F375928

General Info

Members Datasets Scaffolds Average Seq Length
269 169 269 255

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10057122|rootH1_100571223
Length 271
Sequence VRYTRAKKHKQIMMRDKKLIVGNWKMNLNTHEASLYLHKLAGMVPVHRDVTVVLAPTLLALQSLSLQIDRRQFKLAVQNLYWRDHGAFTGEVSAAQLHGVADYAIIGHSERRHIFNETDKDIRSKVQAALRSHIHPILCIGETAGERADGETQDVLHDQLVGGLANVTSEELEDVTIAYEPVWAIGTGDNAMPDDVKAAVMTIRNQIKHLYGAEISKKVAVLYGGSVKADSAASYLAIDGIDGLLVGGASLDAHEFTEIVTRAHTHVEKGK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
55 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
101 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
102 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
103 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
104 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
105 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
125 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
126 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
161 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
167 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
168 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.07
Nodule 0
Rhizoplane 1.49
Rhizosphere 75.09
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2473327 2162886012 Bacteria 1303
2 JGI24740J21852_10015060 3300001979 Bacteria 2833
3 JGI24740J21852_10052926 3300001979 Bacteria 1154
4 JGI24737J22298_10001714 3300001990 Bacteria 7820
5 JGI24743J22301_10025899 3300001991 Bacteria 1139
6 JGI24735J21928_10000273 3300002067 Bacteria 18115
7 JGI24738J21930_10004171 3300002075 Bacteria 3564
8 rootH1_10004333 3300003316 Bacteria 78263
9 rootH2_10000763 3300003320 Bacteria 99150
10 rootL2_10312222 3300003322 Bacteria 1164
11 rootH1_10057122 3300003323 Bacteria 15426
12 Ga0055530_10006145 3300003791 Bacteria 5452
13 JGI25405J52794_10052892 3300003911 Bacteria 872
14 Ga0065714_10147339 3300005288 Bacteria 1129
15 Ga0065715_10098299 3300005293 Bacteria 3568
16 Ga0070658_10000024 3300005327 Bacteria 175873
17 Ga0070658_10376492 3300005327 Bacteria 1217
18 Ga0070683_100320240 3300005329 Unclassified 1476
19 Ga0068869_100169804 3300005334 Bacteria 1703
20 Ga0068869_100298937 3300005334 Bacteria 1299
21 Ga0070680_100399679 3300005336 Bacteria 1171
22 Ga0070660_100007740 3300005339 Bacteria 7492
23 Ga0070660_100051313 3300005339 Bacteria 3176
24 Ga0070660_100169579 3300005339 Bacteria 1762
25 Ga0070661_100151447 3300005344 Bacteria 1753
26 Ga0070675_100526217 3300005354 Bacteria 1067
27 Ga0070675_100668175 3300005354 Bacteria 945
28 Ga0070671_100223738 3300005355 Bacteria 1596
29 Ga0070673_100432110 3300005364 Bacteria 1182
30 Ga0070659_100009496 3300005366 Bacteria 7147
31 Ga0070678_100034914 3300005456 Bacteria 3506
32 Ga0070662_100057255 3300005457 Bacteria 2832
33 Ga0070662_100277323 3300005457 Bacteria 1356
34 Ga0070681_10048052 3300005458 Bacteria 4265
35 Ga0070681_10075027 3300005458 Bacteria 3342
36 Ga0068867_100210710 3300005459 Bacteria 1560
37 Ga0068855_100000002 3300005563 Bacteria 616881
38 Ga0068855_100000005 3300005563 Bacteria 337711
39 Ga0068855_100000990 3300005563 Bacteria 35322
40 Ga0070664_100000517 3300005564 Bacteria 29256
41 Ga0070664_100664840 3300005564 Bacteria 969
42 Ga0068857_100000331 3300005577 Bacteria 32594
43 Ga0068857_100001409 3300005577 Bacteria 19000
44 Ga0068857_100021166 3300005577 Bacteria 5723
45 Ga0068856_100000027 3300005614 Bacteria 133290
46 Ga0068856_100000029 3300005614 Bacteria 130205
47 Ga0068856_100221350 3300005614 Bacteria 1908
48 Ga0068852_100000001 3300005616 Bacteria 716526
49 Ga0068852_100000531 3300005616 Bacteria 25057
50 Ga0068852_100125222 3300005616 Bacteria 2359
51 Ga0068863_100486745 3300005841 Bacteria 1214
52 Ga0068862_100240510 3300005844 Bacteria 1646
53 Ga0081455_10000001 3300005937 Bacteria 603871
54 Ga0075365_10000008 3300006038 Bacteria 114620
55 Ga0075365_10000041 3300006038 Bacteria 43185
56 Ga0075365_10005405 3300006038 Bacteria 6883
57 Ga0075368_10000954 3300006042 Bacteria 8997
