F376020

General Info

Members Datasets Scaffolds Average Seq Length
269 166 538 146

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100023602|Ga0070714_1000236023
Length 162
Sequence MDDAGKPQDEPRVRRHRGDFRWDAVEVLRYKDEGSAPFRDVTRQVLFDGAGLPVQLRYFEVAPGGWTTLERHEHVHAVMVIRGRGRCLVGERAYDLALNDLVSVPPMTWHQFQAAEDEPLGFLCVVTAERDRPQLPSAEEAEALARQTGDRPLVPRSGTKSR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
164 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 1.86
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100023602 3300005435 Bacteria 5056
2 Ga0070658_10039859 3300005327 Bacteria 3790
3 Ga0070658_10110885 3300005327 Bacteria 2273
4 Ga0070658_10116309 3300005327 Bacteria 2219
5 Ga0070658_10154248 3300005327 Bacteria 1924
6 Ga0070658_10184218 3300005327 Bacteria 1758
7 Ga0070658_10468364 3300005327 Bacteria 1087
8 Ga0070676_10598566 3300005328 Bacteria 795
9 Ga0070683_100031325 3300005329 Unclassified 4835
10 Ga0070683_100256617 3300005329 Bacteria 1663
11 Ga0070683_100610884 3300005329 Bacteria 1044
12 Ga0068868_100155774 3300005338 Bacteria 1884
13 Ga0068868_100160471 3300005338 Bacteria 1856
14 Ga0068868_100167844 3300005338 Bacteria 1816
15 Ga0068868_100624506 3300005338 Bacteria 957
16 Ga0070660_100067531 3300005339 Bacteria 2786
17 Ga0070660_101374710 3300005339 Bacteria 600
18 Ga0070689_100036435 3300005340 Bacteria 3763
19 Ga0070687_100092961 3300005343 Bacteria 1672
20 Ga0070687_100174199 3300005343 Bacteria 1283
21 Ga0070661_100418440 3300005344 Bacteria 1062
22 Ga0070661_101576738 3300005344 Unclassified 555
23 Ga0070692_10411802 3300005345 Bacteria 856
24 Ga0070675_100310337 3300005354 Bacteria 1391
25 Ga0070675_100399399 3300005354 Bacteria 1226
26 Ga0070673_100172834 3300005364 Bacteria 1845
27 Ga0070673_100452806 3300005364 Bacteria 1155
28 Ga0070673_100841941 3300005364 Bacteria 848
29 Ga0070688_100031488 3300005365 Bacteria 3191
30 Ga0070709_10049149 3300005434 Bacteria 2635
31 Ga0070714_100526258 3300005435 Bacteria 1130
32 Ga0070701_10247357 3300005438 Bacteria 1075
33 Ga0070700_101249377 3300005441 Unclassified 622
34 Ga0070678_100037520 3300005456 Bacteria 3404
35 Ga0070662_100408245 3300005457 Bacteria 1122
36 Ga0070681_10119096 3300005458 Bacteria 2576
37 Ga0070681_10185931 3300005458 Bacteria 1998
38 Ga0068867_100071677 3300005459 Bacteria 2592
39 Ga0068867_100133616 3300005459 Bacteria 1931
40 Ga0068867_100515519 3300005459 Bacteria 1030
41 Ga0070685_10133010 3300005466 Bacteria 1557
42 Ga0070698_100298360 3300005471 Bacteria 1542
43 Ga0070699_100992106 3300005518 Bacteria 770
44 Ga0070679_100162052 3300005530 Bacteria 2211
45 Ga0070679_100333286 3300005530 Unclassified 1466
46 Ga0070679_100948639 3300005530 Bacteria 804
47 Ga0070684_100165656 3300005535 Bacteria 2006
48 Ga0070684_100281383 3300005535 Bacteria 1524
49 Ga0070684_100580148 3300005535 Bacteria 1042
50 Ga0070684_101480383 3300005535 Bacteria 640
51 Ga0068853_100060800 3300005539 Bacteria 3265
52 Ga0068853_100102692 3300005539 Bacteria 2530
