F375855

General Info

Members Datasets Scaffolds Average Seq Length
268 198 536 186

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0017432|Ga0466962_0017432_1243_1860
Length 205
Sequence MPTSRMEAFSDGVIAILITVMVLELHVPHGTTWGALHHSLPNLLTYVLSFIYLGIYWNNHHHMLMATGRVGGLILWANLHLLFWLSLVPFTTGWMGENHFATAPVAAYGVVLLAAALAYYGLQTAIIRHQGAGSLLARAIATDAKGKLSPVAYATAIGLSEVNRWIAVAIYVGVALVWLIPDRRVERIIAADASLGTSYSSGTPE

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.37
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 4.85
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0017432 3300061719 Bacteria 3457
2 rootH2_10021402 3300003320 Bacteria 63664
3 Ga0070658_10278293 3300005327 Bacteria 1424
4 Ga0070683_100006845 3300005329 Bacteria 9578
5 Ga0070670_100509388 3300005331 Bacteria 1071
6 Ga0070666_10001143 3300005335 Bacteria 16142
7 Ga0070680_100319089 3300005336 Bacteria 1319
8 Ga0068868_100019558 3300005338 Bacteria 5075
9 Ga0068868_100560500 3300005338 Bacteria 1008
10 Ga0070689_100383505 3300005340 Bacteria 1185
11 Ga0070691_10072312 3300005341 Bacteria 1675
12 Ga0070675_100682018 3300005354 Bacteria 935
13 Ga0070671_100001686 3300005355 Bacteria 16748
14 Ga0070673_100166672 3300005364 Bacteria 1878
15 Ga0070673_100719214 3300005364 Bacteria 918
16 Ga0070688_100068900 3300005365 Bacteria 2257
17 Ga0070667_100158458 3300005367 Bacteria 1992
18 Ga0070667_100335217 3300005367 Bacteria 1367
19 Ga0070667_100565502 3300005367 Bacteria 1046
20 Ga0070709_10247070 3300005434 Bacteria 1284
21 Ga0070714_100970799 3300005435 Bacteria 826
22 Ga0070713_100039334 3300005436 Bacteria 3837
23 Ga0070711_100005639 3300005439 Bacteria 7495
24 Ga0070681_10142165 3300005458 Bacteria 2329
25 Ga0070681_11288092 3300005458 Bacteria 653
26 Ga0070706_100012862 3300005467 Bacteria 7746
27 Ga0070707_100006864 3300005468 Bacteria 10548
28 Ga0070707_100725412 3300005468 Bacteria 957
29 Ga0070698_100232357 3300005471 Bacteria 1777
30 Ga0070699_100012150 3300005518 Bacteria 7431
31 Ga0070679_100104160 3300005530 Bacteria 2824
32 Ga0068853_100039083 3300005539 Bacteria 4046
33 Ga0070686_100933082 3300005544 Bacteria 708
34 Ga0070693_100070391 3300005547 Bacteria 2058
35 Ga0070704_100050689 3300005549 Bacteria 2919
36 Ga0068855_100292407 3300005563 Bacteria 1806
37 Ga0068855_100841243 3300005563 Bacteria 973
38 Ga0068857_100001089 3300005577 Bacteria 21064
39 Ga0068856_100004403 3300005614 Bacteria 14034
40 Ga0068856_100118067 3300005614 Bacteria 2653
41 Ga0070702_100028882 3300005615 Bacteria 3010
42 Ga0070702_100101011 3300005615 Bacteria 1769
43 Ga0068852_100040872 3300005616 Bacteria 3916
44 Ga0068859_100751955 3300005617 Bacteria 1064
45 Ga0068866_10008295 3300005718 Bacteria 4371
46 Ga0068861_100303951 3300005719 Bacteria 1383
47 Ga0068863_100009471 3300005841 Bacteria 9500
48 Ga0068858_100007061 3300005842 Bacteria 10901
49 Ga0068860_100000300 3300005843 Bacteria 68717
50 Ga0068860_100850643 3300005843 Bacteria 927
51 Ga0068862_101237393 3300005844 Bacteria 746
