F375756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 158 | 268 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0169707|Ga0495686_0169707_209_643 |
| Length | 144 |
| Sequence | MAETITERAAANFTVRAVARGVDQTPRKVSLVAALVRNRTVADALVILEHVPKRAALPVKKVIESAKANAVNNHGLDGKTLTISTLTVTTGPRLRRFKPASRGRALPFEKKTSHILVEVSGAEKAKKKPAAVKASADEKKEETK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 97 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 98 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 99 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 100 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 111 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 112 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 113 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 114 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 115 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 116 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 117 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 118 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 119 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 120 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 121 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 122 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 125 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 135 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 140 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 141 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 142 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 143 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 144 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 145 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 146 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 147 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 148 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 149 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 150 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 151 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 152 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 153 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 154 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 155 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 157 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 158 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.88 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 73.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1019759 | 3300001904 | Bacteria | 1062 |
| 2 | JGI24741J21665_1000163 | 3300001915 | Bacteria | 19099 |
| 3 | JGI24741J21665_1021927 | 3300001915 | Bacteria | 994 |
| 4 | JGI24740J21852_10004196 | 3300001979 | Bacteria | 6224 |
| 5 | JGI24740J21852_10006058 | 3300001979 | Bacteria | 5054 |
| 6 | JGI24740J21852_10017869 | 3300001979 | Bacteria | 2528 |
