F375928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 169 | 269 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10057122|rootH1_100571223 |
| Length | 271 |
| Sequence | VRYTRAKKHKQIMMRDKKLIVGNWKMNLNTHEASLYLHKLAGMVPVHRDVTVVLAPTLLALQSLSLQIDRRQFKLAVQNLYWRDHGAFTGEVSAAQLHGVADYAIIGHSERRHIFNETDKDIRSKVQAALRSHIHPILCIGETAGERADGETQDVLHDQLVGGLANVTSEELEDVTIAYEPVWAIGTGDNAMPDDVKAAVMTIRNQIKHLYGAEISKKVAVLYGGSVKADSAASYLAIDGIDGLLVGGASLDAHEFTEIVTRAHTHVEKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 55 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 99 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 100 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 101 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 102 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 103 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 104 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 105 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 106 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 107 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 116 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 117 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 118 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 119 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 120 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 121 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 122 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 123 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 124 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 125 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 126 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 127 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 128 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 131 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 146 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 147 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 148 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 149 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 150 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 151 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 152 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 153 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 154 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 155 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 156 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 157 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 158 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 159 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 160 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 161 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 162 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 163 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 165 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 166 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 167 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 168 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 169 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.07 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 75.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2473327 | 2162886012 | Bacteria | 1303 |
| 2 | JGI24740J21852_10015060 | 3300001979 | Bacteria | 2833 |
| 3 | JGI24740J21852_10052926 | 3300001979 | Bacteria | 1154 |
| 4 | JGI24737J22298_10001714 | 3300001990 | Bacteria | 7820 |
| 5 | JGI24743J22301_10025899 | 3300001991 | Bacteria | 1139 |
| 6 | JGI24735J21928_10000273 | 3300002067 | Bacteria | 18115 |
| 7 | JGI24738J21930_10004171 | 3300002075 | Bacteria | 3564 |
| 8 | rootH1_10004333 | 3300003316 | Bacteria | 78263 |
| 9 | rootH2_10000763 | 3300003320 | Bacteria | 99150 |
| 10 | rootL2_10312222 | 3300003322 | Bacteria | 1164 |
| 11 | rootH1_10057122 | 3300003323 | Bacteria | 15426 |
| 12 | Ga0055530_10006145 | 3300003791 | Bacteria | 5452 |
| 13 | JGI25405J52794_10052892 | 3300003911 | Bacteria | 872 |
| 14 | Ga0065714_10147339 | 3300005288 | Bacteria | 1129 |
| 15 | Ga0065715_10098299 | 3300005293 | Bacteria | 3568 |
| 16 | Ga0070658_10000024 | 3300005327 | Bacteria | 175873 |
| 17 | Ga0070658_10376492 | 3300005327 | Bacteria | 1217 |
| 18 | Ga0070683_100320240 | 3300005329 | Unclassified | 1476 |
| 19 | Ga0068869_100169804 | 3300005334 | Bacteria | 1703 |
| 20 | Ga0068869_100298937 | 3300005334 | Bacteria | 1299 |
| 21 | Ga0070680_100399679 | 3300005336 | Bacteria | 1171 |
| 22 | Ga0070660_100007740 | 3300005339 | Bacteria | 7492 |
| 23 | Ga0070660_100051313 | 3300005339 | Bacteria | 3176 |
| 24 | Ga0070660_100169579 | 3300005339 | Bacteria | 1762 |
| 25 | Ga0070661_100151447 | 3300005344 | Bacteria | 1753 |
| 26 | Ga0070675_100526217 | 3300005354 | Bacteria | 1067 |
| 27 | Ga0070675_100668175 | 3300005354 | Bacteria | 945 |
| 28 | Ga0070671_100223738 | 3300005355 | Bacteria | 1596 |
| 29 | Ga0070673_100432110 | 3300005364 | Bacteria | 1182 |
