ga0068867_1003166792
Length 229
Sequence MTTANERVIEEPMVGTAGQPAVDRAVSPGPAAAEVKQRLALAVGAALLVAGLILVMFVLPAEFAVDPLGTGARFGLLPLGVVGQQVDELNKTAAATAGAAGQSAILVAQDKPFQQESVDFTLKPKEGMEYKYRLDKGEALLYSWKSTAPVDYELHAEPDGAPAGYAQSYEKSASSGASGTLTAPFPGIHGWYWENKTDQEVTVTLKTAGYYNLSHEFRSGQPTKNKTFQ

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 99.26
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100316679 3300005459 Bacteria 1291
2 SwRhRL2b_contig_3195367 2162886007 Unclassified 864
3 JGI25406J46586_10000232 3300003203 Bacteria 24721
4 Ga0065704_10005045 3300005289 Bacteria 5989
5 Ga0065715_10159802 3300005293 Bacteria 1640
6 Ga0065707_10000320 3300005295 Bacteria 3088
7 Ga0070683_100010580 3300005329 Bacteria 7931
8 Ga0070690_100002084 3300005330 Bacteria 10682
9 Ga0070690_100544764 3300005330 Unclassified 874
10 Ga0070670_100006900 3300005331 Bacteria 9625
11 Ga0070670_100337670 3300005331 Bacteria 1322
12 Ga0070677_10029857 3300005333 Bacteria 2071
13 Ga0068869_100335658 3300005334 Unclassified 1229
14 Ga0070680_100744100 3300005336 Unclassified 844
15 Ga0070680_100765607 3300005336 Unclassified 831
16 Ga0070689_100023010 3300005340 Bacteria 4659
17 Ga0070691_10111698 3300005341 Bacteria 1368
18 Ga0070692_10025202 3300005345 Bacteria 2930
19 Ga0070675_100004748 3300005354 Bacteria 10371
20 Ga0070675_100076507 3300005354 Bacteria 2784
21 Ga0070675_100132785 3300005354 Bacteria 2123
22 Ga0070671_100003231 3300005355 Bacteria 12707
23 Ga0070671_100193916 3300005355 Bacteria 1722
24 Ga0070671_100577859 3300005355 Bacteria 970
25 Ga0070673_100156628 3300005364 Bacteria 1934
26 Ga0070673_100484248 3300005364 Unclassified 1117
27 Ga0070673_100614658 3300005364 Unclassified 992
28 Ga0070673_100723347 3300005364 Unclassified 915
29 Ga0070688_100014480 3300005365 Bacteria 4469
30 Ga0070688_100664022 3300005365 Bacteria 804
31 Ga0070659_100141591 3300005366 Bacteria 1958
32 Ga0070701_10105770 3300005438 Bacteria 1565
33 Ga0070705_100000172 3300005440 Bacteria 37849
34 Ga0070705_100162647 3300005440 Bacteria 1494
35 Ga0070705_100167866 3300005440 Bacteria 1474
36 Ga0070700_100116970 3300005441 Bacteria 1781
37 Ga0070700_100391662 3300005441 Bacteria 1042
38 Ga0070694_100003106 3300005444 Bacteria 9891
39 Ga0070694_100009169 3300005444 Bacteria 6070
40 Ga0070708_100028747 3300005445 Bacteria 4786
41 Ga0070708_100224569 3300005445 Bacteria 1762
42 Ga0070708_100299125 3300005445 Bacteria 1515
43 Ga0070708_100582272 3300005445 Bacteria 1055
44 Ga0070678_100234373 3300005456 Bacteria 1532
45 Ga0070681_10006467 3300005458 Bacteria 11407
46 Ga0070681_10879534 3300005458 Unclassified 814
47 Ga0070706_100569738 3300005467 Bacteria 1053
48 Ga0070707_100053252 3300005468 Bacteria 3879
49 Ga0070707_100372253 3300005468 Bacteria 1388
50 Ga0070698_100001069 3300005471 Bacteria 30087
51 Ga0070698_100022720 3300005471 Bacteria 6559
52 Ga0070698_100041592 3300005471 Bacteria 4718
53 Ga0070699_100000243 3300005518 Bacteria 53604
54 Ga0070699_100060536 3300005518 Bacteria 3281
55 Ga0070699_100111109 3300005518 Bacteria 2406