| 7 | JGI24739J22299_10002659 | 3300001989 | Bacteria | 6878 |
| 8 | JGI24737J22298_10000106 | 3300001990 | Bacteria | 25250 |
| 9 | JGI24737J22298_10001063 | 3300001990 | Bacteria | 9703 |
| 10 | JGI24735J21928_10000051 | 3300002067 | Bacteria | 50715 |
| 11 | JGI24735J21928_10000083 | 3300002067 | Bacteria | 36242 |
| 12 | JGI24738J21930_10000517 | 3300002075 | Bacteria | 11027 |
| 13 | rootL2_10155344 | 3300003322 | Bacteria | 1423 |
| 14 | rootH1_10143678 | 3300003323 | Bacteria | 1367 |
| 15 | Ga0065712_10699663 | 3300005290 | Unclassified | 547 |
| 16 | Ga0070658_10000038 | 3300005327 | Bacteria | 137159 |
| 17 | Ga0070658_11250604 | 3300005327 | Bacteria | 645 |
| 18 | Ga0070676_10388293 | 3300005328 | Bacteria | 968 |
| 19 | Ga0070676_10479601 | 3300005328 | Bacteria | 879 |
| 20 | Ga0070683_100285794 | 3300005329 | Bacteria | 1569 |
| 21 | Ga0068869_100167014 | 3300005334 | Bacteria | 1717 |
| 22 | Ga0068869_100169510 | 3300005334 | Bacteria | 1705 |
| 23 | Ga0070680_100370040 | 3300005336 | Bacteria | 1219 |
| 24 | Ga0070660_100000786 | 3300005339 | Bacteria | 21098 |
| 25 | Ga0070660_100024393 | 3300005339 | Bacteria | 4485 |
| 26 | Ga0070661_100147954 | 3300005344 | Bacteria | 1774 |
| 27 | Ga0070675_100238862 | 3300005354 | Bacteria | 1587 |
| 28 | Ga0070673_101291308 | 3300005364 | Bacteria | 685 |
| 29 | Ga0070659_100958790 | 3300005366 | Bacteria | 749 |
| 30 | Ga0070700_101034656 | 3300005441 | Bacteria | 677 |
| 31 | Ga0070708_100022492 | 3300005445 | Bacteria | 5348 |
| 32 | Ga0070662_100007860 | 3300005457 | Bacteria | 6928 |
| 33 | Ga0070685_11251976 | 3300005466 | Bacteria | 565 |
| 34 | Ga0070684_100001744 | 3300005535 | Bacteria | 15831 |
| 35 | Ga0070684_100420548 | 3300005535 | Bacteria | 1233 |
| 36 | Ga0070696_100597431 | 3300005546 | Bacteria | 889 |
| 37 | Ga0068855_100000011 | 3300005563 | Bacteria | 244140 |
| 38 | Ga0068855_100005792 | 3300005563 | Bacteria | 15086 |
| 39 | Ga0068855_102444556 | 3300005563 | Bacteria | 521 |
| 40 | Ga0070664_100044797 | 3300005564 | Bacteria | 3736 |
| 41 | Ga0070664_100669181 | 3300005564 | Bacteria | 965 |
| 42 | Ga0068857_100004496 | 3300005577 | Bacteria | 11786 |
| 43 | Ga0068857_100012235 | 3300005577 | Bacteria | 7466 |
| 44 | Ga0068857_100017321 | 3300005577 | Bacteria | 6311 |
| 45 | Ga0068854_100170322 | 3300005578 | Bacteria | 1694 |
| 46 | Ga0068856_100001797 | 3300005614 | Bacteria | 22390 |
| 47 | Ga0068856_100094762 | 3300005614 | Bacteria | 2972 |
| 48 | Ga0068856_101910983 | 3300005614 | Bacteria | 604 |
| 49 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 50 | Ga0068852_100000135 | 3300005616 | Bacteria | 49773 |
| 51 | Ga0068852_100021496 | 3300005616 | Bacteria | 5154 |
| 52 | Ga0068852_100076235 | 3300005616 | Bacteria | 2960 |
| 53 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 54 | Ga0075365_10000049 | 3300006038 | Bacteria | 38677 |
| 55 | Ga0075365_10040790 | 3300006038 | Bacteria | 3029 |
| 56 | Ga0075365_10077730 | 3300006038 | Bacteria | 2242 |
