F375756

General Info

Members Datasets Scaffolds Average Seq Length
268 158 268 129

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0169707|Ga0495686_0169707_209_643
Length 144
Sequence MAETITERAAANFTVRAVARGVDQTPRKVSLVAALVRNRTVADALVILEHVPKRAALPVKKVIESAKANAVNNHGLDGKTLTISTLTVTTGPRLRRFKPASRGRALPFEKKTSHILVEVSGAEKAKKKPAAVKASADEKKEETK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
97 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
98 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
114 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
115 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
116 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
152 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
156 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.88
Nodule 0
Rhizoplane 0.75
Rhizosphere 73.51
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1019759 3300001904 Bacteria 1062
2 JGI24741J21665_1000163 3300001915 Bacteria 19099
3 JGI24741J21665_1021927 3300001915 Bacteria 994
4 JGI24740J21852_10004196 3300001979 Bacteria 6224
5 JGI24740J21852_10006058 3300001979 Bacteria 5054
6 JGI24740J21852_10017869 3300001979 Bacteria 2528
7 JGI24739J22299_10002659 3300001989 Bacteria 6878
8 JGI24737J22298_10000106 3300001990 Bacteria 25250
9 JGI24737J22298_10001063 3300001990 Bacteria 9703
10 JGI24735J21928_10000051 3300002067 Bacteria 50715
11 JGI24735J21928_10000083 3300002067 Bacteria 36242
12 JGI24738J21930_10000517 3300002075 Bacteria 11027
13 rootL2_10155344 3300003322 Bacteria 1423
14 rootH1_10143678 3300003323 Bacteria 1367
15 Ga0065712_10699663 3300005290 Unclassified 547
16 Ga0070658_10000038 3300005327 Bacteria 137159
17 Ga0070658_11250604 3300005327 Bacteria 645
18 Ga0070676_10388293 3300005328 Bacteria 968
19 Ga0070676_10479601 3300005328 Bacteria 879
20 Ga0070683_100285794 3300005329 Bacteria 1569
21 Ga0068869_100167014 3300005334 Bacteria 1717
22 Ga0068869_100169510 3300005334 Bacteria 1705
23 Ga0070680_100370040 3300005336 Bacteria 1219
24 Ga0070660_100000786 3300005339 Bacteria 21098
25 Ga0070660_100024393 3300005339 Bacteria 4485
26 Ga0070661_100147954 3300005344 Bacteria 1774
27 Ga0070675_100238862 3300005354 Bacteria 1587
28 Ga0070673_101291308 3300005364 Bacteria 685
29 Ga0070659_100958790 3300005366 Bacteria 749
30 Ga0070700_101034656 3300005441 Bacteria 677
31 Ga0070708_100022492 3300005445 Bacteria 5348
32 Ga0070662_100007860 3300005457 Bacteria 6928
33 Ga0070685_11251976 3300005466 Bacteria 565
34 Ga0070684_100001744 3300005535 Bacteria 15831
35 Ga0070684_100420548 3300005535 Bacteria 1233
36 Ga0070696_100597431 3300005546 Bacteria 889
37 Ga0068855_100000011 3300005563 Bacteria 244140
38 Ga0068855_100005792 3300005563 Bacteria 15086
39 Ga0068855_102444556 3300005563 Bacteria 521
40 Ga0070664_100044797 3300005564 Bacteria 3736
41 Ga0070664_100669181 3300005564 Bacteria 965
42 Ga0068857_100004496 3300005577 Bacteria 11786
43 Ga0068857_100012235 3300005577 Bacteria 7466
44 Ga0068857_100017321 3300005577 Bacteria 6311
45 Ga0068854_100170322 3300005578 Bacteria 1694
46 Ga0068856_100001797 3300005614 Bacteria 22390
47 Ga0068856_100094762 3300005614 Bacteria 2972
48 Ga0068856_101910983 3300005614 Bacteria 604
49 Ga0068852_100000001 3300005616 Bacteria 716526
50 Ga0068852_100000135 3300005616 Bacteria 49773
51 Ga0068852_100021496 3300005616 Bacteria 5154
52 Ga0068852_100076235 3300005616 Bacteria 2960
53 Ga0081455_10000001 3300005937 Bacteria 603871
54 Ga0075365_10000049 3300006038 Bacteria 38677
55 Ga0075365_10040790 3300006038 Bacteria 3029
56 Ga0075365_10077730 3300006038 Bacteria 2242
57 Ga0075365_10139212 3300006038 Bacteria 1684
58 Ga0075365_10410915 3300006038 Bacteria 955
59 Ga0075368_10000022 3300006042 Bacteria 37479
60 Ga0075363_100013867 3300006048 Bacteria 3922
61 Ga0075364_10008868 3300006051 Bacteria 6021
62 Ga0075364_10033950 3300006051 Bacteria 3288
63 Ga0075364_10209140 3300006051 Bacteria 1323
64 Ga0075364_10512546 3300006051 Bacteria 820