56 Ga0070679_100066523 3300005530 Bacteria 3592
57 Ga0070684_100025484 3300005535 Bacteria 4973
58 Ga0070697_100057180 3300005536 Bacteria 3174
59 Ga0070697_100121523 3300005536 Unclassified 2185
60 Ga0070697_100168356 3300005536 Bacteria 1853
61 Ga0068853_100369374 3300005539 Bacteria 1338
62 Ga0068853_100407664 3300005539 Bacteria 1273
63 Ga0070672_100004693 3300005543 Bacteria 8961
64 Ga0070672_100332860 3300005543 Bacteria 1292
65 Ga0070686_100004868 3300005544 Bacteria 7412
66 Ga0070695_100000809 3300005545 Bacteria 16826
67 Ga0070695_100035182 3300005545 Bacteria 3145
68 Ga0070695_100056766 3300005545 Bacteria 2528
69 Ga0070695_100071285 3300005545 Bacteria 2275
70 Ga0070695_100234354 3300005545 Bacteria 1328
71 Ga0070695_100284898 3300005545 Bacteria 1215
72 Ga0070696_100001646 3300005546 Bacteria 14648
73 Ga0070696_100077672 3300005546 Bacteria 2346
74 Ga0070696_100161209 3300005546 Bacteria 1652
75 Ga0070704_100034498 3300005549 Bacteria 3432
76 Ga0070704_100039901 3300005549 Bacteria 3226
77 Ga0068855_100237001 3300005563 Bacteria 2040
78 Ga0070664_100031578 3300005564 Bacteria 4426
79 Ga0068857_100026187 3300005577 Bacteria 5138
80 Ga0068854_100020904 3300005578 Bacteria 4435
81 Ga0070702_100104126 3300005615 Bacteria 1747
82 Ga0070702_100373235 3300005615 Bacteria 1012
83 Ga0070702_100555135 3300005615 Unclassified 853
84 Ga0068859_100059322 3300005617 Bacteria 3855
85 Ga0068859_100432907 3300005617 Bacteria 1412
86 Ga0068864_100035141 3300005618 Bacteria 4266
87 Ga0068861_100574175 3300005719 Unclassified 1031
88 Ga0068861_100957552 3300005719 Unclassified 814
89 Ga0068861_101081113 3300005719 Bacteria 770
90 Ga0068870_10006190 3300005840 Bacteria 5264
91 Ga0068870_10365052 3300005840 Unclassified 930
92 Ga0068863_100482039 3300005841 Bacteria 1220
93 Ga0068858_100006751 3300005842 Bacteria 11170
94 Ga0068860_100008315 3300005843 Bacteria 10329
95 Ga0068860_100698488 3300005843 Bacteria 1024
96 Ga0081539_10000096 3300005985 Bacteria 204059
97 Ga0097621_100094493 3300006237 Bacteria 2507
98 Ga0097621_100423978 3300006237 Bacteria 1195
99 Ga0068871_100179501 3300006358 Bacteria 1819
100 Ga0068871_100339687 3300006358 Bacteria 1326
101 Ga0068871_100612558 3300006358 Unclassified 991
102 Ga0075428_100000747 3300006844 Bacteria 33783
103 Ga0075430_100161027 3300006846 Bacteria 1868
104 Ga0075433_10055850 3300006852 Bacteria 3448
105 Ga0075433_10115739 3300006852 Bacteria 2379
106 Ga0075433_10262523 3300006852 Bacteria 1531
107 Ga0075433_10347686 3300006852 Bacteria 1310
108 Ga0075433_10457749 3300006852 Bacteria 1124
109 Ga0075434_100043761 3300006871 Bacteria 4440
110 Ga0075434_100046899 3300006871 Bacteria 4288
111 Ga0075434_100187502 3300006871 Bacteria 2089
112 Ga0075434_100217185 3300006871 Bacteria 1932
113 Ga0075434_100264809 3300006871 Bacteria 1738
114 Ga0075434_100382419 3300006871 Bacteria 1428
115 Ga0075434_100722234 3300006871 Unclassified 1013
116 Ga0075434_101039821 3300006871 Unclassified 833
117 Ga0075429_100349897 3300006880 Bacteria 1294
