F375811

General Info

Members Datasets Scaffolds Average Seq Length
268 130 536 158

Family's Representative Sequence

Representative Sequence 3300049779|Ga0501283_052237|Ga0501283_052237_135_626
Length 163
Sequence MKRRHLLPLALLAGAIVAWQRSSAPNAASPVAYPEGYRSWTHVKSTVISPAHRNFANTGGFQHIYANTEAMVGYRTRTFPEGSIVVFDWIEMRDRNGAFEEGPRRQLDVMVRHARFASTGGWGFQRFVKDSKTEVATAPSPEQCFACHDHLRKDGLILSTYRD

Samples

Sample ID Description Type Environment
1 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.37
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 25.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501283_052237 3300049779 Unclassified 726
2 Ga0065712_10217932 3300005290 Bacteria 1050
3 Ga0065715_10014920 3300005293 Bacteria 2307
4 Ga0065715_10582181 3300005293 Unclassified 719
5 Ga0065707_10276204 3300005295 Unclassified 1059
6 Ga0070690_100025911 3300005330 Bacteria 3613
7 Ga0070670_100049137 3300005331 Bacteria 3627
8 Ga0068869_100107115 3300005334 Bacteria 2122
9 Ga0068869_100777188 3300005334 Bacteria 821
10 Ga0068868_100172368 3300005338 Bacteria 1791
11 Ga0068868_100221938 3300005338 Unclassified 1582
12 Ga0068868_100312954 3300005338 Bacteria 1336
13 Ga0068868_101458521 3300005338 Bacteria 640
14 Ga0070692_10043502 3300005345 Unclassified 2309
15 Ga0070692_10647334 3300005345 Unclassified 705
16 Ga0070668_100112094 3300005347 Bacteria 2172
17 Ga0070669_100006671 3300005353 Bacteria 8312
18 Ga0070669_100123742 3300005353 Bacteria 1977
19 Ga0070669_100197114 3300005353 Bacteria 1583
20 Ga0070669_101196396 3300005353 Bacteria 656
21 Ga0070675_100286090 3300005354 Unclassified 1450
22 Ga0070675_100435827 3300005354 Unclassified 1174
23 Ga0070667_100884895 3300005367 Bacteria 831
24 Ga0070694_100033281 3300005444 Unclassified 3391
25 Ga0070694_100728058 3300005444 Unclassified 809
26 Ga0070694_100804284 3300005444 Unclassified 771
27 Ga0070678_100670095 3300005456 Bacteria 932
28 Ga0070662_100031694 3300005457 Bacteria 3712
29 Ga0068867_100344216 3300005459 Bacteria 1242
30 Ga0068867_100428434 3300005459 Bacteria 1122
31 Ga0070698_100008542 3300005471 Bacteria 11051
32 Ga0070698_100112493 3300005471 Bacteria 2687
33 Ga0070698_100421746 3300005471 Bacteria 1269
34 Ga0070698_100726100 3300005471 Unclassified 936
35 Ga0070698_101321540 3300005471 Bacteria 671
36 Ga0068853_100934031 3300005539 Bacteria 834
37 Ga0070672_100739294 3300005543 Bacteria 863
38 Ga0070686_100133879 3300005544 Bacteria 1717
39 Ga0070665_100048644 3300005548 Bacteria 4256
40 Ga0070704_100055814 3300005549 Bacteria 2802
41 Ga0068857_100054901 3300005577 Bacteria 3536
42 Ga0068857_100709632 3300005577 Bacteria 956
43 Ga0068859_100049837 3300005617 Unclassified 4206
44 Ga0068859_100327773 3300005617 Unclassified 1625
45 Ga0068859_100541829 3300005617 Bacteria 1258
46 Ga0068859_100611467 3300005617 Bacteria 1183
47 Ga0068864_100204009 3300005618 Bacteria 1818
48 Ga0068864_100445379 3300005618 Bacteria 1238
49 Ga0068864_100567615 3300005618 Bacteria 1098
50 Ga0068866_10015191 3300005718 Bacteria 3417