52 Ga0075365_10015744 3300006038 Bacteria 4580
53 Ga0075364_10641160 3300006051 Bacteria 725
54 Ga0070715_10071658 3300006163 Bacteria 1549
55 Ga0070716_100011648 3300006173 Bacteria 4431
56 Ga0070712_100029742 3300006175 Bacteria 3664
57 Ga0075367_10022600 3300006178 Bacteria 3530
58 Ga0097621_100014935 3300006237 Bacteria 5828
59 Ga0097621_100034659 3300006237 Bacteria 4027
60 Ga0068871_100035703 3300006358 Bacteria 3952
61 Ga0068871_100546552 3300006358 Bacteria 1049
62 Ga0068865_100067293 3300006881 Bacteria 2530
63 Ga0068865_100292454 3300006881 Bacteria 1301
64 Ga0097620_100751885 3300006931 Bacteria 1064
65 Ga0075435_100467673 3300007076 Bacteria 1088
66 Ga0105240_10030936 3300009093 Bacteria 6950
67 Ga0105240_10574736 3300009093 Bacteria 1244
68 Ga0105245_10008933 3300009098 Bacteria 8743
69 Ga0105247_10029057 3300009101 Bacteria 3348
70 Ga0114129_10306068 3300009147 Bacteria 2117
71 Ga0105243_10544417 3300009148 Bacteria 1108
72 Ga0105241_10000029 3300009174 Bacteria 125929
73 Ga0105241_10000171 3300009174 Bacteria 47968
74 Ga0105241_10156351 3300009174 Bacteria 1870
75 Ga0105241_10807360 3300009174 Bacteria 865
76 Ga0105242_10049378 3300009176 Bacteria 3424
77 Ga0105248_10008488 3300009177 Bacteria 11277
78 Ga0105248_12043063 3300009177 Bacteria 651
79 Ga0105237_10005501 3300009545 Bacteria 14275
80 Ga0105237_10035727 3300009545 Bacteria 5027
81 Ga0105237_10485221 3300009545 Bacteria 1242
82 Ga0105239_10000046 3300010375 Bacteria 181115
83 Ga0105239_10017293 3300010375 Bacteria 7974
84 Ga0157369_10032182 3300013105 Bacteria 5769
85 Ga0157369_10084885 3300013105 Bacteria 3384
86 Ga0157374_10010395 3300013296 Bacteria 8003
87 Ga0157378_10000027 3300013297 Bacteria 128412
88 Ga0157378_10486626 3300013297 Bacteria 1230
89 Ga0163162_10013652 3300013306 Bacteria 7936
90 Ga0163162_10463814 3300013306 Bacteria 1398
91 Ga0157372_10001939 3300013307 Bacteria 22453
92 Ga0157375_10046005 3300013308 Bacteria 4251
93 Ga0157375_10478912 3300013308 Bacteria 1410
94 Ga0163163_10886282 3300014325 Bacteria 956
95 Ga0157380_10292456 3300014326 Bacteria 1496
96 Ga0157376_10320593 3300014969 Bacteria 1473
97 Ga0206353_10990517 3300020082 Bacteria 2171
98 Ga0213876_10084350 3300021384 Bacteria 1681
99 Ga0207692_10009687 3300025898 Bacteria 4033
100 Ga0207710_10072355 3300025900 Bacteria 1583
101 Ga0207680_10180256 3300025903 Bacteria 1428
102 Ga0207680_10350325 3300025903 Bacteria 1037
103 Ga0207685_10100036 3300025905 Bacteria 1238
104 Ga0207699_10083261 3300025906 Bacteria 1989
105 Ga0207654_10000039 3300025911 Bacteria 105913
106 Ga0207654_10000134 3300025911 Bacteria 47957
107 Ga0207707_10007594 3300025912 Bacteria 9449
108 Ga0207707_10531485 3300025912 Bacteria 1001
109 Ga0207695_10025958 3300025913 Bacteria 6547
110 Ga0207695_10354739 3300025913 Bacteria 1353
111 Ga0207695_10647455 3300025913 Bacteria 938
112 Ga0207671_10013878 3300025914 Bacteria 6396
113 Ga0207671_10284430 3300025914 Bacteria 1305
114 Ga0207693_10000554 3300025915 Bacteria 33783