58 Ga0075363_100003988 3300006048 Bacteria 6385
59 Ga0075364_10009874 3300006051 Bacteria 5743
60 Ga0075364_10092837 3300006051 Bacteria 2004
61 Ga0075362_10048576 3300006177 Bacteria 1893
62 Ga0075369_10024083 3300006186 Bacteria 2520
63 Ga0075366_10020155 3300006195 Bacteria 3865
64 Ga0075366_10039072 3300006195 Bacteria 2804
65 Ga0075370_10003143 3300006353 Bacteria 7797
66 Ga0075370_10006633 3300006353 Bacteria 5836
67 Ga0075370_10090220 3300006353 Bacteria 1768
68 Ga0068871_100013864 3300006358 Bacteria 5993
69 Ga0068871_100077262 3300006358 Bacteria 2751
70 Ga0075428_100002220 3300006844 Bacteria 21042
71 Ga0068865_100016589 3300006881 Bacteria 4717
72 Ga0068865_100190751 3300006881 Bacteria 1585
73 Ga0105240_10000004 3300009093 Bacteria 708156
74 Ga0105240_10001037 3300009093 Bacteria 49391
75 Ga0105240_10029617 3300009093 Bacteria 7127
76 Ga0105245_10455559 3300009098 Bacteria 1288
77 Ga0105245_10794900 3300009098 Bacteria 984
78 Ga0105241_10087287 3300009174 Bacteria 2455
79 Ga0105241_10335713 3300009174 Bacteria 1308
80 Ga0105242_10030902 3300009176 Bacteria 4277
81 Ga0105237_10000001 3300009545 Bacteria 1009213
82 Ga0105237_10000002 3300009545 Bacteria 702357
83 Ga0105238_10001532 3300009551 Bacteria 23175
84 Ga0105238_10370444 3300009551 Bacteria 1423
85 Ga0105238_10845543 3300009551 Bacteria 932
86 Ga0105238_11058290 3300009551 Bacteria 833
87 Ga0105032_100001 3300009979 Bacteria 472394
88 Ga0105032_100025 3300009979 Bacteria 33986
89 Ga0105032_104339 3300009979 Unclassified 1213
90 Ga0105028_100344 3300009993 Unclassified 4973
91 Ga0105028_103593 3300009993 Bacteria 1619
92 Ga0105239_10000960 3300010375 Bacteria 40541
93 Ga0105239_10091434 3300010375 Bacteria 3358
94 Ga0105246_10000105 3300011119 Bacteria 36849
95 Ga0105246_10003086 3300011119 Bacteria 10110
96 Ga0105246_10006004 3300011119 Bacteria 7415
97 Ga0157373_10001588 3300013100 Bacteria 17357
98 Ga0157373_10003921 3300013100 Bacteria 11232
99 Ga0157373_10047311 3300013100 Bacteria 3068
100 Ga0157373_10051013 3300013100 Bacteria 2946
101 Ga0157371_10009138 3300013102 Bacteria 7829
102 Ga0157371_10016146 3300013102 Bacteria 5581
103 Ga0157371_10018922 3300013102 Bacteria 5085
104 Ga0157370_10000168 3300013104 Bacteria 80700
105 Ga0157370_10000403 3300013104 Bacteria 54542
106 Ga0157370_10000520 3300013104 Bacteria 48163
107 Ga0157369_10000003 3300013105 Bacteria 507337
108 Ga0157369_10000055 3300013105 Bacteria 161739
109 Ga0157369_10000075 3300013105 Bacteria 136520
110 Ga0157369_10001459 3300013105 Bacteria 28989
111 Ga0157369_10006246 3300013105 Bacteria 13824
112 Ga0157369_10137480 3300013105 Bacteria 2586
113 Ga0157374_10108965 3300013296 Bacteria 2662
114 Ga0163162_10515277 3300013306 Bacteria 1326
115 Ga0157372_10000002 3300013307 Bacteria 687862
116 Ga0157372_10000106 3300013307 Bacteria 87935
117 Ga0157372_10022887 3300013307 Bacteria 6767
118 Ga0157372_10781774 3300013307 Bacteria 1109
119 Ga0163163_10367189 3300014325 Bacteria 1496
120 Ga0163163_10383541 3300014325 Bacteria 1463
121 Ga0157377_10024118 3300014745 Bacteria 3231
122 Ga0157376_10000083 3300014969 Bacteria 71608
123 Ga0157376_10005017 3300014969 Bacteria 9235
124 Ga0163161_10062268 3300017792 Bacteria 2717
125 Ga0209050_1001888 3300025298 Bacteria 20105
126 Ga0209257_1000122 3300025304 Bacteria 219678
127 Ga0207705_10000047 3300025909 Bacteria 175887
128 Ga0207654_10210274 3300025911 Bacteria 1285
129 Ga0207654_10223891 3300025911 Bacteria 1249
130 Ga0207654_10419576 3300025911 Bacteria 933
131 Ga0207707_10195388 3300025912 Bacteria 1765
132 Ga0207695_10000009 3300025913 Bacteria 1034276
133 Ga0207695_10002087 3300025913 Bacteria 30417
134 Ga0207695_10003753 3300025913 Bacteria 21111
135 Ga0207671_10000003 3300025914 Bacteria 1065461
136 Ga0207671_10000008 3300025914 Bacteria 798229
137 Ga0207657_10000125 3300025919 Bacteria 76937
138 Ga0207657_10015093 3300025919 Bacteria 7503
139 Ga0207649_10016002 3300025920 Bacteria 4222
140 Ga0207694_10099787 3300025924 Unclassified 2300
141 Ga0207694_10302242 3300025924 Bacteria 1318