65 Ga0075362_10012646 3300006177 Bacteria 3359
66 Ga0075362_10578485 3300006177 Bacteria 579
67 Ga0075367_10678985 3300006178 Bacteria 655
68 Ga0075369_10000077 3300006186 Bacteria 25424
69 Ga0075369_10000098 3300006186 Bacteria 23291
70 Ga0075369_10002696 3300006186 Bacteria 6366
71 Ga0075366_10000001 3300006195 Bacteria 569172
72 Ga0075366_10000147 3300006195 Bacteria 29801
73 Ga0075366_10002227 3300006195 Bacteria 9899
74 Ga0075366_10006218 3300006195 Bacteria 6520
75 Ga0075366_10007166 3300006195 Bacteria 6141
76 Ga0075366_10447295 3300006195 Bacteria 797
77 Ga0075366_10568627 3300006195 Bacteria 702
78 Ga0097621_100000003 3300006237 Bacteria 164830
79 Ga0075370_10019329 3300006353 Bacteria 3709
80 Ga0075370_10019856 3300006353 Bacteria 3662
81 Ga0075370_10112736 3300006353 Bacteria 1580
82 Ga0075370_10662885 3300006353 Bacteria 634
83 Ga0068871_100000013 3300006358 Bacteria 102533
84 Ga0068871_100051755 3300006358 Bacteria 3325
85 Ga0075428_100002637 3300006844 Bacteria 19511
86 Ga0068865_100002319 3300006881 Bacteria 11217
87 Ga0105244_10093216 3300009036 Bacteria 1480
88 Ga0105240_10000004 3300009093 Bacteria 708156
89 Ga0105240_10000789 3300009093 Bacteria 57388
90 Ga0105240_10040725 3300009093 Bacteria 5938
91 Ga0105245_10054078 3300009098 Bacteria 3605
92 Ga0105243_10010600 3300009148 Bacteria 6997
93 Ga0105241_10017679 3300009174 Bacteria 5242
94 Ga0105241_10081719 3300009174 Bacteria 2532
95 Ga0105241_10269717 3300009174 Bacteria 1449
96 Ga0105248_12919693 3300009177 Bacteria 545
97 Ga0105237_10000001 3300009545 Bacteria 1009213
98 Ga0105237_10000002 3300009545 Bacteria 702357
99 Ga0105238_10000463 3300009551 Bacteria 42690
100 Ga0105238_10027003 3300009551 Bacteria 5851
101 Ga0105238_10086605 3300009551 Bacteria 3120
102 Ga0105032_100001 3300009979 Bacteria 472394
103 Ga0105239_10000261 3300010375 Bacteria 78396
104 Ga0105246_10395631 3300011119 Bacteria 1146
105 Ga0105246_11693675 3300011119 Bacteria 601
106 Ga0157313_1006494 3300012503 Bacteria 881
107 Ga0157373_10000583 3300013100 Bacteria 28402
108 Ga0157373_10300959 3300013100 Bacteria 1138
109 Ga0157373_11119108 3300013100 Bacteria 591
110 Ga0157371_10000176 3300013102 Bacteria 93047
111 Ga0157371_10016956 3300013102 Bacteria 5424
112 Ga0157371_10033667 3300013102 Bacteria 3680
113 Ga0157370_10003644 3300013104 Bacteria 18007
114 Ga0157370_10338346 3300013104 Bacteria 1387
115 Ga0157370_10523302 3300013104 Bacteria 1088
116 Ga0157369_10000009 3300013105 Bacteria 303674
117 Ga0157369_10019411 3300013105 Bacteria 7604
118 Ga0157369_10053031 3300013105 Bacteria 4384
119 Ga0157369_10053040 3300013105 Bacteria 4384
120 Ga0157369_11796022 3300013105 Bacteria 623
121 Ga0157374_10005678 3300013296 Bacteria 10519
122 Ga0157374_10151826 3300013296 Bacteria 2252
123 Ga0157374_10903970 3300013296 Bacteria 900
124 Ga0157374_12162785 3300013296 Bacteria 583
125 Ga0157378_11091740 3300013297 Bacteria 835
126 Ga0157372_10000002 3300013307 Bacteria 687862
127 Ga0157372_10000008 3300013307 Bacteria 305449
128 Ga0157372_10014740 3300013307 Bacteria 8367
129 Ga0157372_10607497 3300013307 Bacteria 1275
130 Ga0157372_11939184 3300013307 Bacteria 677
131 Ga0157375_10989865 3300013308 Bacteria 981
132 Ga0157377_10006077 3300014745 Bacteria 5729
133 Ga0157377_10730207 3300014745 Bacteria 722
134 Ga0157376_10002503 3300014969 Bacteria 12443
135 Ga0206351_10378828 3300020077 Bacteria 3831
136 Ga0154015_1106666 3300020610 Bacteria 1204
137 Ga0207647_10000670 3300025904 Bacteria 26786
138 Ga0207643_10854970 3300025908 Bacteria 590
139 Ga0207705_10000051 3300025909 Bacteria 169369
140 Ga0207654_10001365 3300025911 Bacteria 12965
141 Ga0207654_10010971 3300025911 Bacteria 4613
142 Ga0207654_10090074 3300025911 Bacteria 1868
143 Ga0207654_10386355 3300025911 Bacteria 970
144 Ga0207707_10003287 3300025912 Bacteria 14366
145 Ga0207695_10002053 3300025913 Bacteria 30792
146 Ga0207695_10051029 3300025913 Bacteria 4346
147 Ga0207671_10000008 3300025914 Bacteria 798229