115 Ga0207663_10181899 3300025916 Bacteria 1502
116 Ga0207660_10205389 3300025917 Bacteria 1540
117 Ga0207660_10621299 3300025917 Bacteria 880
118 Ga0207657_10226331 3300025919 Bacteria 1497
119 Ga0207652_10133534 3300025921 Bacteria 2215
120 Ga0207652_10678641 3300025921 Bacteria 920
121 Ga0207646_10006637 3300025922 Bacteria 11931
122 Ga0207646_10036948 3300025922 Bacteria 4406
123 Ga0207646_10362692 3300025922 Bacteria 1309
124 Ga0207694_10171007 3300025924 Bacteria 1759
125 Ga0207687_10204371 3300025927 Bacteria 1546
126 Ga0207700_10052045 3300025928 Bacteria 3059
127 Ga0207686_10998156 3300025934 Bacteria 679
128 Ga0207709_10657685 3300025935 Bacteria 835
129 Ga0207704_10200648 3300025938 Bacteria 1459
130 Ga0207691_10426139 3300025940 Bacteria 1130
131 Ga0207689_10640239 3300025942 Bacteria 895
132 Ga0207661_10166434 3300025944 Bacteria 1916
133 Ga0207667_10121690 3300025949 Bacteria 2689
134 Ga0207667_10220746 3300025949 Bacteria 1942
135 Ga0207667_10671931 3300025949 Bacteria 1040
136 Ga0207651_10510267 3300025960 Bacteria 1041
137 Ga0207712_10487932 3300025961 Bacteria 1051
138 Ga0207640_10204265 3300025981 Bacteria 1500
139 Ga0207658_10104952 3300025986 Bacteria 2221
140 Ga0207658_10764270 3300025986 Bacteria 876
141 Ga0207703_11044828 3300026035 Bacteria 784
142 Ga0207708_10380986 3300026075 Bacteria 1163
143 Ga0207702_10185233 3300026078 Bacteria 1920
144 Ga0207641_10101857 3300026088 Bacteria 2531
145 Ga0207674_10000133 3300026116 Bacteria 87556
146 Ga0207683_10165335 3300026121 Bacteria 2002
147 Ga0207698_10171117 3300026142 Bacteria 1913
148 Ga0207698_10595199 3300026142 Bacteria 1090
149 Ga0268264_10000916 3300028381 Bacteria 30848
150 Ga0268264_10073981 3300028381 Bacteria 2893
151 Ga0265338_10027601 3300028800 Bacteria 5690
152 Ga0265338_10095034 3300028800 Bacteria 2450
153 Ga0265325_10074955 3300031241 Bacteria 1691
154 Ga0265325_10137327 3300031241 Bacteria 1165
155 Ga0265340_10001968 3300031247 Bacteria 11738
156 Ga0265339_10017647 3300031249 Bacteria 4221
157 Ga0265339_10101883 3300031249 Bacteria 1493
158 Ga0265313_10001620 3300031595 Bacteria 20891
159 Ga0265314_10155332 3300031711 Bacteria 1398
160 Ga0265342_10005264 3300031712 Bacteria 9917
161 Ga0265342_10112969 3300031712 Bacteria 1536
162 Ga0307412_10033354 3300031911 Bacteria 3272
163 Ga0307409_100001835 3300031995 Bacteria 10793
164 Ga0307416_100000242 3300032002 Bacteria 29019
165 Ga0307411_10055632 3300032005 Bacteria 2604
166 Ga0307415_100001115 3300032126 Bacteria 12541
167 Ga0373934_0000315 3300035086 Bacteria 16971
168 Ga0373936_0271876 3300035113 Bacteria 760
169 Ga0373953_0002870 3300035117 Bacteria 5257
170 Ga0373954_0039687 3300035118 Bacteria 2192
171 Ga0373956_0020040 3300035119 Bacteria 2840
172 Ga0373956_0284968 3300035119 Bacteria 786
173 Ga0373955_0002157 3300035172 Bacteria 8507
174 Ga0373927_0078785 3300035695 Bacteria 2134
175 Ga0373933_0002680 3300035724 Bacteria 9968
176 Ga0373933_0273400 3300035724 Bacteria 1091