142 Ga0207659_10276539 3300025926 Bacteria 1371
143 Ga0207644_10030406 3300025931 Bacteria 3756
144 Ga0207690_10029932 3300025932 Bacteria 3466
145 Ga0207706_10000090 3300025933 Bacteria 93774
146 Ga0207706_10221178 3300025933 Bacteria 1658
147 Ga0207686_10047333 3300025934 Bacteria 2658
148 Ga0207704_10460173 3300025938 Bacteria 1017
149 Ga0207691_10360530 3300025940 Bacteria 1243
150 Ga0207679_10000186 3300025945 Bacteria 50492
151 Ga0207667_10000005 3300025949 Bacteria 715503
152 Ga0207667_10000027 3300025949 Bacteria 337700
153 Ga0207712_10100558 3300025961 Bacteria 2148
154 Ga0207668_10270530 3300025972 Bacteria 1389
155 Ga0207640_10004031 3300025981 Bacteria 7934
156 Ga0207703_10670426 3300026035 Bacteria 985
157 Ga0207702_10000213 3300026078 Bacteria 68574
158 Ga0207702_10000549 3300026078 Bacteria 41892
159 Ga0207702_10052584 3300026078 Bacteria 3447
160 Ga0207641_10148598 3300026088 Bacteria 2121
161 Ga0207674_10001624 3300026116 Bacteria 28924
162 Ga0207674_10001826 3300026116 Bacteria 27174
163 Ga0207674_10035638 3300026116 Bacteria 5193
164 Ga0207683_10054321 3300026121 Bacteria 3513
165 Ga0207698_10000001 3300026142 Bacteria 625389
166 Ga0207698_10000589 3300026142 Bacteria 21170
167 Ga0209813_10000251 3300027866 Bacteria 15589
168 Ga0316176_1093916 3300030732 Bacteria 908
169 Ga0314311_1082504 3300030733 Bacteria 5267
170 Ga0316179_1011384 3300030734 Bacteria 9267
171 Ga0316178_1135305 3300030735 Unclassified 2528
172 Ga0316180_1159006 3300030736 Bacteria 9125
173 Ga0316183_1005382 3300030742 Bacteria 21667
174 Ga0316183_1009146 3300030742 Bacteria 14177
175 Ga0316183_1024096 3300030742 Bacteria 2209
176 Ga0316183_1077166 3300030742 Bacteria 7218
177 Ga0316183_1150083 3300030742 Bacteria 932
178 Ga0316181_1020431 3300030744 Bacteria 46502
179 Ga0316182_1003092 3300030745 Bacteria 41807
180 Ga0316182_1189930 3300030745 Bacteria 4836
181 Ga0316182_1241226 3300030745 Bacteria 6325
182 Ga0316182_1363842 3300030745 Bacteria 3156
183 Ga0307509_10526551 3300031507 Bacteria 863
184 Ga0307516_10011743 3300031730 Bacteria 9503
185 Ga0307406_10000001 3300031901 Bacteria 638191
186 Ga0307406_10000145 3300031901 Bacteria 42161
187 Ga0307412_10014913 3300031911 Unclassified 4595
188 Ga0373937_0340288 3300036401 Bacteria 1421
189 Ga0395899_0035713 3300037312 Bacteria 3730
190 Ga0395899_0139686 3300037312 Unclassified 1724
191 Ga0395900_0000001 3300037418 Bacteria 931146
192 Ga0395900_0234702 3300037418 Bacteria 1843
193 Ga0395898_0000002 3300037466 Bacteria 931013
194 Ga0395901_0000006 3300038443 Bacteria 514112
195 Ga0395901_0006434 3300038443 Bacteria 11902
196 Ga0395901_0169727 3300038443 Bacteria 2289
197 Ga0439447_011690 3300041407 Unclassified 2549
198 Ga0439461_0000308 3300041410 Bacteria 6878
199 Ga0439461_0001694 3300041410 Bacteria 3436
200 Ga0439466_0002776 3300041411 Bacteria 6854
201 Ga0439465_0028210 3300041413 Bacteria 1779
202 Ga0439442_002748 3300042002 Bacteria 3456
203 Ga0439432_000742 3300042006 Bacteria 12201
204 Ga0439452_040045 3300042010 Bacteria 1107
205 Ga0439463_002277 3300042016 Bacteria 4920
206 Ga0450911_005580 3300042115 Bacteria 1935
207 Ga0450920_001300 3300042122 Bacteria 4108
208 Ga0450903_014712 3300042138 Bacteria 1237
209 Ga0450906_008859 3300042145 Bacteria 1933
210 Ga0439446_0000003 3300042156 Bacteria 158513
211 Ga0439446_0000236 3300042156 Bacteria 10208
212 Ga0450909_002108 3300042185 Bacteria 2808
213 Ga0439434_0004989 3300042435 Bacteria 3879
214 Ga0439464_0000107 3300042439 Bacteria 12650
215 Ga0466965_0000133 3300044683 Bacteria 21106
216 Ga0451576_0011194 3300045051 Bacteria 10221
217 Ga0495638_0000061 3300046460 Bacteria 188551
218 Ga0495606_0023320 3300046507 Bacteria 4487
219 Ga0495660_0000005 3300046810 Bacteria 574567
220 Ga0495660_0006871 3300046810 Bacteria 6703
221 Ga0496100_0056442 3300048903 Unclassified 2569
222 Ga0496113_0083234 3300048916 Bacteria 2455
223 Ga0496113_0184494 3300048916 Bacteria 1654
224 Ga0496115_0000001 3300048918 Bacteria 367230