| 57 | Ga0075365_10139212 | 3300006038 | Bacteria | 1684 |
| 58 | Ga0075365_10410915 | 3300006038 | Bacteria | 955 |
| 59 | Ga0075368_10000022 | 3300006042 | Bacteria | 37479 |
| 60 | Ga0075363_100013867 | 3300006048 | Bacteria | 3922 |
| 61 | Ga0075364_10008868 | 3300006051 | Bacteria | 6021 |
| 62 | Ga0075364_10033950 | 3300006051 | Bacteria | 3288 |
| 63 | Ga0075364_10209140 | 3300006051 | Bacteria | 1323 |
| 64 | Ga0075364_10512546 | 3300006051 | Bacteria | 820 |
| 65 | Ga0075362_10012646 | 3300006177 | Bacteria | 3359 |
| 66 | Ga0075362_10578485 | 3300006177 | Bacteria | 579 |
| 67 | Ga0075367_10678985 | 3300006178 | Bacteria | 655 |
| 68 | Ga0075369_10000077 | 3300006186 | Bacteria | 25424 |
| 69 | Ga0075369_10000098 | 3300006186 | Bacteria | 23291 |
| 70 | Ga0075369_10002696 | 3300006186 | Bacteria | 6366 |
| 71 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 72 | Ga0075366_10000147 | 3300006195 | Bacteria | 29801 |
| 73 | Ga0075366_10002227 | 3300006195 | Bacteria | 9899 |
| 74 | Ga0075366_10006218 | 3300006195 | Bacteria | 6520 |
| 75 | Ga0075366_10007166 | 3300006195 | Bacteria | 6141 |
| 76 | Ga0075366_10447295 | 3300006195 | Bacteria | 797 |
| 77 | Ga0075366_10568627 | 3300006195 | Bacteria | 702 |
| 78 | Ga0097621_100000003 | 3300006237 | Bacteria | 164830 |
| 79 | Ga0075370_10019329 | 3300006353 | Bacteria | 3709 |
| 80 | Ga0075370_10019856 | 3300006353 | Bacteria | 3662 |
| 81 | Ga0075370_10112736 | 3300006353 | Bacteria | 1580 |
| 82 | Ga0075370_10662885 | 3300006353 | Bacteria | 634 |
| 83 | Ga0068871_100000013 | 3300006358 | Bacteria | 102533 |
| 84 | Ga0068871_100051755 | 3300006358 | Bacteria | 3325 |
| 85 | Ga0075428_100002637 | 3300006844 | Bacteria | 19511 |
| 86 | Ga0068865_100002319 | 3300006881 | Bacteria | 11217 |
| 87 | Ga0105244_10093216 | 3300009036 | Bacteria | 1480 |
| 88 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 89 | Ga0105240_10000789 | 3300009093 | Bacteria | 57388 |
| 90 | Ga0105240_10040725 | 3300009093 | Bacteria | 5938 |
| 91 | Ga0105245_10054078 | 3300009098 | Bacteria | 3605 |
| 92 | Ga0105243_10010600 | 3300009148 | Bacteria | 6997 |
| 93 | Ga0105241_10017679 | 3300009174 | Bacteria | 5242 |
| 94 | Ga0105241_10081719 | 3300009174 | Bacteria | 2532 |
| 95 | Ga0105241_10269717 | 3300009174 | Bacteria | 1449 |
| 96 | Ga0105248_12919693 | 3300009177 | Bacteria | 545 |
| 97 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 98 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 99 | Ga0105238_10000463 | 3300009551 | Bacteria | 42690 |
| 100 | Ga0105238_10027003 | 3300009551 | Bacteria | 5851 |
| 101 | Ga0105238_10086605 | 3300009551 | Bacteria | 3120 |
| 102 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 103 | Ga0105239_10000261 | 3300010375 | Bacteria | 78396 |
| 104 | Ga0105246_10395631 | 3300011119 | Bacteria | 1146 |
| 105 | Ga0105246_11693675 | 3300011119 | Bacteria | 601 |
| 106 | Ga0157313_1006494 | 3300012503 | Bacteria | 881 |