53 Ga0070672_100278087 3300005543 Bacteria 1414
54 Ga0070672_101674582 3300005543 Bacteria 571
55 Ga0070686_100976677 3300005544 Bacteria 693
56 Ga0070696_100049010 3300005546 Bacteria 2932
57 Ga0070696_100939594 3300005546 Bacteria 719
58 Ga0070693_100578304 3300005547 Bacteria 808
59 Ga0070693_100635099 3300005547 Bacteria 775
60 Ga0070665_100096282 3300005548 Bacteria 2965
61 Ga0070704_100427886 3300005549 Bacteria 1135
62 Ga0070704_100557984 3300005549 Bacteria 1001
63 Ga0068855_100006216 3300005563 Bacteria 14552
64 Ga0068855_100022748 3300005563 Bacteria 7511
65 Ga0068855_100046628 3300005563 Bacteria 5123
66 Ga0068855_100358434 3300005563 Bacteria 1605
67 Ga0068855_100698241 3300005563 Bacteria 1086
68 Ga0068855_100719086 3300005563 Unclassified 1067
69 Ga0068855_101551341 3300005563 Bacteria 679
70 Ga0068854_100226035 3300005578 Bacteria 1483
71 Ga0068854_100953877 3300005578 Unclassified 757
72 Ga0068856_100103800 3300005614 Bacteria 2836
73 Ga0068856_100580964 3300005614 Bacteria 1142
74 Ga0070702_100103204 3300005615 Bacteria 1753
75 Ga0068852_100000605 3300005616 Bacteria 23555
76 Ga0068852_100035923 3300005616 Bacteria 4140
77 Ga0068852_100467860 3300005616 Bacteria 1251
78 Ga0068852_100968272 3300005616 Bacteria 869
79 Ga0068859_100018744 3300005617 Bacteria 6954
80 Ga0068859_100785484 3300005617 Unclassified 1040
81 Ga0068859_100874770 3300005617 Bacteria 984
82 Ga0068866_10620008 3300005718 Bacteria 733
83 Ga0068861_100692141 3300005719 Bacteria 946
84 Ga0068870_10325578 3300005840 Bacteria 978
85 Ga0068863_102050335 3300005841 Bacteria 582
86 Ga0068858_100233394 3300005842 Bacteria 1744
87 Ga0070717_10062607 3300006028 Bacteria 3086
88 Ga0075369_10134158 3300006186 Bacteria 1126
89 Ga0075366_10386755 3300006195 Bacteria 860
90 Ga0075366_10484509 3300006195 Unclassified 764
91 Ga0097621_100137950 3300006237 Bacteria 2082
92 Ga0068871_100927618 3300006358 Bacteria 808
93 Ga0075428_100053420 3300006844 Bacteria 4427
94 Ga0075433_10040424 3300006852 Bacteria 4036
95 Ga0075434_101713317 3300006871 Bacteria 636
96 Ga0068865_101199910 3300006881 Bacteria 672
97 Ga0075436_100000269 3300006914 Bacteria 32659
98 Ga0097620_100018744 3300006931 Bacteria 6954
99 Ga0097620_100785618 3300006931 Unclassified 1040
100 Ga0097620_100874706 3300006931 Bacteria 984
101 Ga0105240_10029850 3300009093 Bacteria 7096
102 Ga0105240_10219400 3300009093 Bacteria 2217
103 Ga0105240_10223597 3300009093 Bacteria 2192
104 Ga0105240_10483854 3300009093 Bacteria 1379
105 Ga0105240_11775412 3300009093 Bacteria 643
106 Ga0111539_10019870 3300009094 Bacteria 8277
107 Ga0105245_10337077 3300009098 Bacteria 1490
108 Ga0105247_10927997 3300009101 Bacteria 674
109 Ga0105243_10642601 3300009148 Bacteria 1027
110 Ga0105243_10748346 3300009148 Bacteria 958
111 Ga0105241_10016927 3300009174 Bacteria 5351
112 Ga0105241_10020936 3300009174 Bacteria 4834
113 Ga0105241_10360551 3300009174 Bacteria 1265
114 Ga0105242_11552664 3300009176 Bacteria 694
115 Ga0105248_10335527 3300009177 Bacteria 1702