225 Ga0496122_0074586 3300048925 Bacteria 2399
226 Ga0496123_0028497 3300048926 Bacteria 4133
227 Ga0496126_0092526 3300048929 Bacteria 2657
228 Ga0501034_0000028 3300049571 Bacteria 255803
229 Ga0501034_0001632 3300049571 Bacteria 29045
230 Ga0501037_0000001 3300049573 Bacteria 753276
231 Ga0501038_0010262 3300049574 Bacteria 8569
232 Ga0501038_0012245 3300049574 Bacteria 7833
233 nmdc:mga00v17_34317_c1 3300050491 Bacteria 3012
234 nmdc:mga00v17_361_c1 3300050491 Bacteria 25741
235 nmdc:mga0yw44_17_c1 3300050492 Bacteria 74504
236 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
237 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
238 nmdc:mga0yw44_90727_c1 3300050492 Bacteria 1931
239 nmdc:mga0k408_164671_c1 3300050493 Bacteria 1321
240 nmdc:mga0k408_21557_c1 3300050493 Bacteria 3620
241 nmdc:mga0k408_71125_c1 3300050493 Bacteria 1258
242 nmdc:mga06z11_196_c1 3300050494 Bacteria 24317
243 nmdc:mga07m45_1081_c1 3300050496 Bacteria 12139
244 nmdc:mga07m45_133407_c1 3300050496 Bacteria 1437
245 Ga0500643_008160 3300053087 Bacteria 4142
246 Ga0500643_029783 3300053087 Bacteria 1676
247 Ga0500646_0000075 3300053090 Bacteria 28149
248 Ga0500646_0043804 3300053090 Bacteria 1268
249 Ga0500583_0000347 3300053092 Bacteria 15434
250 Ga0500583_0002751 3300053092 Bacteria 5368
251 Ga0500651_0000001 3300053093 Bacteria 529808
252 Ga0500641_0000001 3300053096 Bacteria 1115973
253 Ga0500555_000009 3300053103 Bacteria 263998
254 Ga0500562_000001 3300053108 Bacteria 1178987
255 Ga0500569_000014 3300053109 Bacteria 50618
256 Ga0500593_056741 3300053117 Bacteria 1728
257 Ga0500594_0000074 3300053118 Bacteria 31465
258 Ga0500652_000001 3300053131 Bacteria 946868
259 Ga0500655_000528 3300053133 Bacteria 7700
260 Ga0500655_001065 3300053133 Bacteria 5272
261 Ga0500573_0185496 3300053140 Bacteria 1115
262 Ga0500577_0004798 3300053142 Bacteria 3597
263 Ga0500588_0000029 3300053146 Bacteria 32025
264 Ga0500616_0000012 3300053153 Bacteria 681798
265 Ga0500616_0013347 3300053153 Bacteria 4774
266 Ga0500570_000030 3300053724 Bacteria 35041
267 Ga0500611_013472 3300053727 Bacteria 1404
268 Ga0500613_000043 3300053738 Bacteria 5986
269 Ga0590077_031226 3300059426 Bacteria 1164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_164671_c1 nmdc:mga0k408_164671_c1_14_676 213
2 3300030742 Ga0316183_1150083 Ga0316183_11500831 223
3 3300030745 Ga0316182_1363842 Ga0316182_13638423 223
4 3300048916 Ga0496113_0083234 Ga0496113_0083234_206_901 224
5 3300001979 JGI24740J21852_10052926 JGI24740J21852_100529262 229
6 3300001991 JGI24743J22301_10025899 JGI24743J22301_100258992 229
7 3300002075 JGI24738J21930_10004171 JGI24738J21930_100041712 229
8 3300005334 Ga0068869_100169804 Ga0068869_1001698041 229
9 3300005339 Ga0070660_100051313 Ga0070660_1000513132 229
10 3300005344 Ga0070661_100151447 Ga0070661_1001514472 229
11 3300005354 Ga0070675_100526217 Ga0070675_1005262171 229
12 3300005457 Ga0070662_100057255 Ga0070662_1000572552 229
13 3300042138 Ga0450903_014712 Ga0450903_014712_102_884 230
14 3300049571 Ga0501034_0001632 Ga0501034_0001632_23093_23875 232
15 3300044683 Ga0466965_0000133 Ga0466965_0000133_4677_5456 233
16 3300050492 nmdc:mga0yw44_90727_c1 nmdc:mga0yw44_90727_c1_1116_1898 233
17 3300003322 rootL2_10312222 rootL2_103122222 236
18 3300005334 Ga0068869_100298937 Ga0068869_1002989372 237
19 3300005354 Ga0070675_100668175 Ga0070675_1006681751 237
20 3300005355 Ga0070671_100223738 Ga0070671_1002237382 237
21 3300005364 Ga0070673_100432110 Ga0070673_1004321102 237
22 3300005456 Ga0070678_100034914 Ga0070678_1000349143 237
23 3300005457 Ga0070662_100277323 Ga0070662_1002773232 237
24 3300005459 Ga0068867_100210710 Ga0068867_1002107101 237
25 3300005616 Ga0068852_100125222 Ga0068852_1001252222 237
26 3300005841 Ga0068863_100486745 Ga0068863_1004867451 237
27 3300005844 Ga0068862_100240510 Ga0068862_1002405101 237
28 3300006358 Ga0068871_100077262 Ga0068871_1000772626 237
29 3300006881 Ga0068865_100190751 Ga0068865_1001907512 237
30 3300009176 Ga0105242_10030902 Ga0105242_100309022 237