| 30 | Ga0070659_100009496 | 3300005366 | Bacteria | 7147 |
| 31 | Ga0070678_100034914 | 3300005456 | Bacteria | 3506 |
| 32 | Ga0070662_100057255 | 3300005457 | Bacteria | 2832 |
| 33 | Ga0070662_100277323 | 3300005457 | Bacteria | 1356 |
| 34 | Ga0070681_10048052 | 3300005458 | Bacteria | 4265 |
| 35 | Ga0070681_10075027 | 3300005458 | Bacteria | 3342 |
| 36 | Ga0068867_100210710 | 3300005459 | Bacteria | 1560 |
| 37 | Ga0068855_100000002 | 3300005563 | Bacteria | 616881 |
| 38 | Ga0068855_100000005 | 3300005563 | Bacteria | 337711 |
| 39 | Ga0068855_100000990 | 3300005563 | Bacteria | 35322 |
| 40 | Ga0070664_100000517 | 3300005564 | Bacteria | 29256 |
| 41 | Ga0070664_100664840 | 3300005564 | Bacteria | 969 |
| 42 | Ga0068857_100000331 | 3300005577 | Bacteria | 32594 |
| 43 | Ga0068857_100001409 | 3300005577 | Bacteria | 19000 |
| 44 | Ga0068857_100021166 | 3300005577 | Bacteria | 5723 |
| 45 | Ga0068856_100000027 | 3300005614 | Bacteria | 133290 |
| 46 | Ga0068856_100000029 | 3300005614 | Bacteria | 130205 |
| 47 | Ga0068856_100221350 | 3300005614 | Bacteria | 1908 |
| 48 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 49 | Ga0068852_100000531 | 3300005616 | Bacteria | 25057 |
| 50 | Ga0068852_100125222 | 3300005616 | Bacteria | 2359 |
| 51 | Ga0068863_100486745 | 3300005841 | Bacteria | 1214 |
| 52 | Ga0068862_100240510 | 3300005844 | Bacteria | 1646 |
| 53 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 54 | Ga0075365_10000008 | 3300006038 | Bacteria | 114620 |
| 55 | Ga0075365_10000041 | 3300006038 | Bacteria | 43185 |
| 56 | Ga0075365_10005405 | 3300006038 | Bacteria | 6883 |
| 57 | Ga0075368_10000954 | 3300006042 | Bacteria | 8997 |
| 58 | Ga0075363_100003988 | 3300006048 | Bacteria | 6385 |
| 59 | Ga0075364_10009874 | 3300006051 | Bacteria | 5743 |
| 60 | Ga0075364_10092837 | 3300006051 | Bacteria | 2004 |
| 61 | Ga0075362_10048576 | 3300006177 | Bacteria | 1893 |
| 62 | Ga0075369_10024083 | 3300006186 | Bacteria | 2520 |
| 63 | Ga0075366_10020155 | 3300006195 | Bacteria | 3865 |
| 64 | Ga0075366_10039072 | 3300006195 | Bacteria | 2804 |
| 65 | Ga0075370_10003143 | 3300006353 | Bacteria | 7797 |
| 66 | Ga0075370_10006633 | 3300006353 | Bacteria | 5836 |
| 67 | Ga0075370_10090220 | 3300006353 | Bacteria | 1768 |
| 68 | Ga0068871_100013864 | 3300006358 | Bacteria | 5993 |
| 69 | Ga0068871_100077262 | 3300006358 | Bacteria | 2751 |
| 70 | Ga0075428_100002220 | 3300006844 | Bacteria | 21042 |
| 71 | Ga0068865_100016589 | 3300006881 | Bacteria | 4717 |
| 72 | Ga0068865_100190751 | 3300006881 | Bacteria | 1585 |
| 73 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 74 | Ga0105240_10001037 | 3300009093 | Bacteria | 49391 |
| 75 | Ga0105240_10029617 | 3300009093 | Bacteria | 7127 |
| 76 | Ga0105245_10455559 | 3300009098 | Bacteria | 1288 |
| 77 | Ga0105245_10794900 | 3300009098 | Bacteria | 984 |
| 78 | Ga0105241_10087287 | 3300009174 | Bacteria | 2455 |
| 79 | Ga0105241_10335713 | 3300009174 | Bacteria | 1308 |
| 80 | Ga0105242_10030902 | 3300009176 | Bacteria | 4277 |
| 81 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 82 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 83 | Ga0105238_10001532 | 3300009551 | Bacteria | 23175 |
| 84 | Ga0105238_10370444 | 3300009551 | Bacteria | 1423 |
| 85 | Ga0105238_10845543 | 3300009551 | Bacteria | 932 |
| 86 | Ga0105238_11058290 | 3300009551 | Bacteria | 833 |
| 87 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 88 | Ga0105032_100025 | 3300009979 | Bacteria | 33986 |
| 89 | Ga0105032_104339 | 3300009979 | Unclassified | 1213 |
| 90 | Ga0105028_100344 | 3300009993 | Unclassified | 4973 |
| 91 | Ga0105028_103593 | 3300009993 | Bacteria | 1619 |
| 92 | Ga0105239_10000960 | 3300010375 | Bacteria | 40541 |
| 93 | Ga0105239_10091434 | 3300010375 | Bacteria | 3358 |
| 94 | Ga0105246_10000105 | 3300011119 | Bacteria | 36849 |
| 95 | Ga0105246_10003086 | 3300011119 | Bacteria | 10110 |
| 96 | Ga0105246_10006004 | 3300011119 | Bacteria | 7415 |
| 97 | Ga0157373_10001588 | 3300013100 | Bacteria | 17357 |
| 98 | Ga0157373_10003921 | 3300013100 | Bacteria | 11232 |
| 99 | Ga0157373_10047311 | 3300013100 | Bacteria | 3068 |
| 100 | Ga0157373_10051013 | 3300013100 | Bacteria | 2946 |
| 101 | Ga0157371_10009138 | 3300013102 | Bacteria | 7829 |
| 102 | Ga0157371_10016146 | 3300013102 | Bacteria | 5581 |
| 103 | Ga0157371_10018922 | 3300013102 | Bacteria | 5085 |
| 104 | Ga0157370_10000168 | 3300013104 | Bacteria | 80700 |
| 105 | Ga0157370_10000403 | 3300013104 | Bacteria | 54542 |
| 106 | Ga0157370_10000520 | 3300013104 | Bacteria | 48163 |
| 107 | Ga0157369_10000003 | 3300013105 | Bacteria | 507337 |
| 108 | Ga0157369_10000055 | 3300013105 | Bacteria | 161739 |
| 109 | Ga0157369_10000075 | 3300013105 | Bacteria | 136520 |
| 110 | Ga0157369_10001459 | 3300013105 | Bacteria | 28989 |
| 111 | Ga0157369_10006246 | 3300013105 | Bacteria | 13824 |
| 112 | Ga0157369_10137480 | 3300013105 | Bacteria | 2586 |
| 113 | Ga0157374_10108965 | 3300013296 | Bacteria | 2662 |
| 114 | Ga0163162_10515277 | 3300013306 | Bacteria | 1326 |