148 Ga0207657_10002122 3300025919 Bacteria 21466
149 Ga0207694_10001212 3300025924 Bacteria 22387
150 Ga0207694_10090801 3300025924 Bacteria 2410
151 Ga0207659_10350500 3300025926 Bacteria 1225
152 Ga0207687_10449382 3300025927 Bacteria 1068
153 Ga0207706_10000543 3300025933 Bacteria 40146
154 Ga0207704_10010834 3300025938 Bacteria 4465
155 Ga0207689_10174303 3300025942 Bacteria 1774
156 Ga0207661_10002824 3300025944 Bacteria 11992
157 Ga0207661_10020254 3300025944 Bacteria 4967
158 Ga0207679_10001254 3300025945 Bacteria 16096
159 Ga0207679_10543215 3300025945 Bacteria 1042
160 Ga0207667_10000042 3300025949 Bacteria 263461
161 Ga0207667_10008206 3300025949 Bacteria 12429
162 Ga0207712_10512916 3300025961 Unclassified 1026
163 Ga0207640_10166736 3300025981 Bacteria 1636
164 Ga0207708_10912846 3300026075 Bacteria 760
165 Ga0207702_10000001 3300026078 Bacteria 895738
166 Ga0207702_10003219 3300026078 Bacteria 15080
167 Ga0207702_10164384 3300026078 Bacteria 2029
168 Ga0207702_11322705 3300026078 Bacteria 715
169 Ga0207674_10001283 3300026116 Bacteria 32760
170 Ga0207674_10006337 3300026116 Bacteria 13931
171 Ga0207674_10059207 3300026116 Bacteria 3877
172 Ga0207675_100486711 3300026118 Bacteria 1227
173 Ga0207698_10000001 3300026142 Bacteria 625389
174 Ga0207698_10000100 3300026142 Bacteria 54808
175 Ga0207698_10058476 3300026142 Bacteria 2988
176 Ga0207698_10188895 3300026142 Bacteria 1833
177 Ga0265338_10000178 3300028800 Bacteria 118345
178 Ga0316179_1022679 3300030734 Bacteria 22602
179 Ga0316180_1026511 3300030736 Bacteria 2040
180 Ga0316183_1071475 3300030742 Bacteria 1495
181 Ga0316181_1075766 3300030744 Bacteria 1177
182 Ga0316182_1003781 3300030745 Bacteria 592
183 Ga0316182_1027054 3300030745 Bacteria 8931
184 Ga0316182_1196677 3300030745 Bacteria 1815
185 Ga0316182_1375605 3300030745 Bacteria 1705
186 Ga0265314_10318428 3300031711 Bacteria 866
187 Ga0307516_10007665 3300031730 Bacteria 12354
188 Ga0307413_11654679 3300031824 Bacteria 570
189 Ga0373959_0000077 3300034820 Bacteria 21647
190 Ga0395899_0007520 3300037312 Bacteria 8420
191 Ga0395899_0043119 3300037312 Bacteria 3366
192 Ga0395899_0440383 3300037312 Bacteria 855
193 Ga0395900_0000001 3300037418 Bacteria 931146
194 Ga0395900_0003612 3300037418 Bacteria 16623
195 Ga0395900_0120359 3300037418 Bacteria 2694
196 Ga0395900_0193416 3300037418 Bacteria 2062
197 Ga0395898_0000002 3300037466 Bacteria 931013
198 Ga0395898_0068534 3300037466 Bacteria 3433
199 Ga0395905_1643478 3300037471 Unclassified 547
200 Ga0395901_0000060 3300038443 Bacteria 152235
201 Ga0395901_0008414 3300038443 Bacteria 10428
202 Ga0395901_0320748 3300038443 Bacteria 1603
203 Ga0395901_1222659 3300038443 Bacteria 716
204 Ga0439431_0066886 3300041997 Bacteria 953
205 Ga0439445_0002978 3300042004 Bacteria 3788
206 Ga0439463_011598 3300042016 Bacteria 2163
207 Ga0450911_010626 3300042115 Bacteria 1268
208 Ga0450920_000153 3300042122 Bacteria 9520
209 Ga0450906_003262 3300042145 Bacteria 3504
210 Ga0450907_059341 3300042146 Bacteria 660
211 Ga0439446_0000001 3300042156 Bacteria 275840
212 Ga0450908_038826 3300042184 Bacteria 825
213 Ga0439434_0029982 3300042435 Bacteria 1650
214 Ga0439464_0000015 3300042439 Bacteria 23381
215 Ga0450918_051557 3300042531 Bacteria 750
216 Ga0466972_0028653 3300044658 Bacteria 2746
217 Ga0466965_0000096 3300044683 Bacteria 25539
218 Ga0466970_0189737 3300044765 Bacteria 1142
219 Ga0495587_0212883 3300046536 Bacteria 1091
220 Ga0495634_0175662 3300046642 Bacteria 1344
221 Ga0495649_0000182 3300046694 Bacteria 54760
222 Ga0495672_0110051 3300047320 Bacteria 1480
223 Ga0495680_0209202 3300047322 Bacteria 1397
224 Ga0495686_0169707 3300047472 Bacteria 1269
225 Ga0495593_0047847 3300047673 Bacteria 2274
226 Ga0496101_0411248 3300048904 Bacteria 1066
227 Ga0496102_0601141 3300048905 Bacteria 1023
228 Ga0496118_0478294 3300048921 Bacteria 625
229 Ga0496124_0070099 3300048927 Bacteria 2909
230 Ga0501034_0911382 3300049571 Bacteria 766
231 Ga0501037_0273496 3300049573 Bacteria 1178