31 3300010375 Ga0105239_10091434 Ga0105239_100914344 237
32 3300013306 Ga0163162_10515277 Ga0163162_105152772 237
33 3300014325 Ga0163163_10383541 Ga0163163_103835412 237
34 3300025926 Ga0207659_10276539 Ga0207659_102765392 237
35 3300025931 Ga0207644_10030406 Ga0207644_100304062 237
36 3300025933 Ga0207706_10221178 Ga0207706_102211782 237
37 3300025934 Ga0207686_10047333 Ga0207686_100473331 237
38 3300025938 Ga0207704_10460173 Ga0207704_104601732 237
39 3300025940 Ga0207691_10360530 Ga0207691_103605301 237
40 3300025961 Ga0207712_10100558 Ga0207712_101005584 237
41 3300025972 Ga0207668_10270530 Ga0207668_102705302 237
42 3300026088 Ga0207641_10148598 Ga0207641_101485984 237
43 3300026121 Ga0207683_10054321 Ga0207683_100543213 237
44 3300036401 Ga0373937_0340288 Ga0373937_0340288_265_999 237
45 3300053117 Ga0500593_056741 Ga0500593_056741_787_1530 237
46 3300005577 Ga0068857_100000331 Ga0068857_10000033119 239
47 3300025911 Ga0207654_10210274 Ga0207654_102102742 239
48 3300026116 Ga0207674_10001624 Ga0207674_1000162425 239
49 3300001979 JGI24740J21852_10015060 JGI24740J21852_100150603 240
50 3300005564 Ga0070664_100000517 Ga0070664_10000051716 240
51 3300005564 Ga0070664_100664840 Ga0070664_1006648401 240
52 3300005614 Ga0068856_100000027 Ga0068856_100000027143 240
53 3300005614 Ga0068856_100000029 Ga0068856_10000002945 240
54 3300005616 Ga0068852_100000531 Ga0068852_10000053111 240
55 3300006051 Ga0075364_10092837 Ga0075364_100928372 240
56 3300006353 Ga0075370_10006633 Ga0075370_100066334 240
57 3300006358 Ga0068871_100013864 Ga0068871_1000138644 240
58 3300006881 Ga0068865_100016589 Ga0068865_1000165894 240
59 3300025909 Ga0207705_10000047 Ga0207705_10000047198 240
60 3300025911 Ga0207654_10223891 Ga0207654_102238912 240
61 3300025919 Ga0207657_10000125 Ga0207657_1000012581 240
62 3300025920 Ga0207649_10016002 Ga0207649_100160023 240
63 3300025932 Ga0207690_10029932 Ga0207690_100299322 240
64 3300025933 Ga0207706_10000090 Ga0207706_1000009014 240
65 3300025945 Ga0207679_10000186 Ga0207679_1000018613 240
66 3300026078 Ga0207702_10000213 Ga0207702_1000021368 240
67 3300026078 Ga0207702_10000549 Ga0207702_1000054928 240
68 3300026142 Ga0207698_10000589 Ga0207698_1000058915 240
69 3300031911 Ga0307412_10014913 Ga0307412_100149132 240
70 3300006195 Ga0075366_10020155 Ga0075366_100201553 243
71 3300013104 Ga0157370_10000403 Ga0157370_1000040326 243
72 3300017792 Ga0163161_10062268 Ga0163161_100622681 243
73 3300046507 Ga0495606_0023320 Ga0495606_0023320_3715_4467 243
74 3300050493 nmdc:mga0k408_21557_c1 nmdc:mga0k408_21557_c1_1294_2046 243
75 3300003791 Ga0055530_10006145 Ga0055530_100061454 244
76 3300025298 Ga0209050_1001888 Ga0209050_10018885 244
77 3300025304 Ga0209257_1000122 Ga0209257_100012284 244
78 3300048929 Ga0496126_0092526 Ga0496126_0092526_661_1416 244
79 3300049574 Ga0501038_0010262 Ga0501038_0010262_691_1446 244
80 3300005288 Ga0065714_10147339 Ga0065714_101473391 245
81 3300005327 Ga0070658_10376492 Ga0070658_103764921 245
82 3300005329 Ga0070683_100320240 Ga0070683_1003202401 245
83 3300005336 Ga0070680_100399679 Ga0070680_1003996791 245
84 3300005339 Ga0070660_100169579 Ga0070660_1001695792 245
85 3300005458 Ga0070681_10048052 Ga0070681_100480521 245
86 3300013100 Ga0157373_10001588 Ga0157373_1000158814 245
87 3300013105 Ga0157369_10137480 Ga0157369_101374803 245
88 3300037312 Ga0395899_0139686 Ga0395899_0139686_156_920 245
89 3300037418 Ga0395900_0234702 Ga0395900_0234702_656_1420 245
90 3300048903 Ga0496100_0056442 Ga0496100_0056442_376_1155 245
91 3300053140 Ga0500573_0185496 Ga0500573_0185496_315_1079 245
92 3300048925 Ga0496122_0074586 Ga0496122_0074586_1350_2150 246
93 3300048926 Ga0496123_0028497 Ga0496123_0028497_1592_2392 246
94 3300041410 Ga0439461_0001694 Ga0439461_0001694_2449_3231 247
95 3300053153 Ga0500616_0013347 Ga0500616_0013347_3873_4655 248
96 3300009979 Ga0105032_104339 Ga0105032_1043392 249
97 3300009993 Ga0105028_100344 Ga0105028_1003442 249
98 3300005458 Ga0070681_10075027 Ga0070681_100750273 250