| 107 | Ga0157373_10000583 | 3300013100 | Bacteria | 28402 |
| 108 | Ga0157373_10300959 | 3300013100 | Bacteria | 1138 |
| 109 | Ga0157373_11119108 | 3300013100 | Bacteria | 591 |
| 110 | Ga0157371_10000176 | 3300013102 | Bacteria | 93047 |
| 111 | Ga0157371_10016956 | 3300013102 | Bacteria | 5424 |
| 112 | Ga0157371_10033667 | 3300013102 | Bacteria | 3680 |
| 113 | Ga0157370_10003644 | 3300013104 | Bacteria | 18007 |
| 114 | Ga0157370_10338346 | 3300013104 | Bacteria | 1387 |
| 115 | Ga0157370_10523302 | 3300013104 | Bacteria | 1088 |
| 116 | Ga0157369_10000009 | 3300013105 | Bacteria | 303674 |
| 117 | Ga0157369_10019411 | 3300013105 | Bacteria | 7604 |
| 118 | Ga0157369_10053031 | 3300013105 | Bacteria | 4384 |
| 119 | Ga0157369_10053040 | 3300013105 | Bacteria | 4384 |
| 120 | Ga0157369_11796022 | 3300013105 | Bacteria | 623 |
| 121 | Ga0157374_10005678 | 3300013296 | Bacteria | 10519 |
| 122 | Ga0157374_10151826 | 3300013296 | Bacteria | 2252 |
| 123 | Ga0157374_10903970 | 3300013296 | Bacteria | 900 |
| 124 | Ga0157374_12162785 | 3300013296 | Bacteria | 583 |
| 125 | Ga0157378_11091740 | 3300013297 | Bacteria | 835 |
| 126 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 127 | Ga0157372_10000008 | 3300013307 | Bacteria | 305449 |
| 128 | Ga0157372_10014740 | 3300013307 | Bacteria | 8367 |
| 129 | Ga0157372_10607497 | 3300013307 | Bacteria | 1275 |
| 130 | Ga0157372_11939184 | 3300013307 | Bacteria | 677 |
| 131 | Ga0157375_10989865 | 3300013308 | Bacteria | 981 |
| 132 | Ga0157377_10006077 | 3300014745 | Bacteria | 5729 |
| 133 | Ga0157377_10730207 | 3300014745 | Bacteria | 722 |
| 134 | Ga0157376_10002503 | 3300014969 | Bacteria | 12443 |
| 135 | Ga0206351_10378828 | 3300020077 | Bacteria | 3831 |
| 136 | Ga0154015_1106666 | 3300020610 | Bacteria | 1204 |
| 137 | Ga0207647_10000670 | 3300025904 | Bacteria | 26786 |
| 138 | Ga0207643_10854970 | 3300025908 | Bacteria | 590 |
| 139 | Ga0207705_10000051 | 3300025909 | Bacteria | 169369 |
| 140 | Ga0207654_10001365 | 3300025911 | Bacteria | 12965 |
| 141 | Ga0207654_10010971 | 3300025911 | Bacteria | 4613 |
| 142 | Ga0207654_10090074 | 3300025911 | Bacteria | 1868 |
| 143 | Ga0207654_10386355 | 3300025911 | Bacteria | 970 |
| 144 | Ga0207707_10003287 | 3300025912 | Bacteria | 14366 |
| 145 | Ga0207695_10002053 | 3300025913 | Bacteria | 30792 |
| 146 | Ga0207695_10051029 | 3300025913 | Bacteria | 4346 |
| 147 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 148 | Ga0207657_10002122 | 3300025919 | Bacteria | 21466 |
| 149 | Ga0207694_10001212 | 3300025924 | Bacteria | 22387 |
| 150 | Ga0207694_10090801 | 3300025924 | Bacteria | 2410 |
| 151 | Ga0207659_10350500 | 3300025926 | Bacteria | 1225 |
| 152 | Ga0207687_10449382 | 3300025927 | Bacteria | 1068 |
| 153 | Ga0207706_10000543 | 3300025933 | Bacteria | 40146 |
| 154 | Ga0207704_10010834 | 3300025938 | Bacteria | 4465 |
| 155 | Ga0207689_10174303 | 3300025942 | Bacteria | 1774 |
| 156 | Ga0207661_10002824 | 3300025944 | Bacteria | 11992 |