51 Ga0068861_100009836 3300005719 Bacteria 6615
52 Ga0068870_10004779 3300005840 Bacteria 5858
53 Ga0068863_100068364 3300005841 Bacteria 3360
54 Ga0068858_100384462 3300005842 Bacteria 1347
55 Ga0068858_101338474 3300005842 Bacteria 705
56 Ga0068860_100404671 3300005843 Bacteria 1351
57 Ga0068860_100603980 3300005843 Unclassified 1103
58 Ga0097621_100004689 3300006237 Bacteria 9549
59 Ga0097621_100022430 3300006237 Bacteria 4901
60 Ga0097621_100092298 3300006237 Bacteria 2536
61 Ga0097621_100213969 3300006237 Bacteria 1677
62 Ga0068871_100002498 3300006358 Bacteria 12547
63 Ga0068871_100029051 3300006358 Unclassified 4341
64 Ga0068871_100140474 3300006358 Bacteria 2053
65 Ga0068871_100504824 3300006358 Bacteria 1091
66 Ga0075428_100005473 3300006844 Bacteria 14119
67 Ga0075428_100565368 3300006844 Bacteria 1215
68 Ga0075428_100969771 3300006844 Unclassified 900
69 Ga0075430_100007664 3300006846 Bacteria 9117
70 Ga0075430_100008166 3300006846 Bacteria 8848
71 Ga0075430_100009468 3300006846 Bacteria 8232
72 Ga0075430_100020672 3300006846 Bacteria 5599
73 Ga0075430_100753560 3300006846 Unclassified 802
74 Ga0075430_101019079 3300006846 Unclassified 682
75 Ga0075431_100003861 3300006847 Bacteria 14570
76 Ga0075431_100020537 3300006847 Bacteria 6749
77 Ga0075431_100025666 3300006847 Bacteria 6040
78 Ga0075431_100126695 3300006847 Bacteria 2635
79 Ga0075431_100412733 3300006847 Bacteria 1350
80 Ga0075431_100448767 3300006847 Bacteria 1286
81 Ga0075431_100940094 3300006847 Bacteria 833
82 Ga0075434_100358193 3300006871 Bacteria 1480
83 Ga0075434_100664318 3300006871 Unclassified 1060
84 Ga0075434_101020916 3300006871 Bacteria 841
85 Ga0075429_100046736 3300006880 Bacteria 3766
86 Ga0075429_100292663 3300006880 Bacteria 1426
87 Ga0068865_100001846 3300006881 Bacteria 12430
88 Ga0068865_100981935 3300006881 Bacteria 739
89 Ga0097620_100049837 3300006931 Unclassified 4206
90 Ga0097620_100327807 3300006931 Unclassified 1625
91 Ga0097620_100541844 3300006931 Bacteria 1258
92 Ga0097620_100611401 3300006931 Bacteria 1183
93 Ga0111539_10032148 3300009094 Bacteria 6374
94 Ga0111539_10147949 3300009094 Bacteria 2750
95 Ga0111539_10360622 3300009094 Bacteria 1692
96 Ga0111539_10431645 3300009094 Bacteria 1534
97 Ga0111539_10461700 3300009094 Bacteria 1479
98 Ga0111539_11009433 3300009094 Unclassified 967
99 Ga0111539_11213736 3300009094 Unclassified 876
100 Ga0105245_10038072 3300009098 Unclassified 4277
101 Ga0105245_10140665 3300009098 Bacteria 2273
102 Ga0105245_10169978 3300009098 Bacteria 2075
103 Ga0105245_10171778 3300009098 Bacteria 2065
104 Ga0114129_10003655 3300009147 Bacteria 21639
105 Ga0114129_10104703 3300009147 Unclassified 3910
106 Ga0114129_10123150 3300009147 Unclassified 3567
107 Ga0114129_10129136 3300009147 Bacteria 3473
108 Ga0114129_11420413 3300009147 Unclassified 856
109 Ga0105243_10038445 3300009148 Bacteria 3726
110 Ga0105242_10006942 3300009176 Bacteria 8741
111 Ga0105242_10076819 3300009176 Bacteria 2785
112 Ga0105248_10068980 3300009177 Bacteria 3970
113 Ga0105248_10167951 3300009177 Unclassified 2473