99 3300005563 Ga0068855_100000990 Ga0068855_10000099018 250
100 3300009098 Ga0105245_10794900 Ga0105245_107949002 250
101 3300009174 Ga0105241_10087287 Ga0105241_100872872 250
102 3300013102 Ga0157371_10009138 Ga0157371_100091385 250
103 3300013105 Ga0157369_10000003 Ga0157369_10000003432 250
104 3300014325 Ga0163163_10367189 Ga0163163_103671892 250
105 3300025911 Ga0207654_10419576 Ga0207654_104195762 250
106 3300025912 Ga0207707_10195388 Ga0207707_101953883 250
107 3300025981 Ga0207640_10004031 Ga0207640_100040314 250
108 3300031507 Ga0307509_10526551 Ga0307509_105265511 250
109 3300048918 Ga0496115_0000001 Ga0496115_0000001_53244_54023 250
110 3300053087 Ga0500643_008160 Ga0500643_008160_880_1674 250
111 3300053093 Ga0500651_0000001 Ga0500651_0000001_453569_454363 250
112 3300053118 Ga0500594_0000074 Ga0500594_0000074_12311_13105 250
113 3300001990 JGI24737J22298_10001714 JGI24737J22298_100017148 251
114 3300002067 JGI24735J21928_10000273 JGI24735J21928_100002736 251
115 3300003316 rootH1_10004333 rootH1_1000433314 251
116 3300005327 Ga0070658_10000024 Ga0070658_1000002413 251
117 3300005366 Ga0070659_100009496 Ga0070659_1000094967 251
118 3300005577 Ga0068857_100021166 Ga0068857_1000211664 251
119 3300009098 Ga0105245_10455559 Ga0105245_104555592 251
120 3300009174 Ga0105241_10335713 Ga0105241_103357132 251
121 3300009551 Ga0105238_10845543 Ga0105238_108455431 251
122 3300009993 Ga0105028_103593 Ga0105028_1035932 251
123 3300010375 Ga0105239_10000960 Ga0105239_1000096045 251
124 3300011119 Ga0105246_10000105 Ga0105246_1000010514 251
125 3300011119 Ga0105246_10003086 Ga0105246_1000308611 251
126 3300011119 Ga0105246_10006004 Ga0105246_100060041 251
127 3300013100 Ga0157373_10003921 Ga0157373_100039213 251
128 3300013100 Ga0157373_10047311 Ga0157373_100473112 251
129 3300013100 Ga0157373_10051013 Ga0157373_100510132 251
130 3300013102 Ga0157371_10018922 Ga0157371_100189225 251
131 3300013104 Ga0157370_10000520 Ga0157370_1000052033 251
132 3300013105 Ga0157369_10000075 Ga0157369_10000075121 251
133 3300013105 Ga0157369_10001459 Ga0157369_1000145922 251
134 3300013296 Ga0157374_10108965 Ga0157374_101089652 251
135 3300013307 Ga0157372_10781774 Ga0157372_107817742 251
136 3300014745 Ga0157377_10024118 Ga0157377_100241183 251
137 3300014969 Ga0157376_10000083 Ga0157376_1000008313 251
138 3300014969 Ga0157376_10005017 Ga0157376_100050176 251
139 3300026116 Ga0207674_10035638 Ga0207674_100356384 251
140 3300030745 Ga0316182_1189930 Ga0316182_11899303 251
141 3300037312 Ga0395899_0035713 Ga0395899_0035713_910_1698 251
142 3300037418 Ga0395900_0000001 Ga0395900_0000001_356885_357673 251
143 3300037466 Ga0395898_0000002 Ga0395898_0000002_748333_749121 251
144 3300038443 Ga0395901_0000006 Ga0395901_0000006_394009_394797 251
145 3300038443 Ga0395901_0169727 Ga0395901_0169727_102_890 251
146 3300042016 Ga0439463_002277 Ga0439463_002277_136_924 251
147 3300042115 Ga0450911_005580 Ga0450911_005580_16_789 251
148 3300042122 Ga0450920_001300 Ga0450920_001300_2706_3479 251
149 3300042145 Ga0450906_008859 Ga0450906_008859_763_1536 251
150 3300042185 Ga0450909_002108 Ga0450909_002108_947_1720 251
151 3300042439 Ga0439464_0000107 Ga0439464_0000107_7597_8385 251
152 3300046810 Ga0495660_0006871 Ga0495660_0006871_3758_4534 251
153 3300048916 Ga0496113_0184494 Ga0496113_0184494_57_845 251
154 3300050491 nmdc:mga00v17_34317_c1 nmdc:mga00v17_34317_c1_818_1606 251
155 3300050496 nmdc:mga07m45_1081_c1 nmdc:mga07m45_1081_c1_4215_5003 251
156 3300053087 Ga0500643_029783 Ga0500643_029783_522_1295 251
157 3300053108 Ga0500562_000001 Ga0500562_000001_7704_8480 251
158 3300053133 Ga0500655_001065 Ga0500655_001065_1115_1891 251
159 3300053724 Ga0500570_000030 Ga0500570_000030_2247_3020 251
160 3300006038 Ga0075365_10000008 Ga0075365_1000000860 252
161 3300006353 Ga0075370_10090220 Ga0075370_100902202 252
162 3300009979 Ga0105032_100001 Ga0105032_100001451 252
163 3300026035 Ga0207703_10670426 Ga0207703_106704262 252
164 3300031901 Ga0307406_10000145 Ga0307406_1000014513 252