| 115 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 116 | Ga0157372_10000106 | 3300013307 | Bacteria | 87935 |
| 117 | Ga0157372_10022887 | 3300013307 | Bacteria | 6767 |
| 118 | Ga0157372_10781774 | 3300013307 | Bacteria | 1109 |
| 119 | Ga0163163_10367189 | 3300014325 | Bacteria | 1496 |
| 120 | Ga0163163_10383541 | 3300014325 | Bacteria | 1463 |
| 121 | Ga0157377_10024118 | 3300014745 | Bacteria | 3231 |
| 122 | Ga0157376_10000083 | 3300014969 | Bacteria | 71608 |
| 123 | Ga0157376_10005017 | 3300014969 | Bacteria | 9235 |
| 124 | Ga0163161_10062268 | 3300017792 | Bacteria | 2717 |
| 125 | Ga0209050_1001888 | 3300025298 | Bacteria | 20105 |
| 126 | Ga0209257_1000122 | 3300025304 | Bacteria | 219678 |
| 127 | Ga0207705_10000047 | 3300025909 | Bacteria | 175887 |
| 128 | Ga0207654_10210274 | 3300025911 | Bacteria | 1285 |
| 129 | Ga0207654_10223891 | 3300025911 | Bacteria | 1249 |
| 130 | Ga0207654_10419576 | 3300025911 | Bacteria | 933 |
| 131 | Ga0207707_10195388 | 3300025912 | Bacteria | 1765 |
| 132 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 133 | Ga0207695_10002087 | 3300025913 | Bacteria | 30417 |
| 134 | Ga0207695_10003753 | 3300025913 | Bacteria | 21111 |
| 135 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 136 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 137 | Ga0207657_10000125 | 3300025919 | Bacteria | 76937 |
| 138 | Ga0207657_10015093 | 3300025919 | Bacteria | 7503 |
| 139 | Ga0207649_10016002 | 3300025920 | Bacteria | 4222 |
| 140 | Ga0207694_10099787 | 3300025924 | Unclassified | 2300 |
| 141 | Ga0207694_10302242 | 3300025924 | Bacteria | 1318 |
| 142 | Ga0207659_10276539 | 3300025926 | Bacteria | 1371 |
| 143 | Ga0207644_10030406 | 3300025931 | Bacteria | 3756 |
| 144 | Ga0207690_10029932 | 3300025932 | Bacteria | 3466 |
| 145 | Ga0207706_10000090 | 3300025933 | Bacteria | 93774 |
| 146 | Ga0207706_10221178 | 3300025933 | Bacteria | 1658 |
| 147 | Ga0207686_10047333 | 3300025934 | Bacteria | 2658 |
| 148 | Ga0207704_10460173 | 3300025938 | Bacteria | 1017 |
| 149 | Ga0207691_10360530 | 3300025940 | Bacteria | 1243 |
| 150 | Ga0207679_10000186 | 3300025945 | Bacteria | 50492 |
| 151 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 152 | Ga0207667_10000027 | 3300025949 | Bacteria | 337700 |
| 153 | Ga0207712_10100558 | 3300025961 | Bacteria | 2148 |
| 154 | Ga0207668_10270530 | 3300025972 | Bacteria | 1389 |
| 155 | Ga0207640_10004031 | 3300025981 | Bacteria | 7934 |
| 156 | Ga0207703_10670426 | 3300026035 | Bacteria | 985 |
| 157 | Ga0207702_10000213 | 3300026078 | Bacteria | 68574 |
| 158 | Ga0207702_10000549 | 3300026078 | Bacteria | 41892 |
| 159 | Ga0207702_10052584 | 3300026078 | Bacteria | 3447 |
| 160 | Ga0207641_10148598 | 3300026088 | Bacteria | 2121 |
| 161 | Ga0207674_10001624 | 3300026116 | Bacteria | 28924 |
| 162 | Ga0207674_10001826 | 3300026116 | Bacteria | 27174 |
| 163 | Ga0207674_10035638 | 3300026116 | Bacteria | 5193 |
| 164 | Ga0207683_10054321 | 3300026121 | Bacteria | 3513 |
| 165 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 166 | Ga0207698_10000589 | 3300026142 | Bacteria | 21170 |
| 167 | Ga0209813_10000251 | 3300027866 | Bacteria | 15589 |
| 168 | Ga0316176_1093916 | 3300030732 | Bacteria | 908 |
| 169 | Ga0314311_1082504 | 3300030733 | Bacteria | 5267 |
| 170 | Ga0316179_1011384 | 3300030734 | Bacteria | 9267 |
| 171 | Ga0316178_1135305 | 3300030735 | Unclassified | 2528 |
| 172 | Ga0316180_1159006 | 3300030736 | Bacteria | 9125 |
| 173 | Ga0316183_1005382 | 3300030742 | Bacteria | 21667 |
| 174 | Ga0316183_1009146 | 3300030742 | Bacteria | 14177 |
| 175 | Ga0316183_1024096 | 3300030742 | Bacteria | 2209 |
| 176 | Ga0316183_1077166 | 3300030742 | Bacteria | 7218 |
| 177 | Ga0316183_1150083 | 3300030742 | Bacteria | 932 |
| 178 | Ga0316181_1020431 | 3300030744 | Bacteria | 46502 |
| 179 | Ga0316182_1003092 | 3300030745 | Bacteria | 41807 |
| 180 | Ga0316182_1189930 | 3300030745 | Bacteria | 4836 |
| 181 | Ga0316182_1241226 | 3300030745 | Bacteria | 6325 |
| 182 | Ga0316182_1363842 | 3300030745 | Bacteria | 3156 |
| 183 | Ga0307509_10526551 | 3300031507 | Bacteria | 863 |
| 184 | Ga0307516_10011743 | 3300031730 | Bacteria | 9503 |
| 185 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 186 | Ga0307406_10000145 | 3300031901 | Bacteria | 42161 |
| 187 | Ga0307412_10014913 | 3300031911 | Unclassified | 4595 |
| 188 | Ga0373937_0340288 | 3300036401 | Bacteria | 1421 |
| 189 | Ga0395899_0035713 | 3300037312 | Bacteria | 3730 |
| 190 | Ga0395899_0139686 | 3300037312 | Unclassified | 1724 |
| 191 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 192 | Ga0395900_0234702 | 3300037418 | Bacteria | 1843 |
| 193 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 194 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 195 | Ga0395901_0006434 | 3300038443 | Bacteria | 11902 |
| 196 | Ga0395901_0169727 | 3300038443 | Bacteria | 2289 |
| 197 | Ga0439447_011690 | 3300041407 | Unclassified | 2549 |
| 198 | Ga0439461_0000308 | 3300041410 | Bacteria | 6878 |
| 199 | Ga0439461_0001694 | 3300041410 | Bacteria | 3436 |
| 200 | Ga0439466_0002776 | 3300041411 | Bacteria | 6854 |