114 Ga0105248_10272987 3300009177 Bacteria 1904
115 Ga0105248_10313505 3300009177 Bacteria 1767
116 Ga0105238_10000736 3300009551 Bacteria 34203
117 Ga0105249_10025018 3300009553 Bacteria 5372
118 Ga0105249_10155859 3300009553 Bacteria 2202
119 Ga0105249_10192945 3300009553 Bacteria 1989
120 Ga0105249_10282613 3300009553 Unclassified 1658
121 Ga0105239_11805604 3300010375 Bacteria 708
122 Ga0105246_10103762 3300011119 Bacteria 2075
123 Ga0105246_10316079 3300011119 Unclassified 1267
124 Ga0157378_10046282 3300013297 Bacteria 3867
125 Ga0157378_10086603 3300013297 Bacteria 2840
126 Ga0163162_10021100 3300013306 Bacteria 6407
127 Ga0163162_10165408 3300013306 Unclassified 2335
128 Ga0157375_10031934 3300013308 Bacteria 4988
129 Ga0157375_10058414 3300013308 Bacteria 3816
130 Ga0157375_10184989 3300013308 Bacteria 2236
131 Ga0157375_10582551 3300013308 Unclassified 1279
132 Ga0157375_11647506 3300013308 Unclassified 759
133 Ga0163163_10120329 3300014325 Bacteria 2659
134 Ga0163163_10574060 3300014325 Unclassified 1191
135 Ga0157380_10029488 3300014326 Bacteria 4193
136 Ga0157380_10337531 3300014326 Bacteria 1404
137 Ga0157380_11957269 3300014326 Bacteria 647
138 Ga0157376_10007517 3300014969 Bacteria 7787
139 Ga0157376_10034764 3300014969 Bacteria 4072
140 Ga0157376_10540385 3300014969 Bacteria 1152
141 Ga0207697_10329547 3300025315 Unclassified 678
142 Ga0207682_10478467 3300025893 Unclassified 590
143 Ga0207643_10003072 3300025908 Bacteria 8976
144 Ga0207643_10203853 3300025908 Bacteria 1205
145 Ga0207654_10253596 3300025911 Bacteria 1180
146 Ga0207662_10070186 3300025918 Bacteria 2119
147 Ga0207681_10299215 3300025923 Bacteria 1272
148 Ga0207694_10006182 3300025924 Bacteria 9145
149 Ga0207650_10085423 3300025925 Bacteria 2401
150 Ga0207650_10403315 3300025925 Bacteria 1132
151 Ga0207659_10037006 3300025926 Bacteria 3385
152 Ga0207659_10202869 3300025926 Unclassified 1585
153 Ga0207687_10205097 3300025927 Bacteria 1543
154 Ga0207687_10606146 3300025927 Bacteria 923
155 Ga0207644_10013119 3300025931 Bacteria 5517
156 Ga0207706_10050331 3300025933 Plasmid 3682
157 Ga0207706_10634043 3300025933 Bacteria 916
158 Ga0207686_10102844 3300025934 Bacteria 1910
159 Ga0207709_10161729 3300025935 Bacteria 1562
160 Ga0207709_10265695 3300025935 Bacteria 1260
161 Ga0207670_10107604 3300025936 Bacteria 2002
162 Ga0207704_10009876 3300025938 Bacteria 4626
163 Ga0207704_10070080 3300025938 Bacteria 2219
164 Ga0207691_10022629 3300025940 Bacteria 5927
165 Ga0207691_10532760 3300025940 Bacteria 996
166 Ga0207711_10053168 3300025941 Bacteria 3473
167 Ga0207711_10165344 3300025941 Bacteria 2005
168 Ga0207689_10046635 3300025942 Unclassified 3581
169 Ga0207689_10122607 3300025942 Bacteria 2138
170 Ga0207661_10145099 3300025944 Unclassified 2047
171 Ga0207651_11068632 3300025960 Bacteria 723
172 Ga0207712_10029403 3300025961 Bacteria 3686
173 Ga0207712_10096541 3300025961 Bacteria 2188
174 Ga0207712_10108754 3300025961 Bacteria 2075
175 Ga0207668_10056179 3300025972 Bacteria 2740