165 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_58468_59244 252
166 3300050496 nmdc:mga07m45_133407_c1 nmdc:mga07m45_133407_c1_190_969 252
167 3300053103 Ga0500555_000009 Ga0500555_000009_137944_138720 252
168 3300053153 Ga0500616_0000012 Ga0500616_0000012_279712_280491 252
169 2162886012 MBSR1b_contig_2473327 MBSR1b_0338.00007020 253
170 3300003320 rootH2_10000763 rootH2_1000076342 253
171 3300003323 rootH1_10057122 rootH1_100571223 253
172 3300003911 JGI25405J52794_10052892 JGI25405J52794_100528921 253
173 3300005293 Ga0065715_10098299 Ga0065715_100982993 253
174 3300005339 Ga0070660_100007740 Ga0070660_1000077402 253
175 3300005563 Ga0068855_100000002 Ga0068855_100000002361 253
176 3300005563 Ga0068855_100000005 Ga0068855_100000005331 253
177 3300005577 Ga0068857_100001409 Ga0068857_10000140910 253
178 3300005614 Ga0068856_100221350 Ga0068856_1002213502 253
179 3300005616 Ga0068852_100000001 Ga0068852_100000001384 253
180 3300005937 Ga0081455_10000001 Ga0081455_10000001420 253
181 3300006038 Ga0075365_10000041 Ga0075365_1000004115 253
182 3300006038 Ga0075365_10005405 Ga0075365_100054052 253
183 3300006042 Ga0075368_10000954 Ga0075368_100009544 253
184 3300006048 Ga0075363_100003988 Ga0075363_1000039882 253
185 3300006051 Ga0075364_10009874 Ga0075364_100098742 253
186 3300006177 Ga0075362_10048576 Ga0075362_100485762 253
187 3300006186 Ga0075369_10024083 Ga0075369_100240832 253
188 3300006195 Ga0075366_10039072 Ga0075366_100390722 253
189 3300006353 Ga0075370_10003143 Ga0075370_100031433 253
190 3300006844 Ga0075428_100002220 Ga0075428_10000222019 253
191 3300009093 Ga0105240_10000004 Ga0105240_1000000428 253
192 3300009093 Ga0105240_10001037 Ga0105240_1000103736 253
193 3300009093 Ga0105240_10029617 Ga0105240_100296172 253
194 3300009545 Ga0105237_10000001 Ga0105237_10000001404 253
195 3300009545 Ga0105237_10000002 Ga0105237_10000002280 253
196 3300009551 Ga0105238_10001532 Ga0105238_1000153221 253
197 3300009551 Ga0105238_10370444 Ga0105238_103704442 253
198 3300009551 Ga0105238_11058290 Ga0105238_110582901 253
199 3300009979 Ga0105032_100025 Ga0105032_10002533 253
200 3300013102 Ga0157371_10016146 Ga0157371_100161465 253
201 3300013104 Ga0157370_10000168 Ga0157370_1000016874 253
202 3300013105 Ga0157369_10000055 Ga0157369_100000552 253
203 3300013105 Ga0157369_10006246 Ga0157369_100062467 253
204 3300013307 Ga0157372_10000002 Ga0157372_100000026 253
205 3300013307 Ga0157372_10000106 Ga0157372_10000106102 253
206 3300013307 Ga0157372_10022887 Ga0157372_100228872 253
207 3300025913 Ga0207695_10000009 Ga0207695_10000009407 253
208 3300025913 Ga0207695_10002087 Ga0207695_1000208719 253
209 3300025913 Ga0207695_10003753 Ga0207695_1000375314 253
210 3300025914 Ga0207671_10000003 Ga0207671_10000003407 253
211 3300025914 Ga0207671_10000008 Ga0207671_10000008383 253
212 3300025919 Ga0207657_10015093 Ga0207657_100150937 253
213 3300025924 Ga0207694_10099787 Ga0207694_100997872 253
214 3300025924 Ga0207694_10302242 Ga0207694_103022421 253
215 3300025949 Ga0207667_10000005 Ga0207667_10000005471 253
216 3300025949 Ga0207667_10000027 Ga0207667_10000027327 253
217 3300026078 Ga0207702_10052584 Ga0207702_100525843 253
218 3300026116 Ga0207674_10001826 Ga0207674_1000182614 253
219 3300026142 Ga0207698_10000001 Ga0207698_10000001336 253
220 3300027866 Ga0209813_10000251 Ga0209813_100002515 253
221 3300030732 Ga0316176_1093916 Ga0316176_10939161 253
222 3300030733 Ga0314311_1082504 Ga0314311_10825042 253
223 3300030734 Ga0316179_1011384 Ga0316179_10113842 253
224 3300030735 Ga0316178_1135305 Ga0316178_11353053 253
225 3300030736 Ga0316180_1159006 Ga0316180_11590065 253
226 3300030742 Ga0316183_1005382 Ga0316183_100538218 253
227 3300030742 Ga0316183_1009146 Ga0316183_100914615 253
228 3300030742 Ga0316183_1024096 Ga0316183_10240962 253
229 3300030742 Ga0316183_1077166 Ga0316183_10771666 253
230 3300030744 Ga0316181_1020431 Ga0316181_102043140 253
231 3300030745 Ga0316182_1003092 Ga0316182_100309229 253