232 Ga0501070_0278085 3300049586 Bacteria 1366
233 nmdc:mga00v17_293333_c1 3300050491 Bacteria 1056
234 nmdc:mga00v17_313528_c1 3300050491 Bacteria 1019
235 nmdc:mga00v17_501503_c1 3300050491 Bacteria 787
236 nmdc:mga00v17_731783_c1 3300050491 Bacteria 633
237 nmdc:mga00v17_770426_c1 3300050491 Bacteria 614
238 nmdc:mga0yw44_30920_c1 3300050492 Bacteria 3109
239 nmdc:mga0yw44_45419_c1 3300050492 Bacteria 2633
240 nmdc:mga0yw44_63_c1 3300050492 Bacteria 38664
241 nmdc:mga0yw44_7217_c1 3300050492 Bacteria 5445
242 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
243 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
244 nmdc:mga0k408_2531_c1 3300050493 Bacteria 9718
245 nmdc:mga0k408_3588_c1 3300050493 Bacteria 7866
246 nmdc:mga0k408_498831_c1 3300050493 Bacteria 721
247 nmdc:mga0k408_597130_c1 3300050493 Bacteria 651
248 nmdc:mga0k408_6815_c1 3300050493 Bacteria 6090
249 nmdc:mga06z11_196598_c1 3300050494 Bacteria 1169
250 nmdc:mga07m45_107949_c1 3300050496 Bacteria 1601
251 nmdc:mga07m45_147414_c2 3300050496 Bacteria 680
252 nmdc:mga07m45_81995_c1 3300050496 Bacteria 1842
253 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
254 nmdc:mga0sz30_8_c2 3300050516 Bacteria 48225
255 Ga0500643_011833 3300053087 Bacteria 3158
256 Ga0500651_0000203 3300053093 Bacteria 37688
257 Ga0500566_0000001 3300053094 Bacteria 1101031
258 Ga0500554_120979 3300053102 Bacteria 883
259 Ga0500555_000006 3300053103 Bacteria 304416
260 Ga0500614_000001 3300053123 Bacteria 1274484
261 Ga0500561_0000001 3300053137 Bacteria 957685
262 Ga0500574_131425 3300053141 Bacteria 738
263 Ga0500577_0211815 3300053142 Bacteria 837
264 Ga0500616_0000012 3300053153 Bacteria 681798
265 Ga0500649_000014 3300053722 Bacteria 56198
266 Ga0500570_000171 3300053724 Bacteria 20296
267 Ga0500611_039288 3300053727 Bacteria 1030
268 Ga0500656_024784 3300053732 Bacteria 766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1643478 Ga0395905_1643478_21_359 98
2 3300053093 Ga0500651_0000203 Ga0500651_0000203_29639_30052 107
3 3300053102 Ga0500554_120979 Ga0500554_120979_425_838 107
4 3300005577 Ga0068857_100017321 Ga0068857_10001732113 112
5 3300026116 Ga0207674_10059207 Ga0207674_100592073 112
6 3300025961 Ga0207712_10512916 Ga0207712_105129162 113
7 3300025908 Ga0207643_10854970 Ga0207643_108549701 114
8 3300026118 Ga0207675_100486711 Ga0207675_1004867113 114
9 3300031824 Ga0307413_11654679 Ga0307413_116546792 116
10 3300037312 Ga0395899_0043119 Ga0395899_0043119_241_633 116
11 3300037418 Ga0395900_0003612 Ga0395900_0003612_15611_16003 116
12 3300037418 Ga0395900_0193416 Ga0395900_0193416_1389_1781 116
13 3300037466 Ga0395898_0068534 Ga0395898_0068534_2228_2620 116
14 3300038443 Ga0395901_0008414 Ga0395901_0008414_2421_2813 116
15 3300038443 Ga0395901_1222659 Ga0395901_1222659_265_657 116
16 3300041997 Ga0439431_0066886 Ga0439431_0066886_77_481 116
17 3300025912 Ga0207707_10003287 Ga0207707_1000328718 118
18 3300037418 Ga0395900_0120359 Ga0395900_0120359_1413_1805 118
19 3300038443 Ga0395901_0320748 Ga0395901_0320748_401_793 118
20 3300005328 Ga0070676_10388293 Ga0070676_103882932 120
21 3300006038 Ga0075365_10139212 Ga0075365_101392124 120
22 3300044658 Ga0466972_0028653 Ga0466972_0028653_711_1118 120
23 3300044683 Ga0466965_0000096 Ga0466965_0000096_1985_2392 120
24 3300050492 nmdc:mga0yw44_30920_c1 nmdc:mga0yw44_30920_c1_1417_1821 120
25 3300053123 Ga0500614_000001 Ga0500614_000001_229367_229735 120
26 3300053722 Ga0500649_000014 Ga0500649_000014_29751_30119 120
27 3300053724 Ga0500570_000171 Ga0500570_000171_3878_4276 120
28 3300042004 Ga0439445_0002978 Ga0439445_0002978_3074_3484 121
29 3300044765 Ga0466970_0189737 Ga0466970_0189737_619_1017 121
30 3300005290 Ga0065712_10699663 Ga0065712_106996631 122
31 3300006038 Ga0075365_10077730 Ga0075365_100777306 122
32 3300006038 Ga0075365_10410915 Ga0075365_104109151 122
33 3300006051 Ga0075364_10209140 Ga0075364_102091402 122
34 3300006177 Ga0075362_10578485 Ga0075362_105784852 122