176 Ga0207677_10820479 3300026023 Unclassified 834
177 Ga0207703_10359836 3300026035 Bacteria 1342
178 Ga0207703_10706263 3300026035 Bacteria 959
179 Ga0207641_11682940 3300026088 Bacteria 636
180 Ga0207641_12467915 3300026088 Unclassified 518
181 Ga0207648_10009602 3300026089 Bacteria 9255
182 Ga0207648_10168819 3300026089 Bacteria 1933
183 Ga0207648_10274767 3300026089 Bacteria 1506
184 Ga0207676_10394244 3300026095 Bacteria 1292
185 Ga0207676_10840697 3300026095 Bacteria 897
186 Ga0207674_10070835 3300026116 Bacteria 3505
187 Ga0207675_100025816 3300026118 Bacteria 5466
188 Ga0207675_100055779 3300026118 Bacteria 3687
189 Ga0207675_100492613 3300026118 Bacteria 1219
190 Ga0207428_10004265 3300027907 Bacteria 13689
191 Ga0207428_10357625 3300027907 Bacteria 1073
192 Ga0207428_10888191 3300027907 Unclassified 630
193 Ga0268266_10018168 3300028379 Bacteria 5995
194 Ga0268265_10006126 3300028380 Bacteria 8159
195 Ga0268265_10120986 3300028380 Bacteria 2157
196 Ga0268265_10525671 3300028380 Bacteria 1119
197 Ga0268265_10792583 3300028380 Bacteria 923
198 Ga0268264_10282611 3300028381 Bacteria 1555
199 Ga0268264_10710975 3300028381 Unclassified 998
200 Ga0268264_11679563 3300028381 Unclassified 646
201 Ga0307515_10654046 3300028794 Unclassified 664
202 Ga0307408_100019644 3300031548 Bacteria 4551
203 Ga0307408_101562803 3300031548 Unclassified 625
204 Ga0307514_10390272 3300031649 Unclassified 717
205 Ga0307516_10009334 3300031730 Bacteria 10952
206 Ga0307405_10184508 3300031731 Unclassified 1501
207 Ga0307413_10193323 3300031824 Unclassified 1463
208 Ga0307413_11120641 3300031824 Unclassified 681
209 Ga0307410_10965192 3300031852 Unclassified 733
210 Ga0307406_10121348 3300031901 Bacteria 1818
211 Ga0307407_10357807 3300031903 Unclassified 1036
212 Ga0307412_11268036 3300031911 Bacteria 662
213 Ga0307416_100007495 3300032002 Bacteria 6946
214 Ga0307416_100077594 3300032002 Bacteria 2791
215 Ga0307416_100122123 3300032002 Unclassified 2324
216 Ga0307416_100514775 3300032002 Bacteria 1264
217 Ga0307411_11140412 3300032005 Unclassified 704
218 Ga0450894_049632 3300042131 Unclassified 616
219 Ga0451576_0304240 3300045051 Bacteria 1668
220 Ga0495638_0115539 3300046460 Bacteria 1590
221 Ga0495663_0295366 3300046525 Unclassified 582
222 Ga0495636_0532064 3300047318 Unclassified 570
223 Ga0495672_0003785 3300047320 Bacteria 12738
224 Ga0496114_0037392 3300048917 Unclassified 4015
225 Ga0501031_0130053 3300049568 Bacteria 1645
226 Ga0501037_0436478 3300049573 Bacteria 895
227 Ga0501038_0099015 3300049574 Bacteria 2431
228 Ga0501039_0453045 3300049575 Bacteria 1008
229 Ga0501039_0739035 3300049575 Bacteria 769
230 Ga0501040_0927727 3300049576 Bacteria 631
231 Ga0501070_0418042 3300049586 Bacteria 1083
232 Ga0501072_1013970 3300049588 Unclassified 647
233 Ga0501075_0034657 3300049591 Bacteria 3760
234 Ga0501075_0658702 3300049591 Bacteria 798
235 Ga0501076_0064122 3300049592 Bacteria 2928
236 Ga0501076_1368078 3300049592 Unclassified 582
237 Ga0501079_0068162 3300049741 Bacteria 2746
238 Ga0501080_0050745 3300049742 Bacteria 3861