| 157 | Ga0207661_10020254 | 3300025944 | Bacteria | 4967 |
| 158 | Ga0207679_10001254 | 3300025945 | Bacteria | 16096 |
| 159 | Ga0207679_10543215 | 3300025945 | Bacteria | 1042 |
| 160 | Ga0207667_10000042 | 3300025949 | Bacteria | 263461 |
| 161 | Ga0207667_10008206 | 3300025949 | Bacteria | 12429 |
| 162 | Ga0207712_10512916 | 3300025961 | Unclassified | 1026 |
| 163 | Ga0207640_10166736 | 3300025981 | Bacteria | 1636 |
| 164 | Ga0207708_10912846 | 3300026075 | Bacteria | 760 |
| 165 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 166 | Ga0207702_10003219 | 3300026078 | Bacteria | 15080 |
| 167 | Ga0207702_10164384 | 3300026078 | Bacteria | 2029 |
| 168 | Ga0207702_11322705 | 3300026078 | Bacteria | 715 |
| 169 | Ga0207674_10001283 | 3300026116 | Bacteria | 32760 |
| 170 | Ga0207674_10006337 | 3300026116 | Bacteria | 13931 |
| 171 | Ga0207674_10059207 | 3300026116 | Bacteria | 3877 |
| 172 | Ga0207675_100486711 | 3300026118 | Bacteria | 1227 |
| 173 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 174 | Ga0207698_10000100 | 3300026142 | Bacteria | 54808 |
| 175 | Ga0207698_10058476 | 3300026142 | Bacteria | 2988 |
| 176 | Ga0207698_10188895 | 3300026142 | Bacteria | 1833 |
| 177 | Ga0265338_10000178 | 3300028800 | Bacteria | 118345 |
| 178 | Ga0316179_1022679 | 3300030734 | Bacteria | 22602 |
| 179 | Ga0316180_1026511 | 3300030736 | Bacteria | 2040 |
| 180 | Ga0316183_1071475 | 3300030742 | Bacteria | 1495 |
| 181 | Ga0316181_1075766 | 3300030744 | Bacteria | 1177 |
| 182 | Ga0316182_1003781 | 3300030745 | Bacteria | 592 |
| 183 | Ga0316182_1027054 | 3300030745 | Bacteria | 8931 |
| 184 | Ga0316182_1196677 | 3300030745 | Bacteria | 1815 |
| 185 | Ga0316182_1375605 | 3300030745 | Bacteria | 1705 |
| 186 | Ga0265314_10318428 | 3300031711 | Bacteria | 866 |
| 187 | Ga0307516_10007665 | 3300031730 | Bacteria | 12354 |
| 188 | Ga0307413_11654679 | 3300031824 | Bacteria | 570 |
| 189 | Ga0373959_0000077 | 3300034820 | Bacteria | 21647 |
| 190 | Ga0395899_0007520 | 3300037312 | Bacteria | 8420 |
| 191 | Ga0395899_0043119 | 3300037312 | Bacteria | 3366 |
| 192 | Ga0395899_0440383 | 3300037312 | Bacteria | 855 |
| 193 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 194 | Ga0395900_0003612 | 3300037418 | Bacteria | 16623 |
| 195 | Ga0395900_0120359 | 3300037418 | Bacteria | 2694 |
| 196 | Ga0395900_0193416 | 3300037418 | Bacteria | 2062 |
| 197 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 198 | Ga0395898_0068534 | 3300037466 | Bacteria | 3433 |
| 199 | Ga0395905_1643478 | 3300037471 | Unclassified | 547 |
| 200 | Ga0395901_0000060 | 3300038443 | Bacteria | 152235 |
| 201 | Ga0395901_0008414 | 3300038443 | Bacteria | 10428 |
| 202 | Ga0395901_0320748 | 3300038443 | Bacteria | 1603 |
| 203 | Ga0395901_1222659 | 3300038443 | Bacteria | 716 |
| 204 | Ga0439431_0066886 | 3300041997 | Bacteria | 953 |
| 205 | Ga0439445_0002978 | 3300042004 | Bacteria | 3788 |
| 206 | Ga0439463_011598 | 3300042016 | Bacteria | 2163 |
| 207 | Ga0450911_010626 | 3300042115 | Bacteria | 1268 |
| 208 | Ga0450920_000153 | 3300042122 | Bacteria | 9520 |
| 209 | Ga0450906_003262 | 3300042145 | Bacteria | 3504 |
| 210 | Ga0450907_059341 | 3300042146 | Bacteria | 660 |
| 211 | Ga0439446_0000001 | 3300042156 | Bacteria | 275840 |
| 212 | Ga0450908_038826 | 3300042184 | Bacteria | 825 |
| 213 | Ga0439434_0029982 | 3300042435 | Bacteria | 1650 |
| 214 | Ga0439464_0000015 | 3300042439 | Bacteria | 23381 |
| 215 | Ga0450918_051557 | 3300042531 | Bacteria | 750 |
| 216 | Ga0466972_0028653 | 3300044658 | Bacteria | 2746 |
| 217 | Ga0466965_0000096 | 3300044683 | Bacteria | 25539 |
| 218 | Ga0466970_0189737 | 3300044765 | Bacteria | 1142 |
| 219 | Ga0495587_0212883 | 3300046536 | Bacteria | 1091 |
| 220 | Ga0495634_0175662 | 3300046642 | Bacteria | 1344 |
| 221 | Ga0495649_0000182 | 3300046694 | Bacteria | 54760 |
| 222 | Ga0495672_0110051 | 3300047320 | Bacteria | 1480 |
| 223 | Ga0495680_0209202 | 3300047322 | Bacteria | 1397 |
| 224 | Ga0495686_0169707 | 3300047472 | Bacteria | 1269 |
| 225 | Ga0495593_0047847 | 3300047673 | Bacteria | 2274 |
| 226 | Ga0496101_0411248 | 3300048904 | Bacteria | 1066 |
| 227 | Ga0496102_0601141 | 3300048905 | Bacteria | 1023 |
| 228 | Ga0496118_0478294 | 3300048921 | Bacteria | 625 |
| 229 | Ga0496124_0070099 | 3300048927 | Bacteria | 2909 |
| 230 | Ga0501034_0911382 | 3300049571 | Bacteria | 766 |
| 231 | Ga0501037_0273496 | 3300049573 | Bacteria | 1178 |
| 232 | Ga0501070_0278085 | 3300049586 | Bacteria | 1366 |
| 233 | nmdc:mga00v17_293333_c1 | 3300050491 | Bacteria | 1056 |
| 234 | nmdc:mga00v17_313528_c1 | 3300050491 | Bacteria | 1019 |
| 235 | nmdc:mga00v17_501503_c1 | 3300050491 | Bacteria | 787 |
| 236 | nmdc:mga00v17_731783_c1 | 3300050491 | Bacteria | 633 |
| 237 | nmdc:mga00v17_770426_c1 | 3300050491 | Bacteria | 614 |
| 238 | nmdc:mga0yw44_30920_c1 | 3300050492 | Bacteria | 3109 |
| 239 | nmdc:mga0yw44_45419_c1 | 3300050492 | Bacteria | 2633 |
| 240 | nmdc:mga0yw44_63_c1 | 3300050492 | Bacteria | 38664 |
| 241 | nmdc:mga0yw44_7217_c1 | 3300050492 | Bacteria | 5445 |
| 242 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 243 | nmdc:mga0k408_24_c2 | 3300050493 | Bacteria | 61722 |
| 244 | nmdc:mga0k408_2531_c1 | 3300050493 | Bacteria | 9718 |
| 245 | nmdc:mga0k408_3588_c1 | 3300050493 | Bacteria | 7866 |
| 246 | nmdc:mga0k408_498831_c1 | 3300050493 | Bacteria | 721 |
| 247 | nmdc:mga0k408_597130_c1 | 3300050493 | Bacteria | 651 |
| 248 | nmdc:mga0k408_6815_c1 | 3300050493 | Bacteria | 6090 |
| 249 | nmdc:mga06z11_196598_c1 | 3300050494 | Bacteria | 1169 |
| 250 | nmdc:mga07m45_107949_c1 | 3300050496 | Bacteria | 1601 |
| 251 | nmdc:mga07m45_147414_c2 | 3300050496 | Bacteria | 680 |
| 252 | nmdc:mga07m45_81995_c1 | 3300050496 | Bacteria | 1842 |
| 253 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 254 | nmdc:mga0sz30_8_c2 | 3300050516 | Bacteria | 48225 |