| 201 | Ga0439465_0028210 | 3300041413 | Bacteria | 1779 |
| 202 | Ga0439442_002748 | 3300042002 | Bacteria | 3456 |
| 203 | Ga0439432_000742 | 3300042006 | Bacteria | 12201 |
| 204 | Ga0439452_040045 | 3300042010 | Bacteria | 1107 |
| 205 | Ga0439463_002277 | 3300042016 | Bacteria | 4920 |
| 206 | Ga0450911_005580 | 3300042115 | Bacteria | 1935 |
| 207 | Ga0450920_001300 | 3300042122 | Bacteria | 4108 |
| 208 | Ga0450903_014712 | 3300042138 | Bacteria | 1237 |
| 209 | Ga0450906_008859 | 3300042145 | Bacteria | 1933 |
| 210 | Ga0439446_0000003 | 3300042156 | Bacteria | 158513 |
| 211 | Ga0439446_0000236 | 3300042156 | Bacteria | 10208 |
| 212 | Ga0450909_002108 | 3300042185 | Bacteria | 2808 |
| 213 | Ga0439434_0004989 | 3300042435 | Bacteria | 3879 |
| 214 | Ga0439464_0000107 | 3300042439 | Bacteria | 12650 |
| 215 | Ga0466965_0000133 | 3300044683 | Bacteria | 21106 |
| 216 | Ga0451576_0011194 | 3300045051 | Bacteria | 10221 |
| 217 | Ga0495638_0000061 | 3300046460 | Bacteria | 188551 |
| 218 | Ga0495606_0023320 | 3300046507 | Bacteria | 4487 |
| 219 | Ga0495660_0000005 | 3300046810 | Bacteria | 574567 |
| 220 | Ga0495660_0006871 | 3300046810 | Bacteria | 6703 |
| 221 | Ga0496100_0056442 | 3300048903 | Unclassified | 2569 |
| 222 | Ga0496113_0083234 | 3300048916 | Bacteria | 2455 |
| 223 | Ga0496113_0184494 | 3300048916 | Bacteria | 1654 |
| 224 | Ga0496115_0000001 | 3300048918 | Bacteria | 367230 |
| 225 | Ga0496122_0074586 | 3300048925 | Bacteria | 2399 |
| 226 | Ga0496123_0028497 | 3300048926 | Bacteria | 4133 |
| 227 | Ga0496126_0092526 | 3300048929 | Bacteria | 2657 |
| 228 | Ga0501034_0000028 | 3300049571 | Bacteria | 255803 |
| 229 | Ga0501034_0001632 | 3300049571 | Bacteria | 29045 |
| 230 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 231 | Ga0501038_0010262 | 3300049574 | Bacteria | 8569 |
| 232 | Ga0501038_0012245 | 3300049574 | Bacteria | 7833 |
| 233 | nmdc:mga00v17_34317_c1 | 3300050491 | Bacteria | 3012 |
| 234 | nmdc:mga00v17_361_c1 | 3300050491 | Bacteria | 25741 |
| 235 | nmdc:mga0yw44_17_c1 | 3300050492 | Bacteria | 74504 |
| 236 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 237 | nmdc:mga0yw44_4_c1 | 3300050492 | Bacteria | 450247 |
| 238 | nmdc:mga0yw44_90727_c1 | 3300050492 | Bacteria | 1931 |
| 239 | nmdc:mga0k408_164671_c1 | 3300050493 | Bacteria | 1321 |
| 240 | nmdc:mga0k408_21557_c1 | 3300050493 | Bacteria | 3620 |
| 241 | nmdc:mga0k408_71125_c1 | 3300050493 | Bacteria | 1258 |
| 242 | nmdc:mga06z11_196_c1 | 3300050494 | Bacteria | 24317 |
| 243 | nmdc:mga07m45_1081_c1 | 3300050496 | Bacteria | 12139 |
| 244 | nmdc:mga07m45_133407_c1 | 3300050496 | Bacteria | 1437 |
| 245 | Ga0500643_008160 | 3300053087 | Bacteria | 4142 |
| 246 | Ga0500643_029783 | 3300053087 | Bacteria | 1676 |
| 247 | Ga0500646_0000075 | 3300053090 | Bacteria | 28149 |
| 248 | Ga0500646_0043804 | 3300053090 | Bacteria | 1268 |
| 249 | Ga0500583_0000347 | 3300053092 | Bacteria | 15434 |
| 250 | Ga0500583_0002751 | 3300053092 | Bacteria | 5368 |
| 251 | Ga0500651_0000001 | 3300053093 | Bacteria | 529808 |
| 252 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 253 | Ga0500555_000009 | 3300053103 | Bacteria | 263998 |
| 254 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 255 | Ga0500569_000014 | 3300053109 | Bacteria | 50618 |
| 256 | Ga0500593_056741 | 3300053117 | Bacteria | 1728 |
| 257 | Ga0500594_0000074 | 3300053118 | Bacteria | 31465 |
| 258 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 259 | Ga0500655_000528 | 3300053133 | Bacteria | 7700 |
| 260 | Ga0500655_001065 | 3300053133 | Bacteria | 5272 |
| 261 | Ga0500573_0185496 | 3300053140 | Bacteria | 1115 |
| 262 | Ga0500577_0004798 | 3300053142 | Bacteria | 3597 |
| 263 | Ga0500588_0000029 | 3300053146 | Bacteria | 32025 |
| 264 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 265 | Ga0500616_0013347 | 3300053153 | Bacteria | 4774 |
| 266 | Ga0500570_000030 | 3300053724 | Bacteria | 35041 |
| 267 | Ga0500611_013472 | 3300053727 | Bacteria | 1404 |
| 268 | Ga0500613_000043 | 3300053738 | Bacteria | 5986 |
| 269 | Ga0590077_031226 | 3300059426 | Bacteria | 1164 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050493 | nmdc:mga0k408_164671_c1 | nmdc:mga0k408_164671_c1_14_676 | 213 |
| 2 | 3300030742 | Ga0316183_1150083 | Ga0316183_11500831 | 223 |
| 3 | 3300030745 | Ga0316182_1363842 | Ga0316182_13638423 | 223 |
| 4 | 3300048916 | Ga0496113_0083234 | Ga0496113_0083234_206_901 | 224 |
| 5 | 3300001979 | JGI24740J21852_10052926 | JGI24740J21852_100529262 | 229 |
| 6 | 3300001991 | JGI24743J22301_10025899 | JGI24743J22301_100258992 | 229 |
| 7 | 3300002075 | JGI24738J21930_10004171 | JGI24738J21930_100041712 | 229 |
| 8 | 3300005334 | Ga0068869_100169804 | Ga0068869_1001698041 | 229 |
| 9 | 3300005339 | Ga0070660_100051313 | Ga0070660_1000513132 | 229 |
| 10 | 3300005344 | Ga0070661_100151447 | Ga0070661_1001514472 | 229 |
| 11 | 3300005354 | Ga0070675_100526217 | Ga0070675_1005262171 | 229 |
| 12 | 3300005457 | Ga0070662_100057255 | Ga0070662_1000572552 | 229 |