118 Ga0068865_100089204 3300006881 Bacteria 2233
119 Ga0068865_100452143 3300006881 Unclassified 1062
120 Ga0097620_100059317 3300006931 Bacteria 3855
121 Ga0097620_100432889 3300006931 Bacteria 1412
122 Ga0075435_100028567 3300007076 Bacteria 4375
123 Ga0075435_100038274 3300007076 Bacteria 3824
124 Ga0075435_100051637 3300007076 Bacteria 3312
125 Ga0075435_100293336 3300007076 Bacteria 1390
126 Ga0075435_100480712 3300007076 Bacteria 1073
127 Ga0105240_10305883 3300009093 Bacteria 1817
128 Ga0111539_10051408 3300009094 Bacteria 4908
129 Ga0111539_10151228 3300009094 Bacteria 2717
130 Ga0111539_10217230 3300009094 Bacteria 2227
131 Ga0114129_10000152 3300009147 Bacteria 73518
132 Ga0114129_10053535 3300009147 Bacteria 5660
133 Ga0114129_10575607 3300009147 Unclassified 1462
134 Ga0114129_10634353 3300009147 Bacteria 1381
135 Ga0105243_10254062 3300009148 Bacteria 1571
136 Ga0105241_10042506 3300009174 Bacteria 3439
137 Ga0105248_10207877 3300009177 Bacteria 2205
138 Ga0105246_10704355 3300011119 Unclassified 885
139 Ga0157378_10094208 3300013297 Bacteria 2727
140 Ga0157378_10117514 3300013297 Bacteria 2447
141 Ga0157375_10244352 3300013308 Bacteria 1955
142 Ga0157377_10164081 3300014745 Bacteria 1384
143 Ga0157376_10191519 3300014969 Bacteria 1876
144 Ga0157376_10945780 3300014969 Unclassified 882
145 Ga0207682_10131859 3300025893 Unclassified 1116
146 Ga0207684_10318693 3300025910 Bacteria 1340
147 Ga0207695_10423103 3300025913 Bacteria 1216
148 Ga0207652_10184491 3300025921 Bacteria 1876
149 Ga0207646_10135116 3300025922 Bacteria 2220
150 Ga0207646_10708037 3300025922 Bacteria 900
151 Ga0207650_10338790 3300025925 Bacteria 1235
152 Ga0207659_10004418 3300025926 Bacteria 8501
153 Ga0207659_10067799 3300025926 Bacteria 2593
154 Ga0207659_10169903 3300025926 Bacteria 1719
155 Ga0207644_10119479 3300025931 Bacteria 2005
156 Ga0207644_10123951 3300025931 Bacteria 1970
157 Ga0207686_10018781 3300025934 Bacteria 3919
158 Ga0207670_10005999 3300025936 Bacteria 6713
159 Ga0207691_10016220 3300025940 Bacteria 7072
160 Ga0207691_10302612 3300025940 Bacteria 1374
161 Ga0207689_10186228 3300025942 Bacteria 1712
162 Ga0207689_10214699 3300025942 Bacteria 1590
163 Ga0207640_10027894 3300025981 Bacteria 3445
164 Ga0207703_10005141 3300026035 Bacteria 10587
165 Ga0207639_10435460 3300026041 Bacteria 1188
166 Ga0207708_10286339 3300026075 Bacteria 1336
167 Ga0207648_10293047 3300026089 Bacteria 1457
168 Ga0207676_10011347 3300026095 Bacteria 6370
169 Ga0207676_10034181 3300026095 Bacteria 3848
170 Ga0207676_11120609 3300026095 Bacteria 778
171 Ga0207674_10208385 3300026116 Bacteria 1904
172 Ga0207675_100534034 3300026118 Bacteria 1171
173 Ga0207428_10214269 3300027907 Bacteria 1446
174 Ga0207428_10296865 3300027907 Bacteria 1196
175 Ga0268264_10009087 3300028381 Bacteria 8241
176 Ga0307413_10096607 3300031824 Bacteria 1940
177 Ga0307412_10277189 3300031911 Unclassified 1315
178 Ga0373948_0007228 3300034817 Bacteria 1861
179 Ga0373950_0017185 3300034818 Bacteria 1244