116 Ga0105238_10012963 3300009551 Bacteria 8415
117 Ga0105238_10027220 3300009551 Bacteria 5826
118 Ga0105238_10072084 3300009551 Bacteria 3451
119 Ga0105238_10329204 3300009551 Bacteria 1514
120 Ga0105238_10897031 3300009551 Bacteria 905
121 Ga0105238_12133124 3300009551 Unclassified 595
122 Ga0105249_12651481 3300009553 Bacteria 573
123 Ga0105239_10481275 3300010375 Bacteria 1410
124 Ga0157373_10650955 3300013100 Bacteria 770
125 Ga0157371_10132753 3300013102 Bacteria 1772
126 Ga0157370_10034337 3300013104 Bacteria 4940
127 Ga0157369_10007213 3300013105 Bacteria 12812
128 Ga0157369_10648109 3300013105 Bacteria 1089
129 Ga0157374_10167721 3300013296 Bacteria 2141
130 Ga0163162_10294371 3300013306 Bacteria 1755
131 Ga0157372_10001375 3300013307 Bacteria 26279
132 Ga0157372_10017672 3300013307 Bacteria 7656
133 Ga0157372_12064917 3300013307 Bacteria 655
134 Ga0157372_12924472 3300013307 Bacteria 547
135 Ga0157377_10154622 3300014745 Bacteria 1421
136 Ga0157376_10524896 3300014969 Bacteria 1168
137 Ga0157376_10927540 3300014969 Bacteria 890
138 Ga0157376_10934720 3300014969 Bacteria 887
139 Ga0163161_10048179 3300017792 Bacteria 3077
140 Ga0163161_10416215 3300017792 Bacteria 1080
141 Ga0163161_10872794 3300017792 Bacteria 760
142 Ga0206356_10104318 3300020070 Bacteria 946
143 Ga0213876_10552166 3300021384 Unclassified 613
144 Ga0213876_10594103 3300021384 Bacteria 589
145 Ga0207656_10015854 3300025321 Bacteria 2923
146 Ga0207682_10179359 3300025893 Bacteria 967
147 Ga0207688_10121551 3300025901 Bacteria 1524
148 Ga0207699_10052411 3300025906 Bacteria 2415
149 Ga0207705_10075955 3300025909 Bacteria 2442
150 Ga0207705_10230862 3300025909 Bacteria 1407
151 Ga0207705_10292778 3300025909 Bacteria 1247
152 Ga0207705_10354547 3300025909 Bacteria 1131
153 Ga0207705_10483061 3300025909 Bacteria 962
154 Ga0207654_10013932 3300025911 Bacteria 4144
155 Ga0207654_10107025 3300025911 Bacteria 1733
156 Ga0207707_10199623 3300025912 Bacteria 1744
157 Ga0207707_10932783 3300025912 Bacteria 716
158 Ga0207695_10026762 3300025913 Bacteria 6432
159 Ga0207695_10215764 3300025913 Bacteria 1828
160 Ga0207695_10338711 3300025913 Bacteria 1392
161 Ga0207695_10582537 3300025913 Bacteria 1000
162 Ga0207662_10091462 3300025918 Bacteria 1872
163 Ga0207662_10131248 3300025918 Bacteria 1579
164 Ga0207657_10094988 3300025919 Bacteria 2481
165 Ga0207649_10471480 3300025920 Bacteria 951
166 Ga0207652_10139460 3300025921 Bacteria 2167
167 Ga0207652_10282287 3300025921 Bacteria 1498
168 Ga0207652_10849064 3300025921 Bacteria 809
169 Ga0207681_10320394 3300025923 Bacteria 1233
170 Ga0207694_10430857 3300025924 Bacteria 1099
171 Ga0207659_10041937 3300025926 Bacteria 3206
172 Ga0207687_10159741 3300025927 Bacteria 1728
173 Ga0207664_10066900 3300025929 Bacteria 2882
174 Ga0207664_10188986 3300025929 Bacteria 1772
175 Ga0207709_10538451 3300025935 Bacteria 917
176 Ga0207670_10133479 3300025936 Bacteria 1822
177 Ga0207670_10154681 3300025936 Bacteria 1706
178 Ga0207669_10216346 3300025937 Bacteria 1403