239 nmdc:mga05p37_109185_c1 3300050507 Bacteria 3403
240 nmdc:mga05p37_1121356_c1 3300050507 Unclassified 821
241 nmdc:mga05p37_1249_c1 3300050507 Bacteria 29520
242 nmdc:mga05p37_139836_c1 3300050507 Unclassified 2967
243 nmdc:mga09592_1240515_c1 3300050508 Unclassified 615
244 nmdc:mga09592_151502_c1 3300050508 Bacteria 2001
245 nmdc:mga09592_38789_c1 3300050508 Bacteria 3999
246 nmdc:mga09592_619_c1 3300050508 Bacteria 27079
247 nmdc:mga09592_657795_c1 3300050508 Unclassified 894
248 nmdc:mga0qj67_154062_c1 3300050509 Bacteria 1865
249 nmdc:mga0qj67_27146_c1 3300050509 Bacteria 4435
250 nmdc:mga0qj67_28559_c1 3300050509 Bacteria 4331
251 nmdc:mga0qj67_30474_c1 3300050509 Bacteria 4200
252 nmdc:mga0qj67_6445_c1 3300050509 Bacteria 8626
253 nmdc:mga06r32_284110_c1 3300050510 Bacteria 1642
254 nmdc:mga06r32_324899_c1 3300050510 Unclassified 1524
255 nmdc:mga06r32_387555_c1 3300050510 Bacteria 1380
256 nmdc:mga06r32_450_c1 3300050510 Bacteria 34949
257 nmdc:mga06r32_61687_c1 3300050510 Bacteria 3610
258 nmdc:mga06r32_707776_c1 3300050510 Bacteria 972
259 nmdc:mga06r32_916329_c1 3300050510 Bacteria 832
260 nmdc:mga08y16_1471_c1 3300050511 Bacteria 23637
261 nmdc:mga08y16_223590_c1 3300050511 Bacteria 1948
262 nmdc:mga08y16_243794_c1 3300050511 Unclassified 1857
263 nmdc:mga08y16_388374_c1 3300050511 Bacteria 1430
264 nmdc:mga08y16_586756_c1 3300050511 Unclassified 1124
265 nmdc:mga0n895_546131_c1 3300050512 Archaea 1165
266 Ga0500592_022510 3300053116 Bacteria 1016
267 Ga0500658_0129138 3300053134 Bacteria 1126
268 Ga0501082_0028939 3300060353 Bacteria 4773
269 Ga0501283_052237
270 Ga0065712_10217932
271 Ga0065715_10014920
272 Ga0065715_10582181
273 Ga0065707_10276204
274 Ga0070690_100025911
275 Ga0070670_100049137
276 Ga0068869_100107115
277 Ga0068869_100777188
278 Ga0068868_100172368
279 Ga0068868_100221938
280 Ga0068868_100312954
281 Ga0068868_101458521
282 Ga0070692_10043502
283 Ga0070692_10647334
284 Ga0070668_100112094
285 Ga0070669_100006671
286 Ga0070669_100123742
287 Ga0070669_100197114
288 Ga0070669_101196396
289 Ga0070675_100286090
290 Ga0070675_100435827
291 Ga0070667_100884895
292 Ga0070694_100033281
293 Ga0070694_100728058
294 Ga0070694_100804284
295 Ga0070678_100670095
296 Ga0070662_100031694
297 Ga0068867_100344216
298 Ga0068867_100428434
299 Ga0070698_100008542
300 Ga0070698_100112493
301 Ga0070698_100421746
302 Ga0070698_100726100
303 Ga0070698_101321540
304 Ga0068853_100934031
305 Ga0070672_100739294
306 Ga0070686_100133879
307 Ga0070665_100048644
308 Ga0070704_100055814
309 Ga0068857_100054901
310 Ga0068857_100709632
311 Ga0068859_100049837
312 Ga0068859_100327773
313 Ga0068859_100541829
314 Ga0068859_100611467
315 Ga0068864_100204009
316 Ga0068864_100445379
317 Ga0068864_100567615
318 Ga0068866_10015191
319 Ga0068861_100009836
320 Ga0068870_10004779
321 Ga0068863_100068364
322 Ga0068858_100384462
323 Ga0068858_101338474
324 Ga0068860_100404671
325 Ga0068860_100603980
326 Ga0097621_100004689
327 Ga0097621_100022430
328 Ga0097621_100092298
329 Ga0097621_100213969