| 13 | 3300042138 | Ga0450903_014712 | Ga0450903_014712_102_884 | 230 |
| 14 | 3300049571 | Ga0501034_0001632 | Ga0501034_0001632_23093_23875 | 232 |
| 15 | 3300044683 | Ga0466965_0000133 | Ga0466965_0000133_4677_5456 | 233 |
| 16 | 3300050492 | nmdc:mga0yw44_90727_c1 | nmdc:mga0yw44_90727_c1_1116_1898 | 233 |
| 17 | 3300003322 | rootL2_10312222 | rootL2_103122222 | 236 |
| 18 | 3300005334 | Ga0068869_100298937 | Ga0068869_1002989372 | 237 |
| 19 | 3300005354 | Ga0070675_100668175 | Ga0070675_1006681751 | 237 |
| 20 | 3300005355 | Ga0070671_100223738 | Ga0070671_1002237382 | 237 |
| 21 | 3300005364 | Ga0070673_100432110 | Ga0070673_1004321102 | 237 |
| 22 | 3300005456 | Ga0070678_100034914 | Ga0070678_1000349143 | 237 |
| 23 | 3300005457 | Ga0070662_100277323 | Ga0070662_1002773232 | 237 |
| 24 | 3300005459 | Ga0068867_100210710 | Ga0068867_1002107101 | 237 |
| 25 | 3300005616 | Ga0068852_100125222 | Ga0068852_1001252222 | 237 |
| 26 | 3300005841 | Ga0068863_100486745 | Ga0068863_1004867451 | 237 |
| 27 | 3300005844 | Ga0068862_100240510 | Ga0068862_1002405101 | 237 |
| 28 | 3300006358 | Ga0068871_100077262 | Ga0068871_1000772626 | 237 |
| 29 | 3300006881 | Ga0068865_100190751 | Ga0068865_1001907512 | 237 |
| 30 | 3300009176 | Ga0105242_10030902 | Ga0105242_100309022 | 237 |
| 31 | 3300010375 | Ga0105239_10091434 | Ga0105239_100914344 | 237 |
| 32 | 3300013306 | Ga0163162_10515277 | Ga0163162_105152772 | 237 |
| 33 | 3300014325 | Ga0163163_10383541 | Ga0163163_103835412 | 237 |
| 34 | 3300025926 | Ga0207659_10276539 | Ga0207659_102765392 | 237 |
| 35 | 3300025931 | Ga0207644_10030406 | Ga0207644_100304062 | 237 |
| 36 | 3300025933 | Ga0207706_10221178 | Ga0207706_102211782 | 237 |
| 37 | 3300025934 | Ga0207686_10047333 | Ga0207686_100473331 | 237 |
| 38 | 3300025938 | Ga0207704_10460173 | Ga0207704_104601732 | 237 |
| 39 | 3300025940 | Ga0207691_10360530 | Ga0207691_103605301 | 237 |
| 40 | 3300025961 | Ga0207712_10100558 | Ga0207712_101005584 | 237 |
| 41 | 3300025972 | Ga0207668_10270530 | Ga0207668_102705302 | 237 |
| 42 | 3300026088 | Ga0207641_10148598 | Ga0207641_101485984 | 237 |
| 43 | 3300026121 | Ga0207683_10054321 | Ga0207683_100543213 | 237 |
| 44 | 3300036401 | Ga0373937_0340288 | Ga0373937_0340288_265_999 | 237 |
| 45 | 3300053117 | Ga0500593_056741 | Ga0500593_056741_787_1530 | 237 |
| 46 | 3300005577 | Ga0068857_100000331 | Ga0068857_10000033119 | 239 |
| 47 | 3300025911 | Ga0207654_10210274 | Ga0207654_102102742 | 239 |
| 48 | 3300026116 | Ga0207674_10001624 | Ga0207674_1000162425 | 239 |
| 49 | 3300001979 | JGI24740J21852_10015060 | JGI24740J21852_100150603 | 240 |
| 50 | 3300005564 | Ga0070664_100000517 | Ga0070664_10000051716 | 240 |
| 51 | 3300005564 | Ga0070664_100664840 | Ga0070664_1006648401 | 240 |
| 52 | 3300005614 | Ga0068856_100000027 | Ga0068856_100000027143 | 240 |
| 53 | 3300005614 | Ga0068856_100000029 | Ga0068856_10000002945 | 240 |
| 54 | 3300005616 | Ga0068852_100000531 | Ga0068852_10000053111 | 240 |
| 55 | 3300006051 | Ga0075364_10092837 | Ga0075364_100928372 | 240 |
| 56 | 3300006353 | Ga0075370_10006633 | Ga0075370_100066334 | 240 |
| 57 | 3300006358 | Ga0068871_100013864 | Ga0068871_1000138644 | 240 |
| 58 | 3300006881 | Ga0068865_100016589 | Ga0068865_1000165894 | 240 |
| 59 | 3300025909 | Ga0207705_10000047 | Ga0207705_10000047198 | 240 |
| 60 | 3300025911 | Ga0207654_10223891 | Ga0207654_102238912 | 240 |
| 61 | 3300025919 | Ga0207657_10000125 | Ga0207657_1000012581 | 240 |
| 62 | 3300025920 | Ga0207649_10016002 | Ga0207649_100160023 | 240 |
| 63 | 3300025932 | Ga0207690_10029932 | Ga0207690_100299322 | 240 |
| 64 | 3300025933 | Ga0207706_10000090 | Ga0207706_1000009014 | 240 |
| 65 | 3300025945 | Ga0207679_10000186 | Ga0207679_1000018613 | 240 |
| 66 | 3300026078 | Ga0207702_10000213 | Ga0207702_1000021368 | 240 |
| 67 | 3300026078 | Ga0207702_10000549 | Ga0207702_1000054928 | 240 |
| 68 | 3300026142 | Ga0207698_10000589 | Ga0207698_1000058915 | 240 |
| 69 | 3300031911 | Ga0307412_10014913 | Ga0307412_100149132 | 240 |
| 70 | 3300006195 | Ga0075366_10020155 | Ga0075366_100201553 | 243 |
| 71 | 3300013104 | Ga0157370_10000403 | Ga0157370_1000040326 | 243 |
| 72 | 3300017792 | Ga0163161_10062268 | Ga0163161_100622681 | 243 |
| 73 | 3300046507 | Ga0495606_0023320 | Ga0495606_0023320_3715_4467 | 243 |
| 74 | 3300050493 | nmdc:mga0k408_21557_c1 | nmdc:mga0k408_21557_c1_1294_2046 | 243 |
| 75 | 3300003791 | Ga0055530_10006145 | Ga0055530_100061454 | 244 |
| 76 | 3300025298 | Ga0209050_1001888 | Ga0209050_10018885 | 244 |
| 77 | 3300025304 | Ga0209257_1000122 | Ga0209257_100012284 | 244 |
| 78 | 3300048929 | Ga0496126_0092526 | Ga0496126_0092526_661_1416 | 244 |
| 79 | 3300049574 | Ga0501038_0010262 | Ga0501038_0010262_691_1446 | 244 |
| 80 | 3300005288 | Ga0065714_10147339 | Ga0065714_101473391 | 245 |
| 81 | 3300005327 | Ga0070658_10376492 | Ga0070658_103764921 | 245 |
| 82 | 3300005329 | Ga0070683_100320240 | Ga0070683_1003202401 | 245 |
| 83 | 3300005336 | Ga0070680_100399679 | Ga0070680_1003996791 | 245 |
| 84 | 3300005339 | Ga0070660_100169579 | Ga0070660_1001695792 | 245 |