180 Ga0373958_0006333 3300034819 Bacteria 1840
181 Ga0373959_0004277 3300034820 Unclassified 2296
182 Ga0373938_0001675 3300034957 Bacteria 3546
183 Ga0373928_0001065 3300035084 Bacteria 5428
184 Ga0373929_0002467 3300035085 Bacteria 3402
185 Ga0373940_0000292 3300035088 Bacteria 7201
186 Ga0373951_0004393 3300035091 Bacteria 3350
187 Ga0373952_0001082 3300035092 Bacteria 4979
188 Ga0373932_0001607 3300035112 Bacteria 6220
189 Ga0373939_0000409 3300035114 Bacteria 10818
190 Ga0373941_0000118 3300035115 Bacteria 13479
191 Ga0373960_0002614 3300035121 Bacteria 4070
192 Ga0373942_0002936 3300035207 Bacteria 4041
193 Ga0373961_0003274 3300035241 Bacteria 4034
194 Ga0373931_0001612 3300035691 Bacteria 9772
195 Ga0439460_0016493 3300042461 Unclassified 1968
196 Ga0451576_0012560 3300045051 Bacteria 9506
197 Ga0451576_0033456 3300045051 Bacteria 5464
198 Ga0451576_0069638 3300045051 Bacteria 3661
199 Ga0495603_0026940 3300046455 Bacteria 3471
200 Ga0495603_0130801 3300046455 Bacteria 1461
201 Ga0495629_0099126 3300046459 Bacteria 2033
202 Ga0495582_0121501 3300046473 Bacteria 1472
203 Ga0495594_0145173 3300046499 Bacteria 1346
204 Ga0495583_0263583 3300046506 Unclassified 689
205 Ga0495663_0007325 3300046525 Bacteria 3047
206 Ga0495663_0090713 3300046525 Bacteria 996
207 Ga0495598_0017715 3300046537 Bacteria 1840
208 Ga0495609_0060087 3300046538 Bacteria 1681
209 Ga0495621_0019438 3300046539 Bacteria 2219
210 Ga0495621_0090392 3300046539 Bacteria 1153
211 Ga0495621_0222383 3300046539 Bacteria 764
212 Ga0495659_0008902 3300046664 Bacteria 3197
213 Ga0495659_0021874 3300046664 Bacteria 2158
214 Ga0495659_0041472 3300046664 Bacteria 1644
215 Ga0495588_0002241 3300046674 Bacteria 8278
216 Ga0495669_0138790 3300046684 Bacteria 1147
217 Ga0495670_0071541 3300046691 Bacteria 1756
218 Ga0495670_0354283 3300046691 Bacteria 790
219 Ga0495581_0099220 3300047315 Bacteria 1692
220 Ga0495636_0028246 3300047318 Bacteria 2287
221 Ga0495636_0078622 3300047318 Unclassified 1417
222 Ga0495676_0592909 3300047321 Bacteria 722
223 Ga0496102_0074474 3300048905 Bacteria 3121
224 Ga0496112_0454211 3300048915 Bacteria 1219
225 Ga0501033_0084178 3300049570 Bacteria 2331
226 Ga0501036_0066935 3300049572 Bacteria 3039
227 Ga0501037_0072590 3300049573 Bacteria 2503
228 Ga0501039_0279832 3300049575 Bacteria 1311
229 Ga0501041_0001187 3300049577 Bacteria 14194
230 Ga0501042_0010256 3300049578 Bacteria 6272
231 Ga0501042_0230263 3300049578 Bacteria 1337
232 Ga0501067_0050576 3300049583 Bacteria 2303
233 Ga0501068_0027376 3300049584 Bacteria 3366
234 Ga0501071_0011783 3300049587 Bacteria 5899
235 Ga0501075_0251614 3300049591 Bacteria 1347
236 Ga0501075_0306016 3300049591 Bacteria 1211
237 Ga0501076_0002688 3300049592 Bacteria 12285
238 Ga0501079_0006438 3300049741 Bacteria 8818
239 Ga0501081_0002548 3300049743 Bacteria 11494
240 Ga0501083_0235969 3300049744 Bacteria 1191
241 Ga0501083_0246064 3300049744 Bacteria 1164
242 Ga0501045_0331947 3300049824 Bacteria 1132
243 nmdc:mga05p37_283521_c1 3300050507 Bacteria 1975