179 Ga0207704_10120194 3300025938 Bacteria 1796
180 Ga0207704_10983549 3300025938 Bacteria 713
181 Ga0207691_10011257 3300025940 Bacteria 8583
182 Ga0207711_10702278 3300025941 Bacteria 943
183 Ga0207661_10086243 3300025944 Bacteria 2605
184 Ga0207661_10232456 3300025944 Bacteria 1633
185 Ga0207661_11288106 3300025944 Unclassified 672
186 Ga0207667_10004553 3300025949 Bacteria 16991
187 Ga0207667_10642494 3300025949 Unclassified 1067
188 Ga0207667_10719077 3300025949 Bacteria 1000
189 Ga0207667_10732516 3300025949 Bacteria 989
190 Ga0207667_10842887 3300025949 Bacteria 911
191 Ga0207640_11788640 3300025981 Bacteria 555
192 Ga0207677_10098041 3300026023 Bacteria 2149
193 Ga0207677_10309419 3300026023 Bacteria 1308
194 Ga0207677_11106555 3300026023 Bacteria 722
195 Ga0207703_10001773 3300026035 Bacteria 19268
196 Ga0207703_10145811 3300026035 Bacteria 2059
197 Ga0207703_11505803 3300026035 Bacteria 647
198 Ga0207639_10048477 3300026041 Bacteria 3215
199 Ga0207639_10591445 3300026041 Bacteria 1022
200 Ga0207702_10505294 3300026078 Bacteria 1179
201 Ga0207641_10475410 3300026088 Bacteria 1211
202 Ga0207648_10224658 3300026089 Bacteria 1670
203 Ga0207648_10466131 3300026089 Bacteria 1152
204 Ga0207676_11004995 3300026095 Bacteria 822
205 Ga0207674_10308592 3300026116 Bacteria 1531
206 Ga0207675_102299272 3300026118 Bacteria 553
207 Ga0207683_10134521 3300026121 Bacteria 2225
208 Ga0207698_10006325 3300026142 Bacteria 7375
209 Ga0207698_10009794 3300026142 Bacteria 6122
210 Ga0207698_10041557 3300026142 Bacteria 3427
211 Ga0207698_10220155 3300026142 Bacteria 1715
212 Ga0207428_10009606 3300027907 Bacteria 8666
213 Ga0268266_10602519 3300028379 Bacteria 1055
214 Ga0268266_10845370 3300028379 Bacteria 885
215 Ga0307408_100166353 3300031548 Bacteria 1757
216 Ga0307413_10816973 3300031824 Bacteria 785
217 Ga0307406_10339717 3300031901 Unclassified 1169
218 Ga0307412_10145648 3300031911 Bacteria 1741
219 Ga0307409_101244670 3300031995 Bacteria 768
220 Ga0307416_100418578 3300032002 Bacteria 1383
221 Ga0373937_0694393 3300036401 Unclassified 964
222 Ga0373925_0132236 3300037068 Unclassified 1947
223 Ga0395900_0039128 3300037418 Bacteria 4887
224 Ga0436365_0873502 3300039437 Bacteria 2838
225 Ga0436365_1668698 3300039437 Bacteria 693
226 Ga0436363_0464709 3300039450 Bacteria 632
227 Ga0451789_1094018 3300041443 Bacteria 774
228 Ga0451807_1608696 3300041486 Bacteria 574
229 Ga0451839_1403448 3300041496 Bacteria 640
230 Ga0451853_0005308 3300041512 Archaea 848
231 Ga0439434_0144039 3300042435 Bacteria 786
232 Ga0466966_0683995 3300044684 Bacteria 618
233 Ga0466957_0300545 3300044842 Bacteria 1078
234 Ga0466959_0078337 3300045049 Bacteria 2384
235 Ga0466958_0206415 3300045836 Bacteria 1251
236 Ga0466967_0366913 3300045976 Bacteria 1396
237 Ga0495621_0036638 3300046539 Bacteria 1703
238 Ga0496104_0120118 3300048907 Bacteria 2523
239 Ga0496108_0149075 3300048911 Bacteria 2018
240 Ga0496110_0065944 3300048913 Bacteria 3201
241 Ga0501034_0957974 3300049571 Bacteria 741