330 Ga0068871_100002498
331 Ga0068871_100029051
332 Ga0068871_100140474
333 Ga0068871_100504824
334 Ga0075428_100005473
335 Ga0075428_100565368
336 Ga0075428_100969771
337 Ga0075430_100007664
338 Ga0075430_100008166
339 Ga0075430_100009468
340 Ga0075430_100020672
341 Ga0075430_100753560
342 Ga0075430_101019079
343 Ga0075431_100003861
344 Ga0075431_100020537
345 Ga0075431_100025666
346 Ga0075431_100126695
347 Ga0075431_100412733
348 Ga0075431_100448767
349 Ga0075431_100940094
350 Ga0075434_100358193
351 Ga0075434_100664318
352 Ga0075434_101020916
353 Ga0075429_100046736
354 Ga0075429_100292663
355 Ga0068865_100001846
356 Ga0068865_100981935
357 Ga0097620_100049837
358 Ga0097620_100327807
359 Ga0097620_100541844
360 Ga0097620_100611401
361 Ga0111539_10032148
362 Ga0111539_10147949
363 Ga0111539_10360622
364 Ga0111539_10431645
365 Ga0111539_10461700
366 Ga0111539_11009433
367 Ga0111539_11213736
368 Ga0105245_10038072
369 Ga0105245_10140665
370 Ga0105245_10169978
371 Ga0105245_10171778
372 Ga0114129_10003655
373 Ga0114129_10104703
374 Ga0114129_10123150
375 Ga0114129_10129136
376 Ga0114129_11420413
377 Ga0105243_10038445
378 Ga0105242_10006942
379 Ga0105242_10076819
380 Ga0105248_10068980
381 Ga0105248_10167951
382 Ga0105248_10272987
383 Ga0105248_10313505
384 Ga0105238_10000736
385 Ga0105249_10025018
386 Ga0105249_10155859
387 Ga0105249_10192945
388 Ga0105249_10282613
389 Ga0105239_11805604
390 Ga0105246_10103762
391 Ga0105246_10316079
392 Ga0157378_10046282
393 Ga0157378_10086603
394 Ga0163162_10021100
395 Ga0163162_10165408
396 Ga0157375_10031934
397 Ga0157375_10058414
398 Ga0157375_10184989
399 Ga0157375_10582551
400 Ga0157375_11647506
401 Ga0163163_10120329
402 Ga0163163_10574060
403 Ga0157380_10029488
404 Ga0157380_10337531
405 Ga0157380_11957269
406 Ga0157376_10007517
407 Ga0157376_10034764
408 Ga0157376_10540385
409 Ga0207697_10329547
410 Ga0207682_10478467
411 Ga0207643_10003072
412 Ga0207643_10203853
413 Ga0207654_10253596
414 Ga0207662_10070186
415 Ga0207681_10299215
416 Ga0207694_10006182
417 Ga0207650_10085423
418 Ga0207650_10403315
419 Ga0207659_10037006
420 Ga0207659_10202869
421 Ga0207687_10205097
422 Ga0207687_10606146
423 Ga0207644_10013119
424 Ga0207706_10050331
425 Ga0207706_10634043
426 Ga0207686_10102844
427 Ga0207709_10161729
428 Ga0207709_10265695
429 Ga0207670_10107604
430 Ga0207704_10009876
431 Ga0207704_10070080
432 Ga0207691_10022629
433 Ga0207691_10532760
434 Ga0207711_10053168
435 Ga0207711_10165344
436 Ga0207689_10046635
437 Ga0207689_10122607
438 Ga0207661_10145099
439 Ga0207651_11068632
440 Ga0207712_10029403
441 Ga0207712_10096541
442 Ga0207712_10108754
443 Ga0207668_10056179
444 Ga0207677_10820479
445 Ga0207703_10359836
446 Ga0207703_10706263
447 Ga0207641_11682940
448 Ga0207641_12467915
449 Ga0207648_10009602
450 Ga0207648_10168819
451 Ga0207648_10274767
452 Ga0207676_10394244
453 Ga0207676_10840697
454 Ga0207674_10070835
455 Ga0207675_100025816
456 Ga0207675_100055779
457 Ga0207675_100492613
458 Ga0207428_10004265
459 Ga0207428_10357625