232 3300030745 Ga0316182_1241226 Ga0316182_12412262 253
233 3300031730 Ga0307516_10011743 Ga0307516_100117438 253
234 3300031901 Ga0307406_10000001 Ga0307406_10000001291 253
235 3300038443 Ga0395901_0006434 Ga0395901_0006434_8058_8846 253
236 3300041407 Ga0439447_011690 Ga0439447_011690_1172_1957 253
237 3300041410 Ga0439461_0000308 Ga0439461_0000308_2452_3237 253
238 3300041411 Ga0439466_0002776 Ga0439466_0002776_1308_2093 253
239 3300041413 Ga0439465_0028210 Ga0439465_0028210_732_1517 253
240 3300042002 Ga0439442_002748 Ga0439442_002748_1227_2012 253
241 3300042006 Ga0439432_000742 Ga0439432_000742_1231_2010 253
242 3300042010 Ga0439452_040045 Ga0439452_040045_216_1001 253
243 3300042156 Ga0439446_0000003 Ga0439446_0000003_74997_75779 253
244 3300042156 Ga0439446_0000236 Ga0439446_0000236_8773_9558 253
245 3300042435 Ga0439434_0004989 Ga0439434_0004989_128_913 253
246 3300045051 Ga0451576_0011194 Ga0451576_0011194_7351_8148 253
247 3300046460 Ga0495638_0000061 Ga0495638_0000061_162532_163314 253
248 3300046810 Ga0495660_0000005 Ga0495660_0000005_248776_249558 253
249 3300049571 Ga0501034_0000028 Ga0501034_0000028_103597_104379 253
250 3300049573 Ga0501037_0000001 Ga0501037_0000001_93381_94163 253
251 3300049574 Ga0501038_0012245 Ga0501038_0012245_2758_3540 253
252 3300050491 nmdc:mga00v17_361_c1 nmdc:mga00v17_361_c1_3848_4630 253
253 3300050492 nmdc:mga0yw44_17_c1 nmdc:mga0yw44_17_c1_31065_31847 253
254 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_204854_205636 253
255 3300050493 nmdc:mga0k408_71125_c1 nmdc:mga0k408_71125_c1_170_952 253
256 3300050494 nmdc:mga06z11_196_c1 nmdc:mga06z11_196_c1_12071_12853 253
257 3300053090 Ga0500646_0000075 Ga0500646_0000075_9042_9824 253
258 3300053090 Ga0500646_0043804 Ga0500646_0043804_124_906 253
259 3300053092 Ga0500583_0000347 Ga0500583_0000347_9392_10174 253
260 3300053092 Ga0500583_0002751 Ga0500583_0002751_45_827 253
261 3300053096 Ga0500641_0000001 Ga0500641_0000001_1075481_1076263 253
262 3300053109 Ga0500569_000014 Ga0500569_000014_25238_26020 253
263 3300053131 Ga0500652_000001 Ga0500652_000001_402138_402920 253
264 3300053133 Ga0500655_000528 Ga0500655_000528_6313_7092 253
265 3300053142 Ga0500577_0004798 Ga0500577_0004798_688_1473 253
266 3300053146 Ga0500588_0000029 Ga0500588_0000029_11938_12720 253
267 3300053727 Ga0500611_013472 Ga0500611_013472_433_1233 253
268 3300053738 Ga0500613_000043 Ga0500613_000043_562_1344 253
269 3300059426 Ga0590077_031226 Ga0590077_031226_326_1108 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

18

263

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9657 5 244
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.9609 5 245
2btm-assembly1.cif.gz_B does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? 0.9598 5 245
3uww-assembly1.cif.gz_B crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid 0.9567 5 244
4bi6-assembly1.cif.gz_A-2 crystal structure of a triple mutant (a198v, c202a and c222n) of triosephosphate isomerase from giardia lamblia. complexed with 2- phosphoglycolic acid 0.9554 5 248
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9538 5 245 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9496 5 246 3.20.20.70
2yc8C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9432 5 245 3.20.20.70
4x22A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.943 5 241 3.20.20.70
1m6jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9386 5 245 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W4E7E2-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9872 5 248 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2G6HKU2-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9797 5 252 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7T9ISC5-F1-model_v4 deleted 0.9797 14 252
AF-A0A0G1XFE5-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9793 91 250 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7T9FEW1-F1-model_v4 deleted 0.9792 5 247

Feature Viewer

pLDDT pTM Quality
89.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map