| 85 | 3300005458 | Ga0070681_10048052 | Ga0070681_100480521 | 245 |
| 86 | 3300013100 | Ga0157373_10001588 | Ga0157373_1000158814 | 245 |
| 87 | 3300013105 | Ga0157369_10137480 | Ga0157369_101374803 | 245 |
| 88 | 3300037312 | Ga0395899_0139686 | Ga0395899_0139686_156_920 | 245 |
| 89 | 3300037418 | Ga0395900_0234702 | Ga0395900_0234702_656_1420 | 245 |
| 90 | 3300048903 | Ga0496100_0056442 | Ga0496100_0056442_376_1155 | 245 |
| 91 | 3300053140 | Ga0500573_0185496 | Ga0500573_0185496_315_1079 | 245 |
| 92 | 3300048925 | Ga0496122_0074586 | Ga0496122_0074586_1350_2150 | 246 |
| 93 | 3300048926 | Ga0496123_0028497 | Ga0496123_0028497_1592_2392 | 246 |
| 94 | 3300041410 | Ga0439461_0001694 | Ga0439461_0001694_2449_3231 | 247 |
| 95 | 3300053153 | Ga0500616_0013347 | Ga0500616_0013347_3873_4655 | 248 |
| 96 | 3300009979 | Ga0105032_104339 | Ga0105032_1043392 | 249 |
| 97 | 3300009993 | Ga0105028_100344 | Ga0105028_1003442 | 249 |
| 98 | 3300005458 | Ga0070681_10075027 | Ga0070681_100750273 | 250 |
| 99 | 3300005563 | Ga0068855_100000990 | Ga0068855_10000099018 | 250 |
| 100 | 3300009098 | Ga0105245_10794900 | Ga0105245_107949002 | 250 |
| 101 | 3300009174 | Ga0105241_10087287 | Ga0105241_100872872 | 250 |
| 102 | 3300013102 | Ga0157371_10009138 | Ga0157371_100091385 | 250 |
| 103 | 3300013105 | Ga0157369_10000003 | Ga0157369_10000003432 | 250 |
| 104 | 3300014325 | Ga0163163_10367189 | Ga0163163_103671892 | 250 |
| 105 | 3300025911 | Ga0207654_10419576 | Ga0207654_104195762 | 250 |
| 106 | 3300025912 | Ga0207707_10195388 | Ga0207707_101953883 | 250 |
| 107 | 3300025981 | Ga0207640_10004031 | Ga0207640_100040314 | 250 |
| 108 | 3300031507 | Ga0307509_10526551 | Ga0307509_105265511 | 250 |
| 109 | 3300048918 | Ga0496115_0000001 | Ga0496115_0000001_53244_54023 | 250 |
| 110 | 3300053087 | Ga0500643_008160 | Ga0500643_008160_880_1674 | 250 |
| 111 | 3300053093 | Ga0500651_0000001 | Ga0500651_0000001_453569_454363 | 250 |
| 112 | 3300053118 | Ga0500594_0000074 | Ga0500594_0000074_12311_13105 | 250 |
| 113 | 3300001990 | JGI24737J22298_10001714 | JGI24737J22298_100017148 | 251 |
| 114 | 3300002067 | JGI24735J21928_10000273 | JGI24735J21928_100002736 | 251 |
| 115 | 3300003316 | rootH1_10004333 | rootH1_1000433314 | 251 |
| 116 | 3300005327 | Ga0070658_10000024 | Ga0070658_1000002413 | 251 |
| 117 | 3300005366 | Ga0070659_100009496 | Ga0070659_1000094967 | 251 |
| 118 | 3300005577 | Ga0068857_100021166 | Ga0068857_1000211664 | 251 |
| 119 | 3300009098 | Ga0105245_10455559 | Ga0105245_104555592 | 251 |
| 120 | 3300009174 | Ga0105241_10335713 | Ga0105241_103357132 | 251 |
| 121 | 3300009551 | Ga0105238_10845543 | Ga0105238_108455431 | 251 |
| 122 | 3300009993 | Ga0105028_103593 | Ga0105028_1035932 | 251 |
| 123 | 3300010375 | Ga0105239_10000960 | Ga0105239_1000096045 | 251 |
| 124 | 3300011119 | Ga0105246_10000105 | Ga0105246_1000010514 | 251 |
| 125 | 3300011119 | Ga0105246_10003086 | Ga0105246_1000308611 | 251 |
| 126 | 3300011119 | Ga0105246_10006004 | Ga0105246_100060041 | 251 |
| 127 | 3300013100 | Ga0157373_10003921 | Ga0157373_100039213 | 251 |
| 128 | 3300013100 | Ga0157373_10047311 | Ga0157373_100473112 | 251 |
| 129 | 3300013100 | Ga0157373_10051013 | Ga0157373_100510132 | 251 |
| 130 | 3300013102 | Ga0157371_10018922 | Ga0157371_100189225 | 251 |
| 131 | 3300013104 | Ga0157370_10000520 | Ga0157370_1000052033 | 251 |
| 132 | 3300013105 | Ga0157369_10000075 | Ga0157369_10000075121 | 251 |
| 133 | 3300013105 | Ga0157369_10001459 | Ga0157369_1000145922 | 251 |
| 134 | 3300013296 | Ga0157374_10108965 | Ga0157374_101089652 | 251 |
| 135 | 3300013307 | Ga0157372_10781774 | Ga0157372_107817742 | 251 |
| 136 | 3300014745 | Ga0157377_10024118 | Ga0157377_100241183 | 251 |
| 137 | 3300014969 | Ga0157376_10000083 | Ga0157376_1000008313 | 251 |
| 138 | 3300014969 | Ga0157376_10005017 | Ga0157376_100050176 | 251 |
| 139 | 3300026116 | Ga0207674_10035638 | Ga0207674_100356384 | 251 |
| 140 | 3300030745 | Ga0316182_1189930 | Ga0316182_11899303 | 251 |
| 141 | 3300037312 | Ga0395899_0035713 | Ga0395899_0035713_910_1698 | 251 |
| 142 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_356885_357673 | 251 |
| 143 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_748333_749121 | 251 |
| 144 | 3300038443 | Ga0395901_0000006 | Ga0395901_0000006_394009_394797 | 251 |
| 145 | 3300038443 | Ga0395901_0169727 | Ga0395901_0169727_102_890 | 251 |
| 146 | 3300042016 | Ga0439463_002277 | Ga0439463_002277_136_924 | 251 |
| 147 | 3300042115 | Ga0450911_005580 | Ga0450911_005580_16_789 | 251 |
| 148 | 3300042122 | Ga0450920_001300 | Ga0450920_001300_2706_3479 | 251 |
| 149 | 3300042145 | Ga0450906_008859 | Ga0450906_008859_763_1536 | 251 |
| 150 | 3300042185 | Ga0450909_002108 | Ga0450909_002108_947_1720 | 251 |
| 151 | 3300042439 | Ga0439464_0000107 | Ga0439464_0000107_7597_8385 | 251 |
| 152 | 3300046810 | Ga0495660_0006871 | Ga0495660_0006871_3758_4534 | 251 |
| 153 | 3300048916 | Ga0496113_0184494 | Ga0496113_0184494_57_845 | 251 |
| 154 | 3300050491 | nmdc:mga00v17_34317_c1 | nmdc:mga00v17_34317_c1_818_1606 | 251 |