177 Ga0373937_0007922 3300036401 Bacteria 9208
178 Ga0373925_0565508 3300037068 Bacteria 935
179 Ga0373925_0898036 3300037068 Bacteria 730
180 Ga0436364_1403505 3300037853 Bacteria 1415
181 Ga0436365_0635317 3300039437 Bacteria 1739
182 Ga0436363_1100939 3300039450 Bacteria 1070
183 Ga0466969_0010669 3300044656 Bacteria 4868
184 Ga0466969_0040006 3300044656 Bacteria 2351
185 Ga0466969_0133087 3300044656 Bacteria 1152
186 Ga0466965_0056989 3300044683 Bacteria 1946
187 Ga0466966_0042610 3300044684 Bacteria 2912
188 Ga0466966_0249002 3300044684 Bacteria 1070
189 Ga0466966_0310712 3300044684 Bacteria 947
190 Ga0466961_0022289 3300044693 Bacteria 4074
191 Ga0466961_0079243 3300044693 Bacteria 2080
192 Ga0466961_0158583 3300044693 Bacteria 1411
193 Ga0466963_0142368 3300044694 Bacteria 1662
194 Ga0466963_0187678 3300044694 Bacteria 1444
195 Ga0466963_0191629 3300044694 Bacteria 1428
196 Ga0466964_0012481 3300044706 Bacteria 3214
197 Ga0466971_0021958 3300044719 Bacteria 2841
198 Ga0466968_0014329 3300044735 Bacteria 3132
199 Ga0466968_0156818 3300044735 Bacteria 1049
200 Ga0466970_0201267 3300044765 Bacteria 1108
201 Ga0466957_0030139 3300044842 Bacteria 3238
202 Ga0466957_0110009 3300044842 Bacteria 1746
203 Ga0466959_0021335 3300045049 Bacteria 4776
204 Ga0466959_0082174 3300045049 Bacteria 2321
205 Ga0466959_0393180 3300045049 Bacteria 943
206 Ga0466959_0568698 3300045049 Bacteria 764
207 Ga0466958_0009693 3300045836 Bacteria 5374
208 Ga0466958_0037707 3300045836 Bacteria 2896
209 Ga0466958_0174170 3300045836 Bacteria 1363
210 Ga0466967_0331241 3300045976 Bacteria 1470
211 Ga0466967_0360562 3300045976 Bacteria 1408
212 Ga0466967_0849797 3300045976 Bacteria 907
213 Ga0495592_0005111 3300046454 Bacteria 9665
214 Ga0495629_0474804 3300046459 Bacteria 845
215 Ga0495651_0032833 3300046462 Bacteria 4049
216 Ga0495606_0008320 3300046507 Bacteria 9043
217 Ga0495608_0024086 3300046511 Bacteria 4165
218 Ga0495618_0184847 3300046514 Bacteria 1323
219 Ga0495628_0005720 3300046516 Bacteria 10890
220 Ga0495628_0031852 3300046516 Bacteria 4262
221 Ga0495630_0484236 3300046517 Bacteria 949
222 Ga0495587_0006192 3300046536 Bacteria 7808
223 Ga0495587_0203265 3300046536 Bacteria 1120
224 Ga0495667_0009842 3300046559 Bacteria 6475
225 Ga0495657_0004854 3300046675 Bacteria 10719
226 Ga0495599_0254320 3300046678 Bacteria 1068
227 Ga0495647_0267642 3300046681 Bacteria 764
228 Ga0495658_0492949 3300046683 Bacteria 784
229 Ga0495674_0305241 3300047319 Bacteria 1299
230 Ga0495680_0008930 3300047322 Bacteria 9060
231 Ga0495675_0001192 3300047444 Bacteria 15734
232 Ga0496101_0032150 3300048904 Bacteria 3691
233 Ga0496102_0026321 3300048905 Bacteria 5186
234 Ga0496102_0825325 3300048905 Bacteria 849
235 Ga0496103_0195892 3300048906 Bacteria 1299
236 Ga0496105_0082831 3300048908 Bacteria 2649
237 Ga0496106_0221693 3300048909 Bacteria 1508
238 Ga0496107_0015550 3300048910 Bacteria 5336
239 Ga0496109_0340876 3300048912 Bacteria 1415