242 Ga0501037_0755484 3300049573 Bacteria 644
243 Ga0501037_0935536 3300049573 Bacteria 567
244 Ga0501043_0652778 3300049579 Bacteria 772
245 Ga0501047_0000635 3300049581 Bacteria 36925
246 Ga0501048_0213653 3300049582 Bacteria 1368
247 Ga0501069_0010328 3300049585 Bacteria 4942
248 Ga0501070_0000745 3300049586 Bacteria 29654
249 Ga0501070_0210510 3300049586 Unclassified 1596
250 Ga0501072_0261334 3300049588 Bacteria 1378
251 Ga0501073_0034390 3300049589 Bacteria 3607
252 Ga0501074_0370771 3300049590 Bacteria 1015
253 Ga0501076_1711479 3300049592 Bacteria 516
254 Ga0501079_0193316 3300049741 Bacteria 1588
255 Ga0501080_0077127 3300049742 Bacteria 3099
256 Ga0501080_0540531 3300049742 Bacteria 1038
257 Ga0501083_0005839 3300049744 Bacteria 8716
258 nmdc:mga0k408_519760_c1 3300050493 Bacteria 705
259 nmdc:mga09592_155952_c1 3300050508 Bacteria 1971
260 nmdc:mga08y16_570_c1 3300050511 Bacteria 34272
261 nmdc:mga0rr50_505606_c1 3300050513 Bacteria 1028
262 nmdc:mga08x19_1150_c1 3300050514 Bacteria 16525
263 nmdc:mga0a205_51659_c1 3300050515 Bacteria 3628
264 nmdc:mga0sz30_48556_c2 3300050516 Bacteria 1058
265 Ga0500641_0043281 3300053096 Bacteria 1827
266 Ga0500628_080693 3300053129 Bacteria 832
267 Ga0501084_0177914 3300054114 Bacteria 1796
268 Ga0501082_0114101 3300060353 Bacteria 2340
269 Ga0501082_1262916 3300060353 Bacteria 645
270 Ga0070714_100023602
271 Ga0070658_10039859
272 Ga0070658_10110885
273 Ga0070658_10116309
274 Ga0070658_10154248
275 Ga0070658_10184218
276 Ga0070658_10468364
277 Ga0070676_10598566
278 Ga0070683_100031325
279 Ga0070683_100256617
280 Ga0070683_100610884
281 Ga0068868_100155774
282 Ga0068868_100160471
283 Ga0068868_100167844
284 Ga0068868_100624506
285 Ga0070660_100067531
286 Ga0070660_101374710
287 Ga0070689_100036435
288 Ga0070687_100092961
289 Ga0070687_100174199
290 Ga0070661_100418440
291 Ga0070661_101576738
292 Ga0070692_10411802
293 Ga0070675_100310337
294 Ga0070675_100399399
295 Ga0070673_100172834
296 Ga0070673_100452806
297 Ga0070673_100841941
298 Ga0070688_100031488
299 Ga0070709_10049149
300 Ga0070714_100526258
301 Ga0070701_10247357
302 Ga0070700_101249377
303 Ga0070678_100037520
304 Ga0070662_100408245
305 Ga0070681_10119096
306 Ga0070681_10185931
307 Ga0068867_100071677
308 Ga0068867_100133616
309 Ga0068867_100515519
310 Ga0070685_10133010
311 Ga0070698_100298360
312 Ga0070699_100992106
313 Ga0070679_100162052
314 Ga0070679_100333286
315 Ga0070679_100948639
316 Ga0070684_100165656
317 Ga0070684_100281383
318 Ga0070684_100580148
319 Ga0070684_101480383
320 Ga0068853_100060800
321 Ga0068853_100102692
322 Ga0070672_100278087
323 Ga0070672_101674582
324 Ga0070686_100976677
325 Ga0070696_100049010
326 Ga0070696_100939594
327 Ga0070693_100578304
328 Ga0070693_100635099
329 Ga0070665_100096282
330 Ga0070704_100427886
331 Ga0070704_100557984
332 Ga0068855_100006216
333 Ga0068855_100022748
334 Ga0068855_100046628
335 Ga0068855_100358434
336 Ga0068855_100698241
337 Ga0068855_100719086
338 Ga0068855_101551341
339 Ga0068854_100226035