| 155 | 3300050496 | nmdc:mga07m45_1081_c1 | nmdc:mga07m45_1081_c1_4215_5003 | 251 |
| 156 | 3300053087 | Ga0500643_029783 | Ga0500643_029783_522_1295 | 251 |
| 157 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_7704_8480 | 251 |
| 158 | 3300053133 | Ga0500655_001065 | Ga0500655_001065_1115_1891 | 251 |
| 159 | 3300053724 | Ga0500570_000030 | Ga0500570_000030_2247_3020 | 251 |
| 160 | 3300006038 | Ga0075365_10000008 | Ga0075365_1000000860 | 252 |
| 161 | 3300006353 | Ga0075370_10090220 | Ga0075370_100902202 | 252 |
| 162 | 3300009979 | Ga0105032_100001 | Ga0105032_100001451 | 252 |
| 163 | 3300026035 | Ga0207703_10670426 | Ga0207703_106704262 | 252 |
| 164 | 3300031901 | Ga0307406_10000145 | Ga0307406_1000014513 | 252 |
| 165 | 3300050492 | nmdc:mga0yw44_1_c1 | nmdc:mga0yw44_1_c1_58468_59244 | 252 |
| 166 | 3300050496 | nmdc:mga07m45_133407_c1 | nmdc:mga07m45_133407_c1_190_969 | 252 |
| 167 | 3300053103 | Ga0500555_000009 | Ga0500555_000009_137944_138720 | 252 |
| 168 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_279712_280491 | 252 |
| 169 | 2162886012 | MBSR1b_contig_2473327 | MBSR1b_0338.00007020 | 253 |
| 170 | 3300003320 | rootH2_10000763 | rootH2_1000076342 | 253 |
| 171 | 3300003323 | rootH1_10057122 | rootH1_100571223 | 253 |
| 172 | 3300003911 | JGI25405J52794_10052892 | JGI25405J52794_100528921 | 253 |
| 173 | 3300005293 | Ga0065715_10098299 | Ga0065715_100982993 | 253 |
| 174 | 3300005339 | Ga0070660_100007740 | Ga0070660_1000077402 | 253 |
| 175 | 3300005563 | Ga0068855_100000002 | Ga0068855_100000002361 | 253 |
| 176 | 3300005563 | Ga0068855_100000005 | Ga0068855_100000005331 | 253 |
| 177 | 3300005577 | Ga0068857_100001409 | Ga0068857_10000140910 | 253 |
| 178 | 3300005614 | Ga0068856_100221350 | Ga0068856_1002213502 | 253 |
| 179 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001384 | 253 |
| 180 | 3300005937 | Ga0081455_10000001 | Ga0081455_10000001420 | 253 |
| 181 | 3300006038 | Ga0075365_10000041 | Ga0075365_1000004115 | 253 |
| 182 | 3300006038 | Ga0075365_10005405 | Ga0075365_100054052 | 253 |
| 183 | 3300006042 | Ga0075368_10000954 | Ga0075368_100009544 | 253 |
| 184 | 3300006048 | Ga0075363_100003988 | Ga0075363_1000039882 | 253 |
| 185 | 3300006051 | Ga0075364_10009874 | Ga0075364_100098742 | 253 |
| 186 | 3300006177 | Ga0075362_10048576 | Ga0075362_100485762 | 253 |
| 187 | 3300006186 | Ga0075369_10024083 | Ga0075369_100240832 | 253 |
| 188 | 3300006195 | Ga0075366_10039072 | Ga0075366_100390722 | 253 |
| 189 | 3300006353 | Ga0075370_10003143 | Ga0075370_100031433 | 253 |
| 190 | 3300006844 | Ga0075428_100002220 | Ga0075428_10000222019 | 253 |
| 191 | 3300009093 | Ga0105240_10000004 | Ga0105240_1000000428 | 253 |
| 192 | 3300009093 | Ga0105240_10001037 | Ga0105240_1000103736 | 253 |
| 193 | 3300009093 | Ga0105240_10029617 | Ga0105240_100296172 | 253 |
| 194 | 3300009545 | Ga0105237_10000001 | Ga0105237_10000001404 | 253 |
| 195 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002280 | 253 |
| 196 | 3300009551 | Ga0105238_10001532 | Ga0105238_1000153221 | 253 |
| 197 | 3300009551 | Ga0105238_10370444 | Ga0105238_103704442 | 253 |
| 198 | 3300009551 | Ga0105238_11058290 | Ga0105238_110582901 | 253 |
| 199 | 3300009979 | Ga0105032_100025 | Ga0105032_10002533 | 253 |
| 200 | 3300013102 | Ga0157371_10016146 | Ga0157371_100161465 | 253 |
| 201 | 3300013104 | Ga0157370_10000168 | Ga0157370_1000016874 | 253 |
| 202 | 3300013105 | Ga0157369_10000055 | Ga0157369_100000552 | 253 |
| 203 | 3300013105 | Ga0157369_10006246 | Ga0157369_100062467 | 253 |
| 204 | 3300013307 | Ga0157372_10000002 | Ga0157372_100000026 | 253 |
| 205 | 3300013307 | Ga0157372_10000106 | Ga0157372_10000106102 | 253 |
| 206 | 3300013307 | Ga0157372_10022887 | Ga0157372_100228872 | 253 |
| 207 | 3300025913 | Ga0207695_10000009 | Ga0207695_10000009407 | 253 |
| 208 | 3300025913 | Ga0207695_10002087 | Ga0207695_1000208719 | 253 |
| 209 | 3300025913 | Ga0207695_10003753 | Ga0207695_1000375314 | 253 |
| 210 | 3300025914 | Ga0207671_10000003 | Ga0207671_10000003407 | 253 |
| 211 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008383 | 253 |
| 212 | 3300025919 | Ga0207657_10015093 | Ga0207657_100150937 | 253 |
| 213 | 3300025924 | Ga0207694_10099787 | Ga0207694_100997872 | 253 |
| 214 | 3300025924 | Ga0207694_10302242 | Ga0207694_103022421 | 253 |
| 215 | 3300025949 | Ga0207667_10000005 | Ga0207667_10000005471 | 253 |
| 216 | 3300025949 | Ga0207667_10000027 | Ga0207667_10000027327 | 253 |
| 217 | 3300026078 | Ga0207702_10052584 | Ga0207702_100525843 | 253 |
| 218 | 3300026116 | Ga0207674_10001826 | Ga0207674_1000182614 | 253 |
| 219 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001336 | 253 |
| 220 | 3300027866 | Ga0209813_10000251 | Ga0209813_100002515 | 253 |
| 221 | 3300030732 | Ga0316176_1093916 | Ga0316176_10939161 | 253 |
| 222 | 3300030733 | Ga0314311_1082504 | Ga0314311_10825042 | 253 |
| 223 | 3300030734 | Ga0316179_1011384 | Ga0316179_10113842 | 253 |
| 224 | 3300030735 | Ga0316178_1135305 | Ga0316178_11353053 | 253 |
| 225 | 3300030736 | Ga0316180_1159006 | Ga0316180_11590065 | 253 |