35 3300006195 Ga0075366_10000147 Ga0075366_1000014711 122
36 3300009979 Ga0105032_100001 Ga0105032_100001147 122
37 3300026075 Ga0207708_10912846 Ga0207708_109128461 122
38 3300049573 Ga0501037_0273496 Ga0501037_0273496_32_409 122
39 3300049586 Ga0501070_0278085 Ga0501070_0278085_591_968 122
40 3300050491 nmdc:mga00v17_293333_c1 nmdc:mga00v17_293333_c1_479_856 122
41 3300050491 nmdc:mga00v17_731783_c1 nmdc:mga00v17_731783_c1_128_502 122
42 3300050492 nmdc:mga0yw44_7217_c1 nmdc:mga0yw44_7217_c1_1657_2031 122
43 3300050493 nmdc:mga0k408_597130_c1 nmdc:mga0k408_597130_c1_121_498 122
44 3300005334 Ga0068869_100169510 Ga0068869_1001695103 123
45 3300005441 Ga0070700_101034656 Ga0070700_1010346562 123
46 3300006051 Ga0075364_10512546 Ga0075364_105125462 123
47 3300006178 Ga0075367_10678985 Ga0075367_106789851 123
48 3300006186 Ga0075369_10000077 Ga0075369_1000007724 123
49 3300006195 Ga0075366_10000001 Ga0075366_10000001376 123
50 3300006353 Ga0075370_10112736 Ga0075370_101127363 123
51 3300009148 Ga0105243_10010600 Ga0105243_1001060014 123
52 3300009177 Ga0105248_12919693 Ga0105248_129196932 123
53 3300013102 Ga0157371_10000176 Ga0157371_1000017616 123
54 3300013105 Ga0157369_11796022 Ga0157369_117960222 123
55 3300030734 Ga0316179_1022679 Ga0316179_10226798 123
56 3300030736 Ga0316180_1026511 Ga0316180_10265113 123
57 3300030742 Ga0316183_1071475 Ga0316183_10714752 123
58 3300030744 Ga0316181_1075766 Ga0316181_10757662 123
59 3300030745 Ga0316182_1027054 Ga0316182_102705414 123
60 3300046536 Ga0495587_0212883 Ga0495587_0212883_192_569 123
61 3300047673 Ga0495593_0047847 Ga0495593_0047847_304_681 123
62 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_738559_738936 123
63 3300050494 nmdc:mga06z11_196598_c1 nmdc:mga06z11_196598_c1_765_1142 123
64 3300050496 nmdc:mga07m45_107949_c1 nmdc:mga07m45_107949_c1_782_1159 123
65 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_313627_314004 123
66 3300050516 nmdc:mga0sz30_8_c2 nmdc:mga0sz30_8_c2_2767_3144 123
67 3300053094 Ga0500566_0000001 Ga0500566_0000001_676441_676818 123
68 3300053141 Ga0500574_131425 Ga0500574_131425_27_404 123
69 3300053727 Ga0500611_039288 Ga0500611_039288_466_864 123
70 3300001915 JGI24741J21665_1021927 JGI24741J21665_10219271 124
71 3300001990 JGI24737J22298_10000106 JGI24737J22298_1000010633 124
72 3300002067 JGI24735J21928_10000083 JGI24735J21928_1000008317 124
73 3300005328 Ga0070676_10479601 Ga0070676_104796012 124
74 3300005329 Ga0070683_100285794 Ga0070683_1002857942 124
75 3300005535 Ga0070684_100001744 Ga0070684_10000174410 124
76 3300005614 Ga0068856_100001797 Ga0068856_10000179739 124
77 3300005616 Ga0068852_100021496 Ga0068852_1000214968 124
78 3300005937 Ga0081455_10000001 Ga0081455_10000001151 124
79 3300009093 Ga0105240_10040725 Ga0105240_100407255 124
80 3300009174 Ga0105241_10081719 Ga0105241_100817192 124
81 3300013100 Ga0157373_10000583 Ga0157373_1000058317 124
82 3300013104 Ga0157370_10338346 Ga0157370_103383463 124
83 3300013296 Ga0157374_12162785 Ga0157374_121627852 124
84 3300013297 Ga0157378_11091740 Ga0157378_110917402 124
85 3300025911 Ga0207654_10001365 Ga0207654_1000136516 124
86 3300025911 Ga0207654_10386355 Ga0207654_103863552 124
87 3300025913 Ga0207695_10051029 Ga0207695_1005102910 124
88 3300025944 Ga0207661_10002824 Ga0207661_1000282422 124
89 3300026078 Ga0207702_10000001 Ga0207702_10000001836 124
90 3300026078 Ga0207702_10003219 Ga0207702_1000321928 124
91 3300026142 Ga0207698_10188895 Ga0207698_101888953 124
92 3300028800 Ga0265338_10000178 Ga0265338_1000017896 124
93 3300031711 Ga0265314_10318428 Ga0265314_103184282 124
94 3300050491 nmdc:mga00v17_770426_c1 nmdc:mga00v17_770426_c1_105_488 124
95 3300053137 Ga0500561_0000001 Ga0500561_0000001_533014_533391 124
96 3300001915 JGI24741J21665_1000163 JGI24741J21665_100016325 125
97 3300001979 JGI24740J21852_10004196 JGI24740J21852_1000419613 125
98 3300005546 Ga0070696_100597431 Ga0070696_1005974311 125
99 3300006038 Ga0075365_10040790 Ga0075365_100407904 125