| 255 | Ga0500643_011833 | 3300053087 | Bacteria | 3158 |
| 256 | Ga0500651_0000203 | 3300053093 | Bacteria | 37688 |
| 257 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 258 | Ga0500554_120979 | 3300053102 | Bacteria | 883 |
| 259 | Ga0500555_000006 | 3300053103 | Bacteria | 304416 |
| 260 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 261 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 262 | Ga0500574_131425 | 3300053141 | Bacteria | 738 |
| 263 | Ga0500577_0211815 | 3300053142 | Bacteria | 837 |
| 264 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 265 | Ga0500649_000014 | 3300053722 | Bacteria | 56198 |
| 266 | Ga0500570_000171 | 3300053724 | Bacteria | 20296 |
| 267 | Ga0500611_039288 | 3300053727 | Bacteria | 1030 |
| 268 | Ga0500656_024784 | 3300053732 | Bacteria | 766 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_1643478 | Ga0395905_1643478_21_359 | 98 |
| 2 | 3300053093 | Ga0500651_0000203 | Ga0500651_0000203_29639_30052 | 107 |
| 3 | 3300053102 | Ga0500554_120979 | Ga0500554_120979_425_838 | 107 |
| 4 | 3300005577 | Ga0068857_100017321 | Ga0068857_10001732113 | 112 |
| 5 | 3300026116 | Ga0207674_10059207 | Ga0207674_100592073 | 112 |
| 6 | 3300025961 | Ga0207712_10512916 | Ga0207712_105129162 | 113 |
| 7 | 3300025908 | Ga0207643_10854970 | Ga0207643_108549701 | 114 |
| 8 | 3300026118 | Ga0207675_100486711 | Ga0207675_1004867113 | 114 |
| 9 | 3300031824 | Ga0307413_11654679 | Ga0307413_116546792 | 116 |
| 10 | 3300037312 | Ga0395899_0043119 | Ga0395899_0043119_241_633 | 116 |
| 11 | 3300037418 | Ga0395900_0003612 | Ga0395900_0003612_15611_16003 | 116 |
| 12 | 3300037418 | Ga0395900_0193416 | Ga0395900_0193416_1389_1781 | 116 |
| 13 | 3300037466 | Ga0395898_0068534 | Ga0395898_0068534_2228_2620 | 116 |
| 14 | 3300038443 | Ga0395901_0008414 | Ga0395901_0008414_2421_2813 | 116 |
| 15 | 3300038443 | Ga0395901_1222659 | Ga0395901_1222659_265_657 | 116 |
| 16 | 3300041997 | Ga0439431_0066886 | Ga0439431_0066886_77_481 | 116 |
| 17 | 3300025912 | Ga0207707_10003287 | Ga0207707_1000328718 | 118 |
| 18 | 3300037418 | Ga0395900_0120359 | Ga0395900_0120359_1413_1805 | 118 |
| 19 | 3300038443 | Ga0395901_0320748 | Ga0395901_0320748_401_793 | 118 |
| 20 | 3300005328 | Ga0070676_10388293 | Ga0070676_103882932 | 120 |
| 21 | 3300006038 | Ga0075365_10139212 | Ga0075365_101392124 | 120 |
| 22 | 3300044658 | Ga0466972_0028653 | Ga0466972_0028653_711_1118 | 120 |
| 23 | 3300044683 | Ga0466965_0000096 | Ga0466965_0000096_1985_2392 | 120 |
| 24 | 3300050492 | nmdc:mga0yw44_30920_c1 | nmdc:mga0yw44_30920_c1_1417_1821 | 120 |
| 25 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_229367_229735 | 120 |
| 26 | 3300053722 | Ga0500649_000014 | Ga0500649_000014_29751_30119 | 120 |
| 27 | 3300053724 | Ga0500570_000171 | Ga0500570_000171_3878_4276 | 120 |
| 28 | 3300042004 | Ga0439445_0002978 | Ga0439445_0002978_3074_3484 | 121 |
| 29 | 3300044765 | Ga0466970_0189737 | Ga0466970_0189737_619_1017 | 121 |