| 226 | 3300030742 | Ga0316183_1005382 | Ga0316183_100538218 | 253 |
| 227 | 3300030742 | Ga0316183_1009146 | Ga0316183_100914615 | 253 |
| 228 | 3300030742 | Ga0316183_1024096 | Ga0316183_10240962 | 253 |
| 229 | 3300030742 | Ga0316183_1077166 | Ga0316183_10771666 | 253 |
| 230 | 3300030744 | Ga0316181_1020431 | Ga0316181_102043140 | 253 |
| 231 | 3300030745 | Ga0316182_1003092 | Ga0316182_100309229 | 253 |
| 232 | 3300030745 | Ga0316182_1241226 | Ga0316182_12412262 | 253 |
| 233 | 3300031730 | Ga0307516_10011743 | Ga0307516_100117438 | 253 |
| 234 | 3300031901 | Ga0307406_10000001 | Ga0307406_10000001291 | 253 |
| 235 | 3300038443 | Ga0395901_0006434 | Ga0395901_0006434_8058_8846 | 253 |
| 236 | 3300041407 | Ga0439447_011690 | Ga0439447_011690_1172_1957 | 253 |
| 237 | 3300041410 | Ga0439461_0000308 | Ga0439461_0000308_2452_3237 | 253 |
| 238 | 3300041411 | Ga0439466_0002776 | Ga0439466_0002776_1308_2093 | 253 |
| 239 | 3300041413 | Ga0439465_0028210 | Ga0439465_0028210_732_1517 | 253 |
| 240 | 3300042002 | Ga0439442_002748 | Ga0439442_002748_1227_2012 | 253 |
| 241 | 3300042006 | Ga0439432_000742 | Ga0439432_000742_1231_2010 | 253 |
| 242 | 3300042010 | Ga0439452_040045 | Ga0439452_040045_216_1001 | 253 |
| 243 | 3300042156 | Ga0439446_0000003 | Ga0439446_0000003_74997_75779 | 253 |
| 244 | 3300042156 | Ga0439446_0000236 | Ga0439446_0000236_8773_9558 | 253 |
| 245 | 3300042435 | Ga0439434_0004989 | Ga0439434_0004989_128_913 | 253 |
| 246 | 3300045051 | Ga0451576_0011194 | Ga0451576_0011194_7351_8148 | 253 |
| 247 | 3300046460 | Ga0495638_0000061 | Ga0495638_0000061_162532_163314 | 253 |
| 248 | 3300046810 | Ga0495660_0000005 | Ga0495660_0000005_248776_249558 | 253 |
| 249 | 3300049571 | Ga0501034_0000028 | Ga0501034_0000028_103597_104379 | 253 |
| 250 | 3300049573 | Ga0501037_0000001 | Ga0501037_0000001_93381_94163 | 253 |
| 251 | 3300049574 | Ga0501038_0012245 | Ga0501038_0012245_2758_3540 | 253 |
| 252 | 3300050491 | nmdc:mga00v17_361_c1 | nmdc:mga00v17_361_c1_3848_4630 | 253 |
| 253 | 3300050492 | nmdc:mga0yw44_17_c1 | nmdc:mga0yw44_17_c1_31065_31847 | 253 |
| 254 | 3300050492 | nmdc:mga0yw44_4_c1 | nmdc:mga0yw44_4_c1_204854_205636 | 253 |
| 255 | 3300050493 | nmdc:mga0k408_71125_c1 | nmdc:mga0k408_71125_c1_170_952 | 253 |
| 256 | 3300050494 | nmdc:mga06z11_196_c1 | nmdc:mga06z11_196_c1_12071_12853 | 253 |
| 257 | 3300053090 | Ga0500646_0000075 | Ga0500646_0000075_9042_9824 | 253 |
| 258 | 3300053090 | Ga0500646_0043804 | Ga0500646_0043804_124_906 | 253 |
| 259 | 3300053092 | Ga0500583_0000347 | Ga0500583_0000347_9392_10174 | 253 |
| 260 | 3300053092 | Ga0500583_0002751 | Ga0500583_0002751_45_827 | 253 |
| 261 | 3300053096 | Ga0500641_0000001 | Ga0500641_0000001_1075481_1076263 | 253 |
| 262 | 3300053109 | Ga0500569_000014 | Ga0500569_000014_25238_26020 | 253 |
| 263 | 3300053131 | Ga0500652_000001 | Ga0500652_000001_402138_402920 | 253 |
| 264 | 3300053133 | Ga0500655_000528 | Ga0500655_000528_6313_7092 | 253 |
| 265 | 3300053142 | Ga0500577_0004798 | Ga0500577_0004798_688_1473 | 253 |
| 266 | 3300053146 | Ga0500588_0000029 | Ga0500588_0000029_11938_12720 | 253 |
| 267 | 3300053727 | Ga0500611_013472 | Ga0500611_013472_433_1233 | 253 |
| 268 | 3300053738 | Ga0500613_000043 | Ga0500613_000043_562_1344 | 253 |
| 269 | 3300059426 | Ga0590077_031226 | Ga0590077_031226_326_1108 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b9b-assembly1.cif.gz_B | triosephosphate isomerase of thermotoga maritima | 0.9657 | 5 | 244 |
| 1btm-assembly1.cif.gz_B | triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid | 0.9609 | 5 | 245 |
| 2btm-assembly1.cif.gz_B | does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? | 0.9598 | 5 | 245 |
| 3uww-assembly1.cif.gz_B | crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid | 0.9567 | 5 | 244 |
| 4bi6-assembly1.cif.gz_A-2 | crystal structure of a triple mutant (a198v, c202a and c222n) of triosephosphate isomerase from giardia lamblia. complexed with 2- phosphoglycolic acid | 0.9554 | 5 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y96A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9538 | 5 | 245 | 3.20.20.70 |
| 3taoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9496 | 5 | 246 | 3.20.20.70 |
| 2yc8C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9432 | 5 | 245 | 3.20.20.70 |
| 4x22A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.943 | 5 | 241 | 3.20.20.70 |
| 1m6jA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9386 | 5 | 245 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W4E7E2-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9872 | 5 | 248 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A2G6HKU2-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9797 | 5 | 252 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7T9ISC5-F1-model_v4 | deleted | 0.9797 | 14 | 252 |
|
| AF-A0A0G1XFE5-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9793 | 91 | 250 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7T9FEW1-F1-model_v4 | deleted | 0.9792 | 5 | 247 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar