F375814

General Info

Members Datasets Scaffolds Average Seq Length
268 172 268 124

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_432038_c1|nmdc:mga03683_432038_c1_42_488
Length 148
Sequence LANHQPDGLPRKGVTLEAEVQKRGFMIKVAIIEDDQAISQMYRIKFEAEGYDVETAENGKLGLELAETMRPDIILLDLMMPVMSGEEMLAKLRKSKWGKDMKVIILTNRGEQEIPPEVKELGVTALILKADMTPRQVAELVKTKLGEV

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
59 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
60 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
147 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
153 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
159 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
160 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
161 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
162 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
165 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
169 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
170 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.85
Nodule 0
Rhizoplane 1.49
Rhizosphere 67.54
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000639 3300001915 Bacteria 10596
2 JGI24741J21665_1005562 3300001915 Bacteria 2621
3 JGI24740J21852_10010410 3300001979 Bacteria 3583
4 JGI24740J21852_10015044 3300001979 Bacteria 2835
5 JGI24740J21852_10128646 3300001979 Bacteria 632
6 JGI24737J22298_10000006 3300001990 Bacteria 62764
7 JGI24735J21928_10000018 3300002067 Bacteria 109218
8 JGI24742J22300_10000007 3300002244 Bacteria 40579
9 JGI25406J46586_10157750 3300003203 Unclassified 662
10 rootH2_10130768 3300003320 Bacteria 4607
11 rootH1_10035151 3300003323 Unclassified 4516
12 Ga0070658_10000054 3300005327 Bacteria 115356
13 Ga0070676_10009409 3300005328 Bacteria 5279
14 Ga0070676_10015431 3300005328 Bacteria 4215
15 Ga0070683_100002058 3300005329 Bacteria 15875
16 Ga0070690_100005203 3300005330 Bacteria 7288
17 Ga0070677_10756750 3300005333 Unclassified 551
18 Ga0070666_10085176 3300005335 Bacteria 2164
19 Ga0070682_100052326 3300005337 Bacteria 2555
20 Ga0070671_100099668 3300005355 Bacteria 2437
21 Ga0070671_100388966 3300005355 Bacteria 1192
22 Ga0070674_100036088 3300005356 Bacteria 3316
23 Ga0070673_100000079 3300005364 Bacteria 41513
24 Ga0070673_100429651 3300005364 Bacteria 1185
25 Ga0070688_100020860 3300005365 Bacteria 3818
26 Ga0070659_100779751 3300005366 Bacteria 830
27 Ga0070667_100009542 3300005367 Bacteria 8047
28 Ga0070663_100037979 3300005455 Bacteria 3356
29 Ga0070663_101380365 3300005455 Bacteria 623
30 Ga0070678_100011540 3300005456 Bacteria 5458
31 Ga0070681_10007077 3300005458 Bacteria 10922
32 Ga0070685_10000177 3300005466 Bacteria 42536
33 Ga0070679_100986708 3300005530 Unclassified 786
34 Ga0070684_100041238 3300005535 Bacteria 3979
35 Ga0070672_100007681 3300005543 Bacteria 7341
36 Ga0070665_100158994 3300005548 Bacteria 2261
37 Ga0070665_100191421 3300005548 Bacteria 2046
38 Ga0068855_100000001 3300005563 Bacteria 818777
39 Ga0068855_102401680 3300005563 Bacteria 526
40 Ga0068856_100000807 3300005614 Bacteria 33816
41 Ga0068856_100282004 3300005614 Bacteria 1678
42 Ga0068856_100410132 3300005614 Bacteria 1375
43 Ga0068856_102436058 3300005614 Unclassified 530
44 Ga0068852_100440789 3300005616 Bacteria 1288
45 Ga0068852_100670856 3300005616 Bacteria 1045
46 Ga0068859_103052657 3300005617 Unclassified 511
47 Ga0068866_11363656 3300005718 Unclassified 517
48 Ga0068863_100011550 3300005841 Bacteria 8545
49 Ga0068863_100175480 3300005841 Unclassified 2056
50 Ga0068860_101217943 3300005843 Bacteria 773
51 Ga0081539_10149280 3300005985 Bacteria 1126
52 Ga0075365_10000013 3300006038 Bacteria 80137
53 Ga0075365_10035019 3300006038 Unclassified 3246
54 Ga0075365_10072204 3300006038 Bacteria 2324
55 Ga0075365_10395477 3300006038 Unclassified 975
56 Ga0075368_10023840 3300006042 Bacteria 2341
57 Ga0075364_10001421 3300006051 Bacteria 12989
58 Ga0075364_10627672 3300006051 Bacteria 734
59 Ga0075364_10794691 3300006051 Unclassified 645
60 Ga0075364_10897956 3300006051 Unclassified 603
61 Ga0075362_10002855 3300006177 Bacteria 5901
62 Ga0075367_10000294 3300006178 Bacteria 17538
63 Ga0075369_10000001 3300006186 Bacteria 299616
64 Ga0075369_10000008 3300006186 Bacteria 97558
65 Ga0075366_10000008 3300006195 Bacteria 89973
66 Ga0075366_10000321 3300006195 Bacteria 21877
67 Ga0075366_10001235 3300006195 Bacteria 12677
68 Ga0075366_10001602 3300006195 Bacteria 11326
69 Ga0075366_10002684 3300006195 Bacteria 9179
70 Ga0075366_10011237 3300006195 Bacteria 5052
71 Ga0075366_10141787 3300006195 Bacteria 1453
72 Ga0097621_100000031 3300006237 Bacteria 70439
73 Ga0097621_100025200 3300006237 Unclassified 4651
74 Ga0097621_100164860 3300006237 Bacteria 1907
75 Ga0097621_100231782 3300006237 Bacteria 1612
76 Ga0075370_10026396 3300006353 Bacteria 3218
77 Ga0075370_10512456 3300006353 Bacteria 724
78 Ga0068871_100000011 3300006358 Bacteria 105600
79 Ga0068871_100274433 3300006358 Bacteria 1473
80 Ga0097620_103051916 3300006931 Unclassified 511
81 Ga0105240_10000003 3300009093 Bacteria 1183681
82 Ga0105240_10077189 3300009093 Bacteria 4105
83 Ga0105245_10000007 3300009098 Bacteria 312285
84 Ga0105245_10000388 3300009098 Bacteria 41020
85 Ga0105245_10005971 3300009098 Bacteria 10702
86 Ga0105245_10179453 3300009098 Bacteria 2022
87 Ga0105245_10527348 3300009098 Bacteria 1200
88 Ga0105247_11222621 3300009101 Bacteria 599
89 Ga0105243_10000001 3300009148 Bacteria 1156578
90 Ga0105243_10011243 3300009148 Bacteria 6770
91 Ga0105241_10000003 3300009174 Bacteria 839043
92 Ga0105241_10000636 3300009174 Bacteria 26460
93 Ga0105241_10031652 3300009174 Bacteria 3961
94 Ga0105242_10000364 3300009176 Bacteria 36186
95 Ga0105242_10009619 3300009176 Bacteria 7411
96 Ga0105237_10024379 3300009545 Bacteria 6189
97 Ga0105238_10104082 3300009551 Unclassified 2819
98 Ga0105249_10250395 3300009553 Unclassified 1756
99 Ga0105033_100261 3300009986 Bacteria 4139
100 Ga0105030_109351 3300009987 Bacteria 835
101 Ga0105028_100119 3300009993 Bacteria 8239
102 Ga0105239_10002724 3300010375 Bacteria 22192
103 Ga0105239_10016223 3300010375 Bacteria 8240
104 Ga0105246_10232883 3300011119 Bacteria 1451
105 Ga0157373_10000070 3300013100 Bacteria 89698
106 Ga0157371_10001430 3300013102 Bacteria 24798
107 Ga0157369_10001870 3300013105 Bacteria 25373
108 Ga0157369_10042930 3300013105 Bacteria 4931
109 Ga0157369_10981855 3300013105 Bacteria 865
110 Ga0157374_10000014 3300013296 Bacteria 396846
111 Ga0157374_10002297 3300013296 Bacteria 16101
112 Ga0157374_10170947 3300013296 Bacteria 2120
113 Ga0157374_10181385 3300013296 Bacteria 2057
114 Ga0157378_10009953 3300013297 Bacteria 8289
115 Ga0157372_10223664 3300013307 Bacteria 2182
116 Ga0157372_10970496 3300013307 Bacteria 985
117 Ga0157375_10278953 3300013308 Unclassified 1834
118 Ga0163163_10265406 3300014325 Unclassified 1768
119 Ga0157377_10048099 3300014745 Unclassified 2392
120 Ga0157377_10202787 3300014745 Bacteria 1260
121 Ga0157377_10786475 3300014745 Bacteria 700
122 Ga0157379_10000643 3300014968 Bacteria 28165
123 Ga0157376_10000001 3300014969 Bacteria 842910
124 Ga0207680_10370947 3300025903 Bacteria 1008
125 Ga0207645_10014410 3300025907 Bacteria 5289
126 Ga0207645_10021113 3300025907 Bacteria 4251
127 Ga0207705_10000161 3300025909 Bacteria 72047
128 Ga0207654_10000002 3300025911 Bacteria 1460142
129 Ga0207654_10000367 3300025911 Bacteria 26462
130 Ga0207654_10079180 3300025911 Bacteria 1973
131 Ga0207654_10269625 3300025911 Bacteria 1148
132 Ga0207707_10006341 3300025912 Bacteria 10330
133 Ga0207695_10000005 3300025913 Bacteria 1196715
134 Ga0207671_10005986 3300025914 Bacteria 11004
135 Ga0207662_10392024 3300025918 Bacteria 940
136 Ga0207681_11730914 3300025923 Bacteria 522
137 Ga0207687_10000008 3300025927 Bacteria 497738
138 Ga0207687_10029357 3300025927 Bacteria 3698
139 Ga0207687_10304202 3300025927 Bacteria 1285
140 Ga0207687_10440436 3300025927 Unclassified 1079
141 Ga0207644_10353632 3300025931 Bacteria 1193
142 Ga0207690_10317942 3300025932 Bacteria 1223
143 Ga0207686_10000001 3300025934 Bacteria 1169580
144 Ga0207686_10000754 3300025934 Bacteria 19938
145 Ga0207686_10010970 3300025934 Bacteria 4943
146 Ga0207709_10000002 3300025935 Bacteria 1171536
147 Ga0207709_10016948 3300025935 Bacteria 4059
148 Ga0207669_10144775 3300025937 Bacteria 1655
149 Ga0207691_10090430 3300025940 Bacteria 2744
150 Ga0207689_10177755 3300025942 Bacteria 1755
151 Ga0207661_10005032 3300025944 Bacteria 9271
152 Ga0207661_11736636 3300025944 Bacteria 569
153 Ga0207667_10000003 3300025949 Bacteria 822935
154 Ga0207651_10000188 3300025960 Bacteria 27021
155 Ga0207651_11644763 3300025960 Bacteria 578
156 Ga0207712_10653863 3300025961 Bacteria 914
157 Ga0207640_11276631 3300025981 Unclassified 655
158 Ga0207678_10202432 3300026067 Bacteria 1698
159 Ga0207702_10000776 3300026078 Bacteria 33817
160 Ga0207702_12116849 3300026078 Bacteria 552
161 Ga0207641_10009485 3300026088 Bacteria 8022
162 Ga0207641_10593801 3300026088 Bacteria 1083
163 Ga0207648_10015491 3300026089 Bacteria 7010
164 Ga0207676_11231327 3300026095 Bacteria 742
165 Ga0207698_10512782 3300026142 Bacteria 1169
166 Ga0207698_11648337 3300026142 Bacteria 657
167 Ga0209813_10011165 3300027866 Bacteria 2341
168 Ga0268266_10001890 3300028379 Bacteria 23634
169 Ga0268266_11814132 3300028379 Unclassified 584
170 Ga0268264_10806852 3300028381 Bacteria 938
171 Ga0265319_1122421 3300028563 Bacteria 810
172 Ga0265338_10009134 3300028800 Bacteria 11901
173 Ga0265338_10162097 3300028800 Bacteria 1726
174 Ga0265338_10475365 3300028800 Unclassified 882
175 Ga0265327_10019425 3300031251 Unclassified 4177
176 Ga0265327_10182579 3300031251 Bacteria 959
177 Ga0395900_0008298 3300037418 Bacteria 10689
178 Ga0395900_0011446 3300037418 Bacteria 9081
179 Ga0395900_0071653 3300037418 Bacteria 3563
180 Ga0395898_0019843 3300037466 Bacteria 6836
181 Ga0395905_0092584 3300037471 Bacteria 2835
182 Ga0395901_0001913 3300038443 Bacteria 21439
183 Ga0395901_0073101 3300038443 Unclassified 3576
184 Ga0451793_1053964 3300041452 Unclassified 1866
185 Ga0451798_0129422 3300041458 Bacteria 1004
186 Ga0466966_0263301 3300044684 Bacteria 1038
187 Ga0466967_1315152 3300045976 Bacteria 720
188 Ga0495629_0156388 3300046459 Bacteria 1584
189 Ga0495583_0054555 3300046506 Bacteria 1809
190 Ga0495587_0200149 3300046536 Bacteria 1130
191 Ga0495609_0172828 3300046538 Unclassified 912
192 Ga0495622_0000091 3300046557 Bacteria 80761
193 Ga0495588_0000287 3300046674 Bacteria 37043
194 Ga0495647_0319249 3300046681 Bacteria 703
195 Ga0495658_0063826 3300046683 Bacteria 2120
196 Ga0495649_0000526 3300046694 Bacteria 32534
197 Ga0495600_0023347 3300046809 Unclassified 3978
198 Ga0496105_0620786 3300048908 Unclassified 837
199 Ga0496112_0982459 3300048915 Unclassified 764
200 Ga0496126_0583989 3300048929 Unclassified 882
201 Ga0495678_155172 3300049459 Unclassified 736
202 Ga0501296_040508 3300049519 Bacteria 655
203 Ga0501034_0044313 3300049571 Bacteria 4500
204 Ga0501037_0052918 3300049573 Bacteria 2969
205 Ga0501038_0979895 3300049574 Unclassified 621
206 Ga0501069_0393296 3300049585 Bacteria 820
207 Ga0501073_0175329 3300049589 Unclassified 1484
208 Ga0501080_0000178 3300049742 Bacteria 46844
209 Ga0501083_0020157 3300049744 Bacteria 4640
210 nmdc:mga03683_103364_c1 3300050489 Unclassified 1254
211 nmdc:mga03683_432038_c1 3300050489 Unclassified 632
212 nmdc:mga03683_65_c2 3300050489 Bacteria 39994
213 nmdc:mga00v17_1007414_c1 3300050491 Unclassified 524
214 nmdc:mga00v17_107560_c1 3300050491 Bacteria 1766
215 nmdc:mga00v17_1444_c1 3300050491 Bacteria 12443
216 nmdc:mga00v17_1614_c3 3300050491 Bacteria 784
217 nmdc:mga00v17_585646_c1 3300050491 Bacteria 720
218 nmdc:mga0yw44_71910_c1 3300050492 Bacteria 1800
219 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
220 nmdc:mga0k408_10_c2 3300050493 Bacteria 32712
221 nmdc:mga0k408_155647_c1 3300050493 Bacteria 1361
222 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
223 nmdc:mga0k408_29_c1 3300050493 Bacteria 89645
224 nmdc:mga0k408_31587_c1 3300050493 Bacteria 3024
225 nmdc:mga0k408_4328_c1 3300050493 Bacteria 7540
226 nmdc:mga0k408_634663_c1 3300050493 Bacteria 629
227 nmdc:mga0k408_94_c2 3300050493 Bacteria 28166
228 nmdc:mga06z11_376_c1 3300050494 Bacteria 16810
229 nmdc:mga04h51_5536_c1 3300050495 Bacteria 3225
230 nmdc:mga07m45_160430_c1 3300050496 Bacteria 1305
231 nmdc:mga07m45_448683_c1 3300050496 Bacteria 748
232 nmdc:mga07m45_5392_c2 3300050496 Bacteria 2874
233 nmdc:mga0sz30_20591_c1 3300050516 Bacteria 2661
234 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
235 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
236 Ga0500610_0000005 3300053079 Bacteria 135448
237 Ga0500643_018857 3300053087 Bacteria 2281
238 Ga0500644_0000256 3300053088 Bacteria 30060
239 Ga0500644_0001568 3300053088 Bacteria 6000
240 Ga0500644_0073473 3300053088 Bacteria 1238
241 Ga0500646_0024813 3300053090 Bacteria 1615
242 Ga0500583_0006159 3300053092 Bacteria 4098
243 Ga0500566_0000001 3300053094 Bacteria 1101031
244 Ga0500650_0000001 3300053098 Bacteria 818797
245 Ga0500555_000001 3300053103 Bacteria 1353713
246 Ga0500555_000002 3300053103 Bacteria 1314346
247 Ga0500556_0000103 3300053104 Bacteria 76442
248 Ga0500562_000002 3300053108 Bacteria 977234
249 Ga0500562_002134 3300053108 Bacteria 4944
250 Ga0500594_0000001 3300053118 Bacteria 1178472
251 Ga0500594_0000112 3300053118 Bacteria 23825
252 Ga0500614_000001 3300053123 Bacteria 1274484
253 Ga0500628_000008 3300053129 Bacteria 151664
254 Ga0500652_000036 3300053131 Bacteria 72510
255 Ga0500655_001809 3300053133 Bacteria 4004
256 Ga0500561_0000002 3300053137 Bacteria 394147
257 Ga0500574_126023 3300053141 Bacteria 756
258 Ga0500577_0000424 3300053142 Bacteria 10848
259 Ga0500579_006577 3300053143 Bacteria 7231
260 Ga0500603_021481 3300053150 Bacteria 1588
261 Ga0500603_275329 3300053150 Bacteria 543
262 Ga0500616_0298011 3300053153 Bacteria 671
263 Ga0500622_0303162 3300053156 Unclassified 680
264 Ga0500633_0178401 3300053160 Bacteria 796
265 Ga0500649_000005 3300053722 Bacteria 123143
266 Ga0500656_006206 3300053732 Bacteria 1206
267 Ga0501084_1750186 3300054114 Unclassified 519
268 Ga0530510_1315939 3300061734 Bacteria 554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10157750 JGI25406J46586_101577501 120
2 3300005985 Ga0081539_10149280 Ga0081539_101492802 120
3 3300006195 Ga0075366_10141787 Ga0075366_101417872 121
4 3300009176 Ga0105242_10000364 Ga0105242_1000036434 121
5 3300009551 Ga0105238_10104082 Ga0105238_101040822 121
6 3300009553 Ga0105249_10250395 Ga0105249_102503952 121
7 3300025934 Ga0207686_10000754 Ga0207686_100007544 121
8 3300025961 Ga0207712_10653863 Ga0207712_106538632 121
9 3300028379 Ga0268266_10001890 Ga0268266_1000189017 121
10 3300028800 Ga0265338_10009134 Ga0265338_100091348 121
11 3300028800 Ga0265338_10162097 Ga0265338_101620973 121
12 3300028800 Ga0265338_10475365 Ga0265338_104753652 121
13 3300050491 nmdc:mga00v17_585646_c1 nmdc:mga00v17_585646_c1_53_418 121
14 3300050493 nmdc:mga0k408_155647_c1 nmdc:mga0k408_155647_c1_394_759 121
15 3300053104 Ga0500556_0000103 Ga0500556_0000103_12662_13027 121
16 3300053156 Ga0500622_0303162 Ga0500622_0303162_127_492 121
17 3300001979 JGI24740J21852_10128646 JGI24740J21852_101286462 122
18 3300002244 JGI24742J22300_10000007 JGI24742J22300_1000000727 122
19 3300003320 rootH2_10130768 rootH2_101307686 122
20 3300003323 rootH1_10035151 rootH1_100351515 122
21 3300005327 Ga0070658_10000054 Ga0070658_1000005421 122
22 3300005328 Ga0070676_10009409 Ga0070676_100094094 122
23 3300005328 Ga0070676_10015431 Ga0070676_100154311 122
24 3300005333 Ga0070677_10756750 Ga0070677_107567501 122
25 3300005355 Ga0070671_100099668 Ga0070671_1000996683 122
26 3300005355 Ga0070671_100388966 Ga0070671_1003889662 122
27 3300005356 Ga0070674_100036088 Ga0070674_1000360884 122
28 3300005364 Ga0070673_100000079 Ga0070673_10000007913 122
29 3300005364 Ga0070673_100429651 Ga0070673_1004296512 122
30 3300005365 Ga0070688_100020860 Ga0070688_1000208602 122
31 3300005367 Ga0070667_100009542 Ga0070667_1000095424 122
32 3300005455 Ga0070663_100037979 Ga0070663_1000379792 122
33 3300005456 Ga0070678_100011540 Ga0070678_1000115403 122
34 3300005458 Ga0070681_10007077 Ga0070681_100070772 122
35 3300005466 Ga0070685_10000177 Ga0070685_1000017750 122
36 3300005530 Ga0070679_100986708 Ga0070679_1009867082 122
37 3300005543 Ga0070672_100007681 Ga0070672_1000076814 122
38 3300005548 Ga0070665_100158994 Ga0070665_1001589943 122
39 3300005563 Ga0068855_102401680 Ga0068855_1024016802 122
40 3300005617 Ga0068859_103052657 Ga0068859_1030526571 122
41 3300005718 Ga0068866_11363656 Ga0068866_113636561 122
42 3300005841 Ga0068863_100011550 Ga0068863_1000115503 122
43 3300005841 Ga0068863_100175480 Ga0068863_1001754803 122
44 3300005843 Ga0068860_101217943 Ga0068860_1012179431 122
45 3300006038 Ga0075365_10000013 Ga0075365_1000001362 122
46 3300006038 Ga0075365_10072204 Ga0075365_100722043 122
47 3300006038 Ga0075365_10395477 Ga0075365_103954772 122
48 3300006051 Ga0075364_10627672 Ga0075364_106276722 122
49 3300006051 Ga0075364_10794691 Ga0075364_107946912 122
50 3300006177 Ga0075362_10002855 Ga0075362_100028554 122
51 3300006186 Ga0075369_10000001 Ga0075369_10000001249 122
52 3300006186 Ga0075369_10000008 Ga0075369_100000087 122
53 3300006195 Ga0075366_10000008 Ga0075366_1000000878 122
54 3300006195 Ga0075366_10002684 Ga0075366_100026844 122
55 3300006237 Ga0097621_100025200 Ga0097621_1000252004 122
56 3300006237 Ga0097621_100164860 Ga0097621_1001648601 122
57 3300006237 Ga0097621_100231782 Ga0097621_1002317821 122
58 3300006353 Ga0075370_10026396 Ga0075370_100263962 122
59 3300006353 Ga0075370_10512456 Ga0075370_105124562 122
60 3300006358 Ga0068871_100274433 Ga0068871_1002744331 122
61 3300006931 Ga0097620_103051916 Ga0097620_1030519161 122
62 3300009093 Ga0105240_10000003 Ga0105240_10000003490 122
63 3300009098 Ga0105245_10000388 Ga0105245_1000038818 122
64 3300009098 Ga0105245_10005971 Ga0105245_100059719 122
65 3300009098 Ga0105245_10527348 Ga0105245_105273482 122
66 3300009101 Ga0105247_11222621 Ga0105247_112226211 122
67 3300009148 Ga0105243_10000001 Ga0105243_10000001760 122
68 3300009176 Ga0105242_10009619 Ga0105242_100096192 122
69 3300009545 Ga0105237_10024379 Ga0105237_100243796 122
70 3300009987 Ga0105030_109351 Ga0105030_1093512 122
71 3300010375 Ga0105239_10002724 Ga0105239_100027246 122
72 3300010375 Ga0105239_10016223 Ga0105239_100162237 122
73 3300011119 Ga0105246_10232883 Ga0105246_102328832 122
74 3300013105 Ga0157369_10042930 Ga0157369_100429302 122
75 3300013296 Ga0157374_10002297 Ga0157374_1000229724 122
76 3300013296 Ga0157374_10181385 Ga0157374_101813851 122
77 3300013297 Ga0157378_10009953 Ga0157378_100099534 122
78 3300013308 Ga0157375_10278953 Ga0157375_102789532 122
79 3300014745 Ga0157377_10202787 Ga0157377_102027872 122
80 3300014745 Ga0157377_10786475 Ga0157377_107864752 122
81 3300014968 Ga0157379_10000643 Ga0157379_100006438 122
82 3300014969 Ga0157376_10000001 Ga0157376_10000001401 122
83 3300025907 Ga0207645_10014410 Ga0207645_100144105 122
84 3300025907 Ga0207645_10021113 Ga0207645_100211135 122
85 3300025909 Ga0207705_10000161 Ga0207705_1000016178 122
86 3300025912 Ga0207707_10006341 Ga0207707_100063415 122
87 3300025913 Ga0207695_10000005 Ga0207695_10000005499 122
88 3300025914 Ga0207671_10005986 Ga0207671_100059866 122
89 3300025923 Ga0207681_11730914 Ga0207681_117309142 122
90 3300025927 Ga0207687_10029357 Ga0207687_100293574 122
91 3300025927 Ga0207687_10440436 Ga0207687_104404361 122
92 3300025931 Ga0207644_10353632 Ga0207644_103536322 122
93 3300025932 Ga0207690_10317942 Ga0207690_103179422 122
94 3300025934 Ga0207686_10000001 Ga0207686_10000001382 122
95 3300025934 Ga0207686_10010970 Ga0207686_100109705 122
96 3300025935 Ga0207709_10000002 Ga0207709_10000002499 122
97 3300025937 Ga0207669_10144775 Ga0207669_101447751 122
98 3300025940 Ga0207691_10090430 Ga0207691_100904303 122
99 3300025942 Ga0207689_10177755 Ga0207689_101777551 122
100 3300025960 Ga0207651_10000188 Ga0207651_100001885 122
101 3300025960 Ga0207651_11644763 Ga0207651_116447631 122
102 3300026067 Ga0207678_10202432 Ga0207678_102024322 122
103 3300026088 Ga0207641_10009485 Ga0207641_100094859 122
104 3300026088 Ga0207641_10593801 Ga0207641_105938012 122
105 3300026089 Ga0207648_10015491 Ga0207648_100154913 122
106 3300026095 Ga0207676_11231327 Ga0207676_112313271 122
107 3300028379 Ga0268266_11814132 Ga0268266_118141321 122
108 3300028381 Ga0268264_10806852 Ga0268264_108068522 122
109 3300028563 Ga0265319_1122421 Ga0265319_11224212 122
110 3300031251 Ga0265327_10182579 Ga0265327_101825791 122
111 3300037418 Ga0395900_0011446 Ga0395900_0011446_5081_5449 122
112 3300038443 Ga0395901_0001913 Ga0395901_0001913_16578_16946 122
113 3300041452 Ga0451793_1053964 Ga0451793_1053964_1165_1533 122
114 3300041458 Ga0451798_0129422 Ga0451798_0129422_423_794 122
115 3300045976 Ga0466967_1315152 Ga0466967_1315152_135_503 122
116 3300046459 Ga0495629_0156388 Ga0495629_0156388_179_559 122
117 3300046536 Ga0495587_0200149 Ga0495587_0200149_584_964 122
118 3300046538 Ga0495609_0172828 Ga0495609_0172828_513_893 122
119 3300046557 Ga0495622_0000091 Ga0495622_0000091_45611_45991 122
120 3300046674 Ga0495588_0000287 Ga0495588_0000287_5210_5581 122
121 3300046681 Ga0495647_0319249 Ga0495647_0319249_220_600 122
122 3300046683 Ga0495658_0063826 Ga0495658_0063826_64_444 122
123 3300046809 Ga0495600_0023347 Ga0495600_0023347_3305_3685 122
124 3300048908 Ga0496105_0620786 Ga0496105_0620786_113_481 122
125 3300048915 Ga0496112_0982459 Ga0496112_0982459_32_400 122
126 3300049459 Ga0495678_155172 Ga0495678_155172_152_523 122
127 3300049519 Ga0501296_040508 Ga0501296_040508_66_434 122
128 3300049589 Ga0501073_0175329 Ga0501073_0175329_972_1340 122
129 3300049742 Ga0501080_0000178 Ga0501080_0000178_5157_5525 122
130 3300049744 Ga0501083_0020157 Ga0501083_0020157_1793_2167 122
131 3300050489 nmdc:mga03683_103364_c1 nmdc:mga03683_103364_c1_95_463 122
132 3300050489 nmdc:mga03683_65_c2 nmdc:mga03683_65_c2_2793_3164 122
133 3300050491 nmdc:mga00v17_1007414_c1 nmdc:mga00v17_1007414_c1_93_473 122
134 3300050491 nmdc:mga00v17_107560_c1 nmdc:mga00v17_107560_c1_931_1299 122
135 3300050492 nmdc:mga0yw44_8_c1 nmdc:mga0yw44_8_c1_124177_124545 122
136 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_386111_386491 122
137 3300050493 nmdc:mga0k408_29_c1 nmdc:mga0k408_29_c1_89169_89537 122
138 3300050493 nmdc:mga0k408_634663_c1 nmdc:mga0k408_634663_c1_43_411 122
139 3300050496 nmdc:mga07m45_160430_c1 nmdc:mga07m45_160430_c1_724_1104 122
140 3300050496 nmdc:mga07m45_448683_c1 nmdc:mga07m45_448683_c1_204_578 122
141 3300050496 nmdc:mga07m45_5392_c2 nmdc:mga07m45_5392_c2_1007_1375 122
142 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_500047_500418 122
143 3300050516 nmdc:mga0sz30_3_c8 nmdc:mga0sz30_3_c8_4764_5144 122
144 3300053079 Ga0500610_0000005 Ga0500610_0000005_106981_107367 122
145 3300053087 Ga0500643_018857 Ga0500643_018857_1118_1504 122
146 3300053088 Ga0500644_0000256 Ga0500644_0000256_6863_7249 122
147 3300053088 Ga0500644_0001568 Ga0500644_0001568_1438_1809 122
148 3300053088 Ga0500644_0073473 Ga0500644_0073473_773_1159 122
149 3300053090 Ga0500646_0024813 Ga0500646_0024813_247_618 122
150 3300053092 Ga0500583_0006159 Ga0500583_0006159_1351_1722 122
151 3300053094 Ga0500566_0000001 Ga0500566_0000001_338870_339250 122
152 3300053098 Ga0500650_0000001 Ga0500650_0000001_216845_217216 122
153 3300053103 Ga0500555_000001 Ga0500555_000001_396549_396932 122
154 3300053103 Ga0500555_000002 Ga0500555_000002_943889_944275 122
155 3300053108 Ga0500562_002134 Ga0500562_002134_4370_4741 122
156 3300053118 Ga0500594_0000001 Ga0500594_0000001_896290_896661 122
157 3300053118 Ga0500594_0000112 Ga0500594_0000112_16173_16559 122
158 3300053123 Ga0500614_000001 Ga0500614_000001_665176_665547 122
159 3300053129 Ga0500628_000008 Ga0500628_000008_113869_114255 122