340 Ga0068854_100953877
341 Ga0068856_100103800
342 Ga0068856_100580964
343 Ga0070702_100103204
344 Ga0068852_100000605
345 Ga0068852_100035923
346 Ga0068852_100467860
347 Ga0068852_100968272
348 Ga0068859_100018744
349 Ga0068859_100785484
350 Ga0068859_100874770
351 Ga0068866_10620008
352 Ga0068861_100692141
353 Ga0068870_10325578
354 Ga0068863_102050335
355 Ga0068858_100233394
356 Ga0070717_10062607
357 Ga0075369_10134158
358 Ga0075366_10386755
359 Ga0075366_10484509
360 Ga0097621_100137950
361 Ga0068871_100927618
362 Ga0075428_100053420
363 Ga0075433_10040424
364 Ga0075434_101713317
365 Ga0068865_101199910
366 Ga0075436_100000269
367 Ga0097620_100018744
368 Ga0097620_100785618
369 Ga0097620_100874706
370 Ga0105240_10029850
371 Ga0105240_10219400
372 Ga0105240_10223597
373 Ga0105240_10483854
374 Ga0105240_11775412
375 Ga0111539_10019870
376 Ga0105245_10337077
377 Ga0105247_10927997
378 Ga0105243_10642601
379 Ga0105243_10748346
380 Ga0105241_10016927
381 Ga0105241_10020936
382 Ga0105241_10360551
383 Ga0105242_11552664
384 Ga0105248_10335527
385 Ga0105238_10012963
386 Ga0105238_10027220
387 Ga0105238_10072084
388 Ga0105238_10329204
389 Ga0105238_10897031
390 Ga0105238_12133124
391 Ga0105249_12651481
392 Ga0105239_10481275
393 Ga0157373_10650955
394 Ga0157371_10132753
395 Ga0157370_10034337
396 Ga0157369_10007213
397 Ga0157369_10648109
398 Ga0157374_10167721
399 Ga0163162_10294371
400 Ga0157372_10001375
401 Ga0157372_10017672
402 Ga0157372_12064917
403 Ga0157372_12924472
404 Ga0157377_10154622
405 Ga0157376_10524896
406 Ga0157376_10927540
407 Ga0157376_10934720
408 Ga0163161_10048179
409 Ga0163161_10416215
410 Ga0163161_10872794
411 Ga0206356_10104318
412 Ga0213876_10552166
413 Ga0213876_10594103
414 Ga0207656_10015854
415 Ga0207682_10179359
416 Ga0207688_10121551
417 Ga0207699_10052411
418 Ga0207705_10075955
419 Ga0207705_10230862
420 Ga0207705_10292778
421 Ga0207705_10354547
422 Ga0207705_10483061
423 Ga0207654_10013932
424 Ga0207654_10107025
425 Ga0207707_10199623
426 Ga0207707_10932783
427 Ga0207695_10026762
428 Ga0207695_10215764
429 Ga0207695_10338711
430 Ga0207695_10582537
431 Ga0207662_10091462
432 Ga0207662_10131248
433 Ga0207657_10094988
434 Ga0207649_10471480
435 Ga0207652_10139460
436 Ga0207652_10282287
437 Ga0207652_10849064
438 Ga0207681_10320394
439 Ga0207694_10430857
440 Ga0207659_10041937
441 Ga0207687_10159741
442 Ga0207664_10066900
443 Ga0207664_10188986
444 Ga0207709_10538451
445 Ga0207670_10133479
446 Ga0207670_10154681
447 Ga0207669_10216346
448 Ga0207704_10120194
449 Ga0207704_10983549
450 Ga0207691_10011257
451 Ga0207711_10702278
452 Ga0207661_10086243
453 Ga0207661_10232456
454 Ga0207661_11288106
455 Ga0207667_10004553
456 Ga0207667_10642494
457 Ga0207667_10719077
458 Ga0207667_10732516
459 Ga0207667_10842887
460 Ga0207640_11788640
461 Ga0207677_10098041
462 Ga0207677_10309419
463 Ga0207677_11106555
464 Ga0207703_10001773
465 Ga0207703_10145811
466 Ga0207703_11505803
467 Ga0207639_10048477
468 Ga0207639_10591445
469 Ga0207702_10505294