244 nmdc:mga05p37_7128_c1 3300050507 Bacteria 13181
245 nmdc:mga05p37_88534_c1 3300050507 Bacteria 3816
246 nmdc:mga09592_42997_c1 3300050508 Bacteria 3801
247 nmdc:mga0qj67_71481_c1 3300050509 Bacteria 2769
248 nmdc:mga08y16_138474_c1 3300050511 Bacteria 2530
249 nmdc:mga08y16_169031_c1 3300050511 Bacteria 2271
250 nmdc:mga08y16_89387_c1 3300050511 Bacteria 3210
251 nmdc:mga0n895_25120_c1 3300050512 Bacteria 5625
252 nmdc:mga0n895_259500_c1 3300050512 Bacteria 1764
253 nmdc:mga0n895_324056_c1 3300050512 Unclassified 1561
254 nmdc:mga0n895_484747_c1 3300050512 Bacteria 1247
255 nmdc:mga0n895_503507_c1 3300050512 Bacteria 1220
256 nmdc:mga0n895_71036_c1 3300050512 Bacteria 3451
257 nmdc:mga0rr50_10558_c1 3300050513 Bacteria 5868
258 nmdc:mga0rr50_15033_c1 3300050513 Bacteria 5099
259 nmdc:mga0rr50_223651_c1 3300050513 Bacteria 1555
260 nmdc:mga0rr50_306317_c1 3300050513 Bacteria 1330
261 nmdc:mga0rr50_369140_c1 3300050513 Bacteria 1209
262 nmdc:mga0rr50_707756_c1 3300050513 Bacteria 860
263 nmdc:mga0a205_120993_c1 3300050515 Bacteria 2517
264 nmdc:mga0a205_142150_c1 3300050515 Bacteria 2300
265 nmdc:mga0a205_485992_c1 3300050515 Bacteria 1093
266 nmdc:mga0a205_695947_c1 3300050515 Unclassified 866
267 Ga0501084_0006886 3300054114 Bacteria 9358
268 Ga0501082_0003187 3300060353 Bacteria 14312
269 Ga0501082_0189653 3300060353 Bacteria 1789
270 Ga0068867_100316679
271 SwRhRL2b_contig_3195367
272 JGI25406J46586_10000232
273 Ga0065704_10005045
274 Ga0065715_10159802
275 Ga0065707_10000320
276 Ga0070683_100010580
277 Ga0070690_100002084
278 Ga0070690_100544764
279 Ga0070670_100006900
280 Ga0070670_100337670
281 Ga0070677_10029857
282 Ga0068869_100335658
283 Ga0070680_100744100
284 Ga0070680_100765607
285 Ga0070689_100023010
286 Ga0070691_10111698
287 Ga0070692_10025202
288 Ga0070675_100004748
289 Ga0070675_100076507
290 Ga0070675_100132785
291 Ga0070671_100003231
292 Ga0070671_100193916
293 Ga0070671_100577859
294 Ga0070673_100156628
295 Ga0070673_100484248
296 Ga0070673_100614658
297 Ga0070673_100723347
298 Ga0070688_100014480
299 Ga0070688_100664022
300 Ga0070659_100141591
301 Ga0070701_10105770
302 Ga0070705_100000172
303 Ga0070705_100162647
304 Ga0070705_100167866
305 Ga0070700_100116970
306 Ga0070700_100391662
307 Ga0070694_100003106
308 Ga0070694_100009169
309 Ga0070708_100028747
310 Ga0070708_100224569
311 Ga0070708_100299125
312 Ga0070708_100582272
313 Ga0070678_100234373
314 Ga0070681_10006467
315 Ga0070681_10879534
316 Ga0070706_100569738
317 Ga0070707_100053252
318 Ga0070707_100372253
319 Ga0070698_100001069
320 Ga0070698_100022720
321 Ga0070698_100041592
322 Ga0070699_100000243
323 Ga0070699_100060536
324 Ga0070699_100111109
325 Ga0070679_100066523
326 Ga0070684_100025484
327 Ga0070697_100057180
328 Ga0070697_100121523
329 Ga0070697_100168356
330 Ga0068853_100369374
331 Ga0068853_100407664
332 Ga0070672_100004693
333 Ga0070672_100332860
334 Ga0070686_100004868
335 Ga0070695_100000809
336 Ga0070695_100035182
337 Ga0070695_100056766
338 Ga0070695_100071285
339 Ga0070695_100234354