240 Ga0496111_0226063 3300048914 Bacteria 1390
241 Ga0496112_0019912 3300048915 Bacteria 6350
242 Ga0496113_0005999 3300048916 Bacteria 7648
243 Ga0496114_0020332 3300048917 Bacteria 5387
244 Ga0496115_0231226 3300048918 Bacteria 1524
245 Ga0496118_0119046 3300048921 Bacteria 1727
246 Ga0501034_0236773 3300049571 Bacteria 1773
247 Ga0501037_0278316 3300049573 Bacteria 1166
248 Ga0501067_0135804 3300049583 Bacteria 1370
249 Ga0501069_0017640 3300049585 Bacteria 3846
250 Ga0501070_0001163 3300049586 Bacteria 23531
251 Ga0501070_0012214 3300049586 Bacteria 7247
252 Ga0501070_0126864 3300049586 Bacteria 2108
253 Ga0501073_0082733 3300049589 Bacteria 2233
254 Ga0501074_0003956 3300049590 Bacteria 10559
255 Ga0501239_046929 3300049672 Bacteria 614
256 Ga0501257_041121 3300049686 Bacteria 1135
257 Ga0501219_004746 3300049703 Bacteria 968
258 Ga0501079_0000971 3300049741 Bacteria 19779
259 Ga0501080_0038259 3300049742 Bacteria 4479
260 Ga0501080_0068936 3300049742 Bacteria 3290
261 Ga0501044_0018872 3300049823 Bacteria 7385
262 nmdc:mga00v17_292563_c1 3300050491 Bacteria 1057
263 nmdc:mga06z11_12049_c1 3300050494 Bacteria 3749
264 nmdc:mga07m45_130960_c1 3300050496 Bacteria 1451
265 Ga0495619_0398131 3300053085 Bacteria 951
266 Ga0501084_0228372 3300054114 Bacteria 1571
267 Ga0501082_0006127 3300060353 Bacteria 10439
268 2977234335 2977232053 Bacteria 5485925
269 Ga0466962_0017432
270 rootH2_10021402
271 Ga0070658_10278293
272 Ga0070683_100006845
273 Ga0070670_100509388
274 Ga0070666_10001143
275 Ga0070680_100319089
276 Ga0068868_100019558
277 Ga0068868_100560500
278 Ga0070689_100383505
279 Ga0070691_10072312
280 Ga0070675_100682018
281 Ga0070671_100001686
282 Ga0070673_100166672
283 Ga0070673_100719214
284 Ga0070688_100068900
285 Ga0070667_100158458
286 Ga0070667_100335217
287 Ga0070667_100565502
288 Ga0070709_10247070
289 Ga0070714_100970799
290 Ga0070713_100039334
291 Ga0070711_100005639
292 Ga0070681_10142165
293 Ga0070681_11288092
294 Ga0070706_100012862
295 Ga0070707_100006864
296 Ga0070707_100725412
297 Ga0070698_100232357
298 Ga0070699_100012150
299 Ga0070679_100104160
300 Ga0068853_100039083
301 Ga0070686_100933082
302 Ga0070693_100070391
303 Ga0070704_100050689
304 Ga0068855_100292407
305 Ga0068855_100841243
306 Ga0068857_100001089
307 Ga0068856_100004403
308 Ga0068856_100118067
309 Ga0070702_100028882
310 Ga0070702_100101011
311 Ga0068852_100040872
312 Ga0068859_100751955
313 Ga0068866_10008295
314 Ga0068861_100303951
315 Ga0068863_100009471
316 Ga0068858_100007061
317 Ga0068860_100000300
318 Ga0068860_100850643
319 Ga0068862_101237393
320 Ga0075365_10015744
321 Ga0075364_10641160
322 Ga0070715_10071658
323 Ga0070716_100011648
324 Ga0070712_100029742
325 Ga0075367_10022600
326 Ga0097621_100014935
327 Ga0097621_100034659
328 Ga0068871_100035703
329 Ga0068871_100546552
330 Ga0068865_100067293
331 Ga0068865_100292454
332 Ga0097620_100751885
333 Ga0075435_100467673
334 Ga0105240_10030936
335 Ga0105240_10574736
336 Ga0105245_10008933
337 Ga0105247_10029057
338 Ga0114129_10306068
339 Ga0105243_10544417
340 Ga0105241_10000029
341 Ga0105241_10000171
342 Ga0105241_10156351
343 Ga0105241_10807360
344 Ga0105242_10049378
345 Ga0105248_10008488
346 Ga0105248_12043063
347 Ga0105237_10005501
348 Ga0105237_10035727
349 Ga0105237_10485221
350 Ga0105239_10000046
351 Ga0105239_10017293
352 Ga0157369_10032182
353 Ga0157369_10084885
354 Ga0157374_10010395
355 Ga0157378_10000027
356 Ga0157378_10486626
357 Ga0163162_10013652
358 Ga0163162_10463814
359 Ga0157372_10001939
360 Ga0157375_10046005
361 Ga0157375_10478912
362 Ga0163163_10886282
363 Ga0157380_10292456
364 Ga0157376_10320593
365 Ga0206353_10990517
366 Ga0213876_10084350
367 Ga0207692_10009687
368 Ga0207710_10072355
369 Ga0207680_10180256
370 Ga0207680_10350325
371 Ga0207685_10100036
372 Ga0207699_10083261
373 Ga0207654_10000039
374 Ga0207654_10000134
375 Ga0207707_10007594
376 Ga0207707_10531485
377 Ga0207695_10025958
378 Ga0207695_10354739
379 Ga0207695_10647455
380 Ga0207671_10013878
381 Ga0207671_10284430
382 Ga0207693_10000554
383 Ga0207663_10181899
384 Ga0207660_10205389
385 Ga0207660_10621299
386 Ga0207657_10226331
387 Ga0207652_10133534
388 Ga0207652_10678641
389 Ga0207646_10006637
390 Ga0207646_10036948
391 Ga0207646_10362692
392 Ga0207694_10171007
393 Ga0207687_10204371
394 Ga0207700_10052045
395 Ga0207686_10998156
396 Ga0207709_10657685
397 Ga0207704_10200648
398 Ga0207691_10426139
399 Ga0207689_10640239
400 Ga0207661_10166434
401 Ga0207667_10121690
402 Ga0207667_10220746
403 Ga0207667_10671931
404 Ga0207651_10510267
405 Ga0207712_10487932
406 Ga0207640_10204265
407 Ga0207658_10104952
408 Ga0207658_10764270
409 Ga0207703_11044828
410 Ga0207708_10380986
411 Ga0207702_10185233
412 Ga0207641_10101857
413 Ga0207674_10000133
414 Ga0207683_10165335
415 Ga0207698_10171117
416 Ga0207698_10595199
417 Ga0268264_10000916
418 Ga0268264_10073981
419 Ga0265338_10027601
420 Ga0265338_10095034
421 Ga0265325_10074955
422 Ga0265325_10137327
423 Ga0265340_10001968
424 Ga0265339_10017647
425 Ga0265339_10101883
426 Ga0265313_10001620
427 Ga0265314_10155332
428 Ga0265342_10005264
429 Ga0265342_10112969
430 Ga0307412_10033354
431 Ga0307409_100001835
432 Ga0307416_100000242
433 Ga0307411_10055632
434 Ga0307415_100001115
435 Ga0373934_0000315
436 Ga0373936_0271876
437 Ga0373953_0002870
438 Ga0373954_0039687
439 Ga0373956_0020040
440 Ga0373956_0284968
441 Ga0373955_0002157
442 Ga0373927_0078785
443 Ga0373933_0002680
444 Ga0373933_0273400
445 Ga0373937_0007922
446 Ga0373925_0565508
447 Ga0373925_0898036
448 Ga0436364_1403505
449 Ga0436365_0635317
450 Ga0436363_1100939
451 Ga0466969_0010669
452 Ga0466969_0040006
453 Ga0466969_0133087
454 Ga0466965_0056989
455 Ga0466966_0042610
456 Ga0466966_0249002
457 Ga0466966_0310712
458 Ga0466961_0022289
459 Ga0466961_0079243
460 Ga0466961_0158583
461 Ga0466963_0142368
462 Ga0466963_0187678
463 Ga0466963_0191629
464 Ga0466964_0012481
465 Ga0466971_0021958
466 Ga0466968_0014329
467 Ga0466968_0156818
468 Ga0466970_0201267
469 Ga0466957_0030139
470 Ga0466957_0110009
471 Ga0466959_0021335
472 Ga0466959_0082174
473 Ga0466959_0393180
474 Ga0466959_0568698
475 Ga0466958_0009693
476 Ga0466958_0037707
477 Ga0466958_0174170
478 Ga0466967_0331241
479 Ga0466967_0360562
480 Ga0466967_0849797
481 Ga0495592_0005111
482 Ga0495629_0474804
483 Ga0495651_0032833
484 Ga0495606_0008320
485 Ga0495608_0024086
486 Ga0495618_0184847
487 Ga0495628_0005720
488 Ga0495628_0031852
489 Ga0495630_0484236
490 Ga0495587_0006192
491 Ga0495587_0203265
492 Ga0495667_0009842
493 Ga0495657_0004854
494 Ga0495599_0254320
495 Ga0495647_0267642
496 Ga0495658_0492949
497 Ga0495674_0305241
498 Ga0495680_0008930
499 Ga0495675_0001192
500 Ga0496101_0032150
501 Ga0496102_0026321
502 Ga0496102_0825325
503 Ga0496103_0195892
504 Ga0496105_0082831
505 Ga0496106_0221693
506 Ga0496107_0015550
507 Ga0496109_0340876
508 Ga0496111_0226063
509 Ga0496112_0019912
510 Ga0496113_0005999
511 Ga0496114_0020332
512 Ga0496115_0231226
513 Ga0496118_0119046
514 Ga0501034_0236773
515 Ga0501037_0278316
516 Ga0501067_0135804
517 Ga0501069_0017640
518 Ga0501070_0001163
519 Ga0501070_0012214
520 Ga0501070_0126864
521 Ga0501073_0082733
522 Ga0501074_0003956
523 Ga0501239_046929
524 Ga0501257_041121
525 Ga0501219_004746
526 Ga0501079_0000971
527 Ga0501080_0038259
528 Ga0501080_0068936
529 Ga0501044_0018872
530 nmdc:mga00v17_292563_c1
531 nmdc:mga06z11_12049_c1
532 nmdc:mga07m45_130960_c1
533 Ga0495619_0398131
534 Ga0501084_0228372
535 Ga0501082_0006127
536 2977234335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

5

89

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8645 3 179
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.813 3 179
8fyf-assembly1.cif.gz_B human tmem175-lamp1 transmembrane domain only complex 0.785 3 192
8fyf-assembly1.cif.gz_B human tmem175-lamp1 transmembrane domain only complex 0.7634 3 192
7unm-assembly1.cif.gz_A human tmem175 in an closed state 0.7562 1 192
ID Description Score Start End Superfamily
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.619 14 127 1.20.930.20
af_A0A1P8AVE4_154_344_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.6118 6 158 1.20.1410.10
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5962 14 127 1.20.930.20
af_O14880_2_142_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5575 1 147 1.20.120.550
af_P26039_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5514 38 175 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A529ZQU9-F1-model_v4 DUF1211 domain-containing protein 0.9941 1 122 GO:0005267
GO:0015252
GO:0016020
AF-A0A529MMB4-F1-model_v4 DUF1211 domain-containing protein 0.9881 18 138 GO:0005267
GO:0015252
GO:0016020
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9857 1 194 GO:0005267
GO:0015252
GO:0016020
AF-A0A2V5PTR6-F1-model_v4 DUF1211 domain-containing protein 0.9854 1 175 GO:0005267
GO:0015252
GO:0016020
AF-Q98KD7-F1-model_v4 Mlr1523 protein 0.9822 1 190 GO:0005267
GO:0015252
GO:0016020

Map