100 3300006051 Ga0075364_10008868 Ga0075364_1000886810 125
101 3300006195 Ga0075366_10006218 Ga0075366_100062184 125
102 3300013296 Ga0157374_10903970 Ga0157374_109039702 125
103 3300014745 Ga0157377_10730207 Ga0157377_107302071 125
104 3300046694 Ga0495649_0000182 Ga0495649_0000182_7903_8292 125
105 3300050491 nmdc:mga00v17_501503_c1 nmdc:mga00v17_501503_c1_37_423 125
106 3300050492 nmdc:mga0yw44_45419_c1 nmdc:mga0yw44_45419_c1_2108_2494 125
107 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_56816_57202 125
108 3300050493 nmdc:mga0k408_6815_c1 nmdc:mga0k408_6815_c1_4444_4830 125
109 3300053732 Ga0500656_024784 Ga0500656_024784_65_478 125
110 3300053142 Ga0500577_0211815 Ga0500577_0211815_61_471 126
111 3300005614 Ga0068856_101910983 Ga0068856_1019109832 127
112 3300005616 Ga0068852_100000135 Ga0068852_10000013533 127
113 3300006042 Ga0075368_10000022 Ga0075368_1000002246 127
114 3300006048 Ga0075363_100013867 Ga0075363_1000138676 127
115 3300006051 Ga0075364_10033950 Ga0075364_100339506 127
116 3300006177 Ga0075362_10012646 Ga0075362_100126465 127
117 3300006186 Ga0075369_10000098 Ga0075369_1000009832 127
118 3300006195 Ga0075366_10447295 Ga0075366_104472952 127
119 3300006353 Ga0075370_10662885 Ga0075370_106628852 127
120 3300009036 Ga0105244_10093216 Ga0105244_100932162 127
121 3300009098 Ga0105245_10054078 Ga0105245_100540783 127
122 3300012503 Ga0157313_1006494 Ga0157313_10064942 127
123 3300013100 Ga0157373_10300959 Ga0157373_103009592 127
124 3300013102 Ga0157371_10016956 Ga0157371_100169561 127
125 3300013105 Ga0157369_10053031 Ga0157369_100530315 127
126 3300013296 Ga0157374_10005678 Ga0157374_1000567812 127
127 3300013307 Ga0157372_10014740 Ga0157372_1001474014 127
128 3300013308 Ga0157375_10989865 Ga0157375_109898652 127
129 3300014745 Ga0157377_10006077 Ga0157377_100060777 127
130 3300026078 Ga0207702_10164384 Ga0207702_101643844 127
131 3300026142 Ga0207698_10000100 Ga0207698_1000010033 127
132 3300030745 Ga0316182_1003781 Ga0316182_10037812 127
133 3300030745 Ga0316182_1375605 Ga0316182_13756053 127
134 3300031730 Ga0307516_10007665 Ga0307516_1000766517 127
135 3300042016 Ga0439463_011598 Ga0439463_011598_399_806 127
136 3300042146 Ga0450907_059341 Ga0450907_059341_59_460 127
137 3300042156 Ga0439446_0000001 Ga0439446_0000001_143211_143624 127
138 3300042435 Ga0439434_0029982 Ga0439434_0029982_556_969 127
139 3300042439 Ga0439464_0000015 Ga0439464_0000015_40_447 127
140 3300050491 nmdc:mga00v17_313528_c1 nmdc:mga00v17_313528_c1_103_498 127
141 3300050493 nmdc:mga0k408_2531_c1 nmdc:mga0k408_2531_c1_8461_8868 127
142 3300050496 nmdc:mga07m45_147414_c2 nmdc:mga07m45_147414_c2_87_482 127
143 3300005466 Ga0070685_11251976 Ga0070685_112519761 128
144 3300005564 Ga0070664_100044797 Ga0070664_1000447975 128
145 3300006195 Ga0075366_10568627 Ga0075366_105686272 128
146 3300006237 Ga0097621_100000003 Ga0097621_10000000395 128
147 3300006353 Ga0075370_10019329 Ga0075370_100193294 128
148 3300006358 Ga0068871_100000013 Ga0068871_10000001393 128
149 3300006844 Ga0075428_100002637 Ga0075428_10000263713 128
150 3300013102 Ga0157371_10033667 Ga0157371_100336674 128
151 3300013307 Ga0157372_11939184 Ga0157372_119391842 128
152 3300025945 Ga0207679_10543215 Ga0207679_105432152 128
153 3300030745 Ga0316182_1196677 Ga0316182_11966773 128
154 3300042115 Ga0450911_010626 Ga0450911_010626_216_620 128
155 3300042122 Ga0450920_000153 Ga0450920_000153_5585_5989 128
156 3300042145 Ga0450906_003262 Ga0450906_003262_55_459 128
157 3300042184 Ga0450908_038826 Ga0450908_038826_206_610 128
158 3300042531 Ga0450918_051557 Ga0450918_051557_123_527 128
159 3300049571 Ga0501034_0911382 Ga0501034_0911382_178_582 128
160 3300050493 nmdc:mga0k408_498831_c1 nmdc:mga0k408_498831_c1_54_452 128
161 3300050496 nmdc:mga07m45_81995_c1 nmdc:mga07m45_81995_c1_19_417 128
162 3300053103 Ga0500555_000006 Ga0500555_000006_182410_182808 128
163 3300053153 Ga0500616_0000012 Ga0500616_0000012_518898_519296 128