160 3300053131 Ga0500652_000036 Ga0500652_000036_35925_36311 122
161 3300053133 Ga0500655_001809 Ga0500655_001809_477_848 122
162 3300053141 Ga0500574_126023 Ga0500574_126023_320_700 122
163 3300053142 Ga0500577_0000424 Ga0500577_0000424_4601_4972 122
164 3300053143 Ga0500579_006577 Ga0500579_006577_1189_1560 122
165 3300053150 Ga0500603_021481 Ga0500603_021481_1128_1508 122
166 3300053153 Ga0500616_0298011 Ga0500616_0298011_40_408 122
167 3300053160 Ga0500633_0178401 Ga0500633_0178401_54_425 122
168 3300053722 Ga0500649_000005 Ga0500649_000005_82786_83157 122
169 3300053732 Ga0500656_006206 Ga0500656_006206_659_1030 122
170 3300054114 Ga0501084_1750186 Ga0501084_1750186_52_420 122
171 3300061734 Ga0530510_1315939 Ga0530510_1315939_10_378 122
172 3300001915 JGI24741J21665_1000639 JGI24741J21665_10006398 123
173 3300001915 JGI24741J21665_1005562 JGI24741J21665_10055624 123
174 3300001979 JGI24740J21852_10010410 JGI24740J21852_100104104 123
175 3300001979 JGI24740J21852_10015044 JGI24740J21852_100150443 123
176 3300001990 JGI24737J22298_10000006 JGI24737J22298_1000000653 123
177 3300002067 JGI24735J21928_10000018 JGI24735J21928_10000018107 123
178 3300005329 Ga0070683_100002058 Ga0070683_10000205813 123
179 3300005330 Ga0070690_100005203 Ga0070690_1000052035 123
180 3300005335 Ga0070666_10085176 Ga0070666_100851763 123
181 3300005337 Ga0070682_100052326 Ga0070682_1000523262 123
182 3300005366 Ga0070659_100779751 Ga0070659_1007797511 123
183 3300005455 Ga0070663_101380365 Ga0070663_1013803651 123
184 3300005535 Ga0070684_100041238 Ga0070684_1000412384 123
185 3300005548 Ga0070665_100191421 Ga0070665_1001914213 123
186 3300005563 Ga0068855_100000001 Ga0068855_100000001426 123
187 3300005614 Ga0068856_100000807 Ga0068856_10000080716 123
188 3300005614 Ga0068856_100282004 Ga0068856_1002820044 123
189 3300005614 Ga0068856_100410132 Ga0068856_1004101322 123
190 3300005614 Ga0068856_102436058 Ga0068856_1024360582 123
191 3300005616 Ga0068852_100440789 Ga0068852_1004407892 123
192 3300005616 Ga0068852_100670856 Ga0068852_1006708562 123
193 3300006038 Ga0075365_10035019 Ga0075365_100350193 123
194 3300006042 Ga0075368_10023840 Ga0075368_100238403 123
195 3300006051 Ga0075364_10001421 Ga0075364_1000142110 123
196 3300006051 Ga0075364_10897956 Ga0075364_108979561 123
197 3300006178 Ga0075367_10000294 Ga0075367_1000029422 123
198 3300006195 Ga0075366_10000321 Ga0075366_100003212 123
199 3300006195 Ga0075366_10001235 Ga0075366_100012359 123
200 3300006195 Ga0075366_10001602 Ga0075366_100016022 123
201 3300006195 Ga0075366_10011237 Ga0075366_100112376 123
202 3300006237 Ga0097621_100000031 Ga0097621_10000003142 123
203 3300006358 Ga0068871_100000011 Ga0068871_10000001127 123
204 3300009093 Ga0105240_10077189 Ga0105240_100771894 123
205 3300009098 Ga0105245_10000007 Ga0105245_1000000745 123
206 3300009098 Ga0105245_10179453 Ga0105245_101794533 123
207 3300009148 Ga0105243_10011243 Ga0105243_100112432 123
208 3300009174 Ga0105241_10000003 Ga0105241_10000003728 123
209 3300009174 Ga0105241_10000636 Ga0105241_1000063618 123
210 3300009174 Ga0105241_10031652 Ga0105241_100316522 123
211 3300009986 Ga0105033_100261 Ga0105033_1002613 123
212 3300009993 Ga0105028_100119 Ga0105028_1001192 123
213 3300013100 Ga0157373_10000070 Ga0157373_1000007031 123
214 3300013102 Ga0157371_10001430 Ga0157371_1000143014 123
215 3300013105 Ga0157369_10001870 Ga0157369_100018708 123
216 3300013105 Ga0157369_10981855 Ga0157369_109818552 123
217 3300013296 Ga0157374_10000014 Ga0157374_1000001445 123
218 3300013296 Ga0157374_10170947 Ga0157374_101709473 123
219 3300013307 Ga0157372_10223664 Ga0157372_102236642 123
220 3300013307 Ga0157372_10970496 Ga0157372_109704962 123
221 3300014325 Ga0163163_10265406 Ga0163163_102654062 123
222 3300014745 Ga0157377_10048099 Ga0157377_100480993 123
223 3300025903 Ga0207680_10370947 Ga0207680_103709472 123
224 3300025911 Ga0207654_10000002 Ga0207654_10000002480 123
225 3300025911 Ga0207654_10000367 Ga0207654_1000036718 123