340 Ga0070695_100284898
341 Ga0070696_100001646
342 Ga0070696_100077672
343 Ga0070696_100161209
344 Ga0070704_100034498
345 Ga0070704_100039901
346 Ga0068855_100237001
347 Ga0070664_100031578
348 Ga0068857_100026187
349 Ga0068854_100020904
350 Ga0070702_100104126
351 Ga0070702_100373235
352 Ga0070702_100555135
353 Ga0068859_100059322
354 Ga0068859_100432907
355 Ga0068864_100035141
356 Ga0068861_100574175
357 Ga0068861_100957552
358 Ga0068861_101081113
359 Ga0068870_10006190
360 Ga0068870_10365052
361 Ga0068863_100482039
362 Ga0068858_100006751
363 Ga0068860_100008315
364 Ga0068860_100698488
365 Ga0081539_10000096
366 Ga0097621_100094493
367 Ga0097621_100423978
368 Ga0068871_100179501
369 Ga0068871_100339687
370 Ga0068871_100612558
371 Ga0075428_100000747
372 Ga0075430_100161027
373 Ga0075433_10055850
374 Ga0075433_10115739
375 Ga0075433_10262523
376 Ga0075433_10347686
377 Ga0075433_10457749
378 Ga0075434_100043761
379 Ga0075434_100046899
380 Ga0075434_100187502
381 Ga0075434_100217185
382 Ga0075434_100264809
383 Ga0075434_100382419
384 Ga0075434_100722234
385 Ga0075434_101039821
386 Ga0075429_100349897
387 Ga0068865_100089204
388 Ga0068865_100452143
389 Ga0097620_100059317
390 Ga0097620_100432889
391 Ga0075435_100028567
392 Ga0075435_100038274
393 Ga0075435_100051637
394 Ga0075435_100293336
395 Ga0075435_100480712
396 Ga0105240_10305883
397 Ga0111539_10051408
398 Ga0111539_10151228
399 Ga0111539_10217230
400 Ga0114129_10000152
401 Ga0114129_10053535
402 Ga0114129_10575607
403 Ga0114129_10634353
404 Ga0105243_10254062
405 Ga0105241_10042506
406 Ga0105248_10207877
407 Ga0105246_10704355
408 Ga0157378_10094208
409 Ga0157378_10117514
410 Ga0157375_10244352
411 Ga0157377_10164081
412 Ga0157376_10191519
413 Ga0157376_10945780
414 Ga0207682_10131859
415 Ga0207684_10318693
416 Ga0207695_10423103
417 Ga0207652_10184491
418 Ga0207646_10135116
419 Ga0207646_10708037
420 Ga0207650_10338790
421 Ga0207659_10004418
422 Ga0207659_10067799
423 Ga0207659_10169903
424 Ga0207644_10119479
425 Ga0207644_10123951
426 Ga0207686_10018781
427 Ga0207670_10005999
428 Ga0207691_10016220
429 Ga0207691_10302612
430 Ga0207689_10186228
431 Ga0207689_10214699
432 Ga0207640_10027894
433 Ga0207703_10005141
434 Ga0207639_10435460
435 Ga0207708_10286339
436 Ga0207648_10293047
437 Ga0207676_10011347
438 Ga0207676_10034181
439 Ga0207676_11120609
440 Ga0207674_10208385
441 Ga0207675_100534034
442 Ga0207428_10214269
443 Ga0207428_10296865
444 Ga0268264_10009087
445 Ga0307413_10096607
446 Ga0307412_10277189
447 Ga0373948_0007228
448 Ga0373950_0017185
449 Ga0373958_0006333
450 Ga0373959_0004277
451 Ga0373938_0001675
452 Ga0373928_0001065
453 Ga0373929_0002467
454 Ga0373940_0000292
455 Ga0373951_0004393
456 Ga0373952_0001082
457 Ga0373932_0001607
458 Ga0373939_0000409
459 Ga0373941_0000118
460 Ga0373960_0002614
461 Ga0373942_0002936
462 Ga0373961_0003274
463 Ga0373931_0001612
464 Ga0439460_0016493
465 Ga0451576_0012560
466 Ga0451576_0033456
467 Ga0451576_0069638
468 Ga0495603_0026940
469 Ga0495603_0130801
470 Ga0495629_0099126
471 Ga0495582_0121501
472 Ga0495594_0145173
473 Ga0495583_0263583
474 Ga0495663_0007325
475 Ga0495663_0090713
476 Ga0495598_0017715
477 Ga0495609_0060087
478 Ga0495621_0019438
479 Ga0495621_0090392
480 Ga0495621_0222383
481 Ga0495659_0008902
482 Ga0495659_0021874
483 Ga0495659_0041472
484 Ga0495588_0002241
485 Ga0495669_0138790
486 Ga0495670_0071541
487 Ga0495670_0354283
488 Ga0495581_0099220
489 Ga0495636_0028246
490 Ga0495636_0078622
491 Ga0495676_0592909
492 Ga0496102_0074474
493 Ga0496112_0454211
494 Ga0501033_0084178
495 Ga0501036_0066935
496 Ga0501037_0072590
497 Ga0501039_0279832
498 Ga0501041_0001187
499 Ga0501042_0010256
500 Ga0501042_0230263
501 Ga0501067_0050576
502 Ga0501068_0027376
503 Ga0501071_0011783
504 Ga0501075_0251614
505 Ga0501075_0306016
506 Ga0501076_0002688
507 Ga0501079_0006438
508 Ga0501081_0002548
509 Ga0501083_0235969
510 Ga0501083_0246064
511 Ga0501045_0331947
512 nmdc:mga05p37_283521_c1
513 nmdc:mga05p37_7128_c1
514 nmdc:mga05p37_88534_c1
515 nmdc:mga09592_42997_c1
516 nmdc:mga0qj67_71481_c1
517 nmdc:mga08y16_138474_c1
518 nmdc:mga08y16_169031_c1
519 nmdc:mga08y16_89387_c1
520 nmdc:mga0n895_25120_c1
521 nmdc:mga0n895_259500_c1
522 nmdc:mga0n895_324056_c1
523 nmdc:mga0n895_484747_c1
524 nmdc:mga0n895_503507_c1
525 nmdc:mga0n895_71036_c1
526 nmdc:mga0rr50_10558_c1
527 nmdc:mga0rr50_15033_c1
528 nmdc:mga0rr50_223651_c1
529 nmdc:mga0rr50_306317_c1
530 nmdc:mga0rr50_369140_c1
531 nmdc:mga0rr50_707756_c1
532 nmdc:mga0a205_120993_c1
533 nmdc:mga0a205_142150_c1
534 nmdc:mga0a205_485992_c1
535 nmdc:mga0a205_695947_c1
536 Ga0501084_0006886
537 Ga0501082_0003187
538 Ga0501082_0189653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azw-assembly1.cif.gz_B crystal structure of p24beta1 gold domain 0.8251 101 191
5azw-assembly1.cif.gz_B crystal structure of p24beta1 gold domain 0.7929 101 191
5gu5-assembly1.cif.gz_A crystal structure of p24gamma2 gold domain determined by sulfur-sad 0.7846 97 196
7rrm-assembly2.cif.gz_B-2 structure of the human tmed1 (p24gamma1) golgi dynamics domain 0.7416 95 193
3jqx-assembly1.cif.gz_A crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium 0.7385 100 194
ID Description Score Start End Superfamily
af_A4I7U4_659_759_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8329 97 191 2.60.120.680
af_Q8IDZ5_23_205_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8298 101 191 2.60.120.10
af_I1KWA0_476_571_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8243 103 191 2.60.120.680
af_Q59V63_18_195_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8167 101 191 2.60.120.10
af_Q8INX8_28_125_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8147 99 191 2.60.120.680
ID Description Score Start End GO Terms
AF-A0A317HMD4-F1-model_v4 Uncharacterized protein 1.001 113 213
AF-A0A317HMD4-F1-model_v4 Uncharacterized protein 0.9819 113 213
AF-A0A349E7C7-F1-model_v4 Uncharacterized protein 0.969 101 213
AF-A0A3D3QD65-F1-model_v4 deleted 0.9617 88 213
AF-A0A381RB09-F1-model_v4 GOLD domain-containing protein 0.9615 85 211

Map