164 3300001979 JGI24740J21852_10017869 JGI24740J21852_100178692 129
165 3300005327 Ga0070658_11250604 Ga0070658_112506041 129
166 3300005445 Ga0070708_100022492 Ga0070708_1000224927 129
167 3300005563 Ga0068855_100000011 Ga0068855_10000001189 129
168 3300005563 Ga0068855_100005792 Ga0068855_1000057929 129
169 3300005577 Ga0068857_100004496 Ga0068857_1000044969 129
170 3300005578 Ga0068854_100170322 Ga0068854_1001703222 129
171 3300005616 Ga0068852_100000001 Ga0068852_100000001570 129
172 3300005616 Ga0068852_100076235 Ga0068852_1000762355 129
173 3300006038 Ga0075365_10000049 Ga0075365_1000004917 129
174 3300006195 Ga0075366_10007166 Ga0075366_100071667 129
175 3300009093 Ga0105240_10000789 Ga0105240_1000078922 129
176 3300009174 Ga0105241_10017679 Ga0105241_100176795 129
177 3300009545 Ga0105237_10000002 Ga0105237_10000002462 129
178 3300009551 Ga0105238_10000463 Ga0105238_1000046320 129
179 3300011119 Ga0105246_10395631 Ga0105246_103956312 129
180 3300013105 Ga0157369_10000009 Ga0157369_10000009284 129
181 3300013105 Ga0157369_10019411 Ga0157369_100194113 129
182 3300013296 Ga0157374_10151826 Ga0157374_101518262 129
183 3300013307 Ga0157372_10000008 Ga0157372_1000000825 129
184 3300013307 Ga0157372_10607497 Ga0157372_106074973 129
185 3300020077 Ga0206351_10378828 Ga0206351_103788285 129
186 3300020610 Ga0154015_1106666 Ga0154015_11066662 129
187 3300025911 Ga0207654_10010971 Ga0207654_100109714 129
188 3300025913 Ga0207695_10002053 Ga0207695_1000205322 129
189 3300025914 Ga0207671_10000008 Ga0207671_10000008567 129
190 3300025924 Ga0207694_10001212 Ga0207694_1000121221 129
191 3300025949 Ga0207667_10000042 Ga0207667_10000042201 129
192 3300025949 Ga0207667_10008206 Ga0207667_100082069 129
193 3300025981 Ga0207640_10166736 Ga0207640_101667363 129
194 3300026116 Ga0207674_10006337 Ga0207674_100063377 129
195 3300026142 Ga0207698_10000001 Ga0207698_10000001520 129
196 3300026142 Ga0207698_10058476 Ga0207698_100584765 129
197 3300046642 Ga0495634_0175662 Ga0495634_0175662_497_904 129
198 3300047320 Ga0495672_0110051 Ga0495672_0110051_139_546 129
199 3300048921 Ga0496118_0478294 Ga0496118_0478294_127_531 129
200 3300050492 nmdc:mga0yw44_63_c1 nmdc:mga0yw44_63_c1_7678_8079 129
201 3300050493 nmdc:mga0k408_3588_c1 nmdc:mga0k408_3588_c1_5025_5423 129
202 3300005339 Ga0070660_100000786 Ga0070660_10000078617 130
203 3300009093 Ga0105240_10000004 Ga0105240_10000004333 130
204 3300009545 Ga0105237_10000001 Ga0105237_10000001765 130
205 3300009551 Ga0105238_10027003 Ga0105238_100270036 130
206 3300013104 Ga0157370_10003644 Ga0157370_100036441 130
207 3300013307 Ga0157372_10000002 Ga0157372_10000002310 130
208 3300034820 Ga0373959_0000077 Ga0373959_0000077_7909_8319 130
209 3300037312 Ga0395899_0440383 Ga0395899_0440383_284_691 130
210 3300047322 Ga0495680_0209202 Ga0495680_0209202_514_921 130
211 3300048904 Ga0496101_0411248 Ga0496101_0411248_254_661 130
212 3300048905 Ga0496102_0601141 Ga0496102_0601141_495_902 130
213 3300048927 Ga0496124_0070099 Ga0496124_0070099_448_855 130
214 3300053087 Ga0500643_011833 Ga0500643_011833_421_840 130
215 3300001904 JGI24736J21556_1019759 JGI24736J21556_10197592 132
216 3300001979 JGI24740J21852_10006058 JGI24740J21852_100060582 132
217 3300001989 JGI24739J22299_10002659 JGI24739J22299_100026597 132
218 3300001990 JGI24737J22298_10001063 JGI24737J22298_1000106311 132
219 3300002067 JGI24735J21928_10000051 JGI24735J21928_1000005117 132
220 3300002075 JGI24738J21930_10000517 JGI24738J21930_1000051713 132
221 3300003322 rootL2_10155344 rootL2_101553442 132
222 3300003323 rootH1_10143678 rootH1_101436783 132
223 3300005327 Ga0070658_10000038 Ga0070658_10000038126 132
224 3300005334 Ga0068869_100167014 Ga0068869_1001670142 132
225 3300005336 Ga0070680_100370040 Ga0070680_1003700402 132
226 3300005339 Ga0070660_100024393 Ga0070660_10002439311 132
227 3300005344 Ga0070661_100147954 Ga0070661_1001479542 132
228 3300005354 Ga0070675_100238862 Ga0070675_1002388623 132
229 3300005364 Ga0070673_101291308 Ga0070673_1012913081 132