460 Ga0207428_10888191
461 Ga0268266_10018168
462 Ga0268265_10006126
463 Ga0268265_10120986
464 Ga0268265_10525671
465 Ga0268265_10792583
466 Ga0268264_10282611
467 Ga0268264_10710975
468 Ga0268264_11679563
469 Ga0307515_10654046
470 Ga0307408_100019644
471 Ga0307408_101562803
472 Ga0307514_10390272
473 Ga0307516_10009334
474 Ga0307405_10184508
475 Ga0307413_10193323
476 Ga0307413_11120641
477 Ga0307410_10965192
478 Ga0307406_10121348
479 Ga0307407_10357807
480 Ga0307412_11268036
481 Ga0307416_100007495
482 Ga0307416_100077594
483 Ga0307416_100122123
484 Ga0307416_100514775
485 Ga0307411_11140412
486 Ga0450894_049632
487 Ga0451576_0304240
488 Ga0495638_0115539
489 Ga0495663_0295366
490 Ga0495636_0532064
491 Ga0495672_0003785
492 Ga0496114_0037392
493 Ga0501031_0130053
494 Ga0501037_0436478
495 Ga0501038_0099015
496 Ga0501039_0453045
497 Ga0501039_0739035
498 Ga0501040_0927727
499 Ga0501070_0418042
500 Ga0501072_1013970
501 Ga0501075_0034657
502 Ga0501075_0658702
503 Ga0501076_0064122
504 Ga0501076_1368078
505 Ga0501079_0068162
506 Ga0501080_0050745
507 nmdc:mga05p37_109185_c1
508 nmdc:mga05p37_1121356_c1
509 nmdc:mga05p37_1249_c1
510 nmdc:mga05p37_139836_c1
511 nmdc:mga09592_1240515_c1
512 nmdc:mga09592_151502_c1
513 nmdc:mga09592_38789_c1
514 nmdc:mga09592_619_c1
515 nmdc:mga09592_657795_c1
516 nmdc:mga0qj67_154062_c1
517 nmdc:mga0qj67_27146_c1
518 nmdc:mga0qj67_28559_c1
519 nmdc:mga0qj67_30474_c1
520 nmdc:mga0qj67_6445_c1
521 nmdc:mga06r32_284110_c1
522 nmdc:mga06r32_324899_c1
523 nmdc:mga06r32_387555_c1
524 nmdc:mga06r32_450_c1
525 nmdc:mga06r32_61687_c1
526 nmdc:mga06r32_707776_c1
527 nmdc:mga06r32_916329_c1
528 nmdc:mga08y16_1471_c1
529 nmdc:mga08y16_223590_c1
530 nmdc:mga08y16_243794_c1
531 nmdc:mga08y16_388374_c1
532 nmdc:mga08y16_586756_c1
533 nmdc:mga0n895_546131_c1
534 Ga0500592_022510
535 Ga0500658_0129138
536 Ga0501082_0028939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

34

159

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.9015 29 163
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.9012 29 163
7zrw-assembly1.cif.gz_B f61v cytochrome c prime beta from methylococcus capsulatus (bath) 0.8986 29 163
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.8892 29 163
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.8889 29 163
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.755 33 158 3.50.70.20
af_Q54CS9_3_300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6401 60 127 3.40.50.300
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.6062 33 158 3.50.70.20
6c07B01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.5606 70 111 3.30.300.10
af_K7UFB2_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5089 60 147 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1QY38-F1-model_v4 Cytochrome C 0.9232 27 111
AF-A0A7C2YYF6-F1-model_v4 Cytochrome C 0.915 29 163
AF-A0A841HUP4-F1-model_v4 Cytochrome P460 domain-containing protein 0.9118 20 163
AF-A0A3B7MIX4-F1-model_v4 Cytochrome C 0.9077 23 163
AF-A0A2G2M643-F1-model_v4 Cytochrome C 0.9067 29 163

Map