470 Ga0207641_10475410
471 Ga0207648_10224658
472 Ga0207648_10466131
473 Ga0207676_11004995
474 Ga0207674_10308592
475 Ga0207675_102299272
476 Ga0207683_10134521
477 Ga0207698_10006325
478 Ga0207698_10009794
479 Ga0207698_10041557
480 Ga0207698_10220155
481 Ga0207428_10009606
482 Ga0268266_10602519
483 Ga0268266_10845370
484 Ga0307408_100166353
485 Ga0307413_10816973
486 Ga0307406_10339717
487 Ga0307412_10145648
488 Ga0307409_101244670
489 Ga0307416_100418578
490 Ga0373937_0694393
491 Ga0373925_0132236
492 Ga0395900_0039128
493 Ga0436365_0873502
494 Ga0436365_1668698
495 Ga0436363_0464709
496 Ga0451789_1094018
497 Ga0451807_1608696
498 Ga0451839_1403448
499 Ga0451853_0005308
500 Ga0439434_0144039
501 Ga0466966_0683995
502 Ga0466957_0300545
503 Ga0466959_0078337
504 Ga0466958_0206415
505 Ga0466967_0366913
506 Ga0495621_0036638
507 Ga0496104_0120118
508 Ga0496108_0149075
509 Ga0496110_0065944
510 Ga0501034_0957974
511 Ga0501037_0755484
512 Ga0501037_0935536
513 Ga0501043_0652778
514 Ga0501047_0000635
515 Ga0501048_0213653
516 Ga0501069_0010328
517 Ga0501070_0000745
518 Ga0501070_0210510
519 Ga0501072_0261334
520 Ga0501073_0034390
521 Ga0501074_0370771
522 Ga0501076_1711479
523 Ga0501079_0193316
524 Ga0501080_0077127
525 Ga0501080_0540531
526 Ga0501083_0005839
527 nmdc:mga0k408_519760_c1
528 nmdc:mga09592_155952_c1
529 nmdc:mga08y16_570_c1
530 nmdc:mga0rr50_505606_c1
531 nmdc:mga08x19_1150_c1
532 nmdc:mga0a205_51659_c1
533 nmdc:mga0sz30_48556_c2
534 Ga0500641_0043281
535 Ga0500628_080693
536 Ga0501084_0177914
537 Ga0501082_0114101
538 Ga0501082_1262916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

57

126

0.97

PF02311

AraC_binding

AraC-like ligand binding domain

53

150

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_A crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9379 50 124
4fah-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans a85h mutant 0.9364 50 124
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.936 50 124
3nl1-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate 0.9359 50 124
3nw4-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate 0.9358 50 124
ID Description Score Start End Superfamily
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9362 50 124 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8966 35 121 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8959 50 121 2.60.120.10
4cugB01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8952 52 121 2.60.120.650
af_Q852L2_251_463_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8908 50 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1P8FDQ1-F1-model_v4 Cupin 0.9627 6 143
AF-A0A6M4GSN3-F1-model_v4 1-methylthio-D-xylulose 5-phosphate methylsulfurylase (EC 4.4.1.-) 0.9576 6 140 GO:0016829
AF-A0A0A0BP12-F1-model_v4 Cupin type-2 domain-containing protein 0.9455 49 121
AF-A0A6M4GSN3-F1-model_v4 1-methylthio-D-xylulose 5-phosphate methylsulfurylase (EC 4.4.1.-) 0.9374 6 140 GO:0016829
AF-A0A1P8FDQ1-F1-model_v4 Cupin 0.9363 6 143

Map