230 3300005366 Ga0070659_100958790 Ga0070659_1009587901 132
231 3300005457 Ga0070662_100007860 Ga0070662_1000078605 132
232 3300005535 Ga0070684_100420548 Ga0070684_1004205483 132
233 3300005563 Ga0068855_102444556 Ga0068855_1024445562 132
234 3300005564 Ga0070664_100669181 Ga0070664_1006691813 132
235 3300005577 Ga0068857_100012235 Ga0068857_10001223510 132
236 3300005614 Ga0068856_100094762 Ga0068856_1000947621 132
237 3300006186 Ga0075369_10002696 Ga0075369_100026969 132
238 3300006195 Ga0075366_10002227 Ga0075366_100022273 132
239 3300006353 Ga0075370_10019856 Ga0075370_100198566 132
240 3300006358 Ga0068871_100051755 Ga0068871_1000517553 132
241 3300006881 Ga0068865_100002319 Ga0068865_10000231921 132
242 3300009174 Ga0105241_10269717 Ga0105241_102697172 132
243 3300009551 Ga0105238_10086605 Ga0105238_100866056 132
244 3300010375 Ga0105239_10000261 Ga0105239_1000026167 132
245 3300011119 Ga0105246_11693675 Ga0105246_116936751 132
246 3300013100 Ga0157373_11119108 Ga0157373_111191081 132
247 3300013104 Ga0157370_10523302 Ga0157370_105233023 132
248 3300013105 Ga0157369_10053040 Ga0157369_100530405 132
249 3300014969 Ga0157376_10002503 Ga0157376_100025032 132
250 3300025904 Ga0207647_10000670 Ga0207647_1000067019 132
251 3300025909 Ga0207705_10000051 Ga0207705_1000005164 132
252 3300025911 Ga0207654_10090074 Ga0207654_100900743 132
253 3300025919 Ga0207657_10002122 Ga0207657_1000212218 132
254 3300025924 Ga0207694_10090801 Ga0207694_100908012 132
255 3300025926 Ga0207659_10350500 Ga0207659_103505002 132
256 3300025927 Ga0207687_10449382 Ga0207687_104493822 132
257 3300025933 Ga0207706_10000543 Ga0207706_1000054318 132
258 3300025938 Ga0207704_10010834 Ga0207704_100108346 132
259 3300025942 Ga0207689_10174303 Ga0207689_101743032 132
260 3300025944 Ga0207661_10020254 Ga0207661_1002025410 132
261 3300025945 Ga0207679_10001254 Ga0207679_1000125418 132
262 3300026078 Ga0207702_11322705 Ga0207702_113227051 132
263 3300026116 Ga0207674_10001283 Ga0207674_1000128329 132
264 3300037312 Ga0395899_0007520 Ga0395899_0007520_5551_5973 132
265 3300037418 Ga0395900_0000001 Ga0395900_0000001_96586_97008 132
266 3300037466 Ga0395898_0000002 Ga0395898_0000002_78112_78534 132
267 3300038443 Ga0395901_0000060 Ga0395901_0000060_140689_141111 132
268 3300047472 Ga0495686_0169707 Ga0495686_0169707_209_643 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

17

120

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9759 7 113
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9628 9 115
8c90-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9606 7 113
8c97-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.958 7 113
6czr-assembly2.cif.gz_2W the structure of amicetin bound to the 70s ribosome 0.951 7 115
ID Description Score Start End Superfamily
5mmiT00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9344 8 116 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9323 7 117 3.90.470.10
5jvgP00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9312 10 116 3.90.470.10
af_A0A0R0IDQ9_68_223_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9137 8 116 3.90.470.10
af_P0C2C0_41_206_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9081 6 116 3.90.470.10
ID Description Score Start End GO Terms
AF-N0ACH3-F1-model_v4 50S ribosomal protein L22, chloroplastic 0.9558 32 115 GO:0003735
GO:0006412
GO:0009507
GO:0015934
GO:0019843
AF-A0A411L2I7-F1-model_v4 Large ribosomal subunit protein uL22c 0.9517 8 115 GO:0003735
GO:0006412
GO:0009507
GO:0015934
GO:0019843
AF-A0A520N530-F1-model_v4 Large ribosomal subunit protein uL22 0.9513 7 115 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1I1RJV0-F1-model_v4 Large ribosomal subunit protein uL22 0.9502 7 113 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1Q5XPU4-F1-model_v4 Large ribosomal subunit protein uL22 0.9495 7 115 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.94 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map