226 3300025911 Ga0207654_10079180 Ga0207654_100791802 123
227 3300025911 Ga0207654_10269625 Ga0207654_102696252 123
228 3300025918 Ga0207662_10392024 Ga0207662_103920244 123
229 3300025927 Ga0207687_10000008 Ga0207687_1000000845 123
230 3300025927 Ga0207687_10304202 Ga0207687_103042023 123
231 3300025935 Ga0207709_10016948 Ga0207709_100169484 123
232 3300025944 Ga0207661_10005032 Ga0207661_100050322 123
233 3300025944 Ga0207661_11736636 Ga0207661_117366362 123
234 3300025949 Ga0207667_10000003 Ga0207667_10000003417 123
235 3300025981 Ga0207640_11276631 Ga0207640_112766311 123
236 3300026078 Ga0207702_10000776 Ga0207702_1000077622 123
237 3300026078 Ga0207702_12116849 Ga0207702_121168491 123
238 3300026142 Ga0207698_10512782 Ga0207698_105127822 123
239 3300026142 Ga0207698_11648337 Ga0207698_116483372 123
240 3300027866 Ga0209813_10011165 Ga0209813_100111652 123
241 3300031251 Ga0265327_10019425 Ga0265327_100194252 123
242 3300037418 Ga0395900_0008298 Ga0395900_0008298_10276_10653 123
243 3300037418 Ga0395900_0071653 Ga0395900_0071653_176_550 123
244 3300037466 Ga0395898_0019843 Ga0395898_0019843_3650_4027 123
245 3300037471 Ga0395905_0092584 Ga0395905_0092584_657_1034 123
246 3300038443 Ga0395901_0073101 Ga0395901_0073101_1157_1534 123
247 3300044684 Ga0466966_0263301 Ga0466966_0263301_271_669 123
248 3300046506 Ga0495583_0054555 Ga0495583_0054555_979_1350 123
249 3300046694 Ga0495649_0000526 Ga0495649_0000526_20999_21370 123
250 3300048929 Ga0496126_0583989 Ga0496126_0583989_415_786 123
251 3300049571 Ga0501034_0044313 Ga0501034_0044313_1688_2062 123
252 3300049573 Ga0501037_0052918 Ga0501037_0052918_539_913 123
253 3300049574 Ga0501038_0979895 Ga0501038_0979895_130_504 123
254 3300049585 Ga0501069_0393296 Ga0501069_0393296_139_513 123
255 3300050489 nmdc:mga03683_432038_c1 nmdc:mga03683_432038_c1_42_488 123
256 3300050491 nmdc:mga00v17_1444_c1 nmdc:mga00v17_1444_c1_4395_4766 123
257 3300050491 nmdc:mga00v17_1614_c3 nmdc:mga00v17_1614_c3_244_690 123
258 3300050492 nmdc:mga0yw44_71910_c1 nmdc:mga0yw44_71910_c1_1328_1774 123
259 3300050493 nmdc:mga0k408_10_c2 nmdc:mga0k408_10_c2_347_724 123
260 3300050493 nmdc:mga0k408_31587_c1 nmdc:mga0k408_31587_c1_359_730 123
261 3300050493 nmdc:mga0k408_4328_c1 nmdc:mga0k408_4328_c1_618_989 123
262 3300050493 nmdc:mga0k408_94_c2 nmdc:mga0k408_94_c2_21038_21409 123
263 3300050494 nmdc:mga06z11_376_c1 nmdc:mga06z11_376_c1_309_680 123
264 3300050495 nmdc:mga04h51_5536_c1 nmdc:mga04h51_5536_c1_1747_2118 123
265 3300050516 nmdc:mga0sz30_20591_c1 nmdc:mga0sz30_20591_c1_13_384 123
266 3300053108 Ga0500562_000002 Ga0500562_000002_616875_617246 123
267 3300053137 Ga0500561_0000002 Ga0500561_0000002_9827_10198 123
268 3300053150 Ga0500603_275329 Ga0500603_275329_99_473 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

142

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9457 2 121
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9411 2 122
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9391 2 121
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.9385 2 119
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9346 3 122
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9747 3 81 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9741 2 83 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9681 3 83 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9618 1 81 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9613 3 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2M7TUI9-F1-model_v4 Response regulatory domain-containing protein 1.001 1 123 GO:0000160
AF-A0A563CID5-F1-model_v4 Response regulator 0.995 2 105 GO:0000160
AF-A0A1F7RE38-F1-model_v4 Response regulatory domain-containing protein 0.9944 2 121 GO:0000160
AF-A0A2M7TUI9-F1-model_v4 Response regulatory domain-containing protein 0.993 1 123 GO:0000160
AF-A0A5C7J617-F1-model_v4 Response regulator 0.9925 2 105 GO:0000160

Feature Viewer

pLDDT pTM Quality
93.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map