| 30 | 3300005290 | Ga0065712_10699663 | Ga0065712_106996631 | 122 |
| 31 | 3300006038 | Ga0075365_10077730 | Ga0075365_100777306 | 122 |
| 32 | 3300006038 | Ga0075365_10410915 | Ga0075365_104109151 | 122 |
| 33 | 3300006051 | Ga0075364_10209140 | Ga0075364_102091402 | 122 |
| 34 | 3300006177 | Ga0075362_10578485 | Ga0075362_105784852 | 122 |
| 35 | 3300006195 | Ga0075366_10000147 | Ga0075366_1000014711 | 122 |
| 36 | 3300009979 | Ga0105032_100001 | Ga0105032_100001147 | 122 |
| 37 | 3300026075 | Ga0207708_10912846 | Ga0207708_109128461 | 122 |
| 38 | 3300049573 | Ga0501037_0273496 | Ga0501037_0273496_32_409 | 122 |
| 39 | 3300049586 | Ga0501070_0278085 | Ga0501070_0278085_591_968 | 122 |
| 40 | 3300050491 | nmdc:mga00v17_293333_c1 | nmdc:mga00v17_293333_c1_479_856 | 122 |
| 41 | 3300050491 | nmdc:mga00v17_731783_c1 | nmdc:mga00v17_731783_c1_128_502 | 122 |
| 42 | 3300050492 | nmdc:mga0yw44_7217_c1 | nmdc:mga0yw44_7217_c1_1657_2031 | 122 |
| 43 | 3300050493 | nmdc:mga0k408_597130_c1 | nmdc:mga0k408_597130_c1_121_498 | 122 |
| 44 | 3300005334 | Ga0068869_100169510 | Ga0068869_1001695103 | 123 |
| 45 | 3300005441 | Ga0070700_101034656 | Ga0070700_1010346562 | 123 |
| 46 | 3300006051 | Ga0075364_10512546 | Ga0075364_105125462 | 123 |
| 47 | 3300006178 | Ga0075367_10678985 | Ga0075367_106789851 | 123 |
| 48 | 3300006186 | Ga0075369_10000077 | Ga0075369_1000007724 | 123 |
| 49 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001376 | 123 |
| 50 | 3300006353 | Ga0075370_10112736 | Ga0075370_101127363 | 123 |
| 51 | 3300009148 | Ga0105243_10010600 | Ga0105243_1001060014 | 123 |
| 52 | 3300009177 | Ga0105248_12919693 | Ga0105248_129196932 | 123 |
| 53 | 3300013102 | Ga0157371_10000176 | Ga0157371_1000017616 | 123 |
| 54 | 3300013105 | Ga0157369_11796022 | Ga0157369_117960222 | 123 |
| 55 | 3300030734 | Ga0316179_1022679 | Ga0316179_10226798 | 123 |
| 56 | 3300030736 | Ga0316180_1026511 | Ga0316180_10265113 | 123 |
| 57 | 3300030742 | Ga0316183_1071475 | Ga0316183_10714752 | 123 |
| 58 | 3300030744 | Ga0316181_1075766 | Ga0316181_10757662 | 123 |
| 59 | 3300030745 | Ga0316182_1027054 | Ga0316182_102705414 | 123 |
| 60 | 3300046536 | Ga0495587_0212883 | Ga0495587_0212883_192_569 | 123 |
| 61 | 3300047673 | Ga0495593_0047847 | Ga0495593_0047847_304_681 | 123 |
| 62 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_738559_738936 | 123 |
| 63 | 3300050494 | nmdc:mga06z11_196598_c1 | nmdc:mga06z11_196598_c1_765_1142 | 123 |
| 64 | 3300050496 | nmdc:mga07m45_107949_c1 | nmdc:mga07m45_107949_c1_782_1159 | 123 |
| 65 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_313627_314004 | 123 |
| 66 | 3300050516 | nmdc:mga0sz30_8_c2 | nmdc:mga0sz30_8_c2_2767_3144 | 123 |
| 67 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_676441_676818 | 123 |
| 68 | 3300053141 | Ga0500574_131425 | Ga0500574_131425_27_404 | 123 |
| 69 | 3300053727 | Ga0500611_039288 | Ga0500611_039288_466_864 | 123 |
| 70 | 3300001915 | JGI24741J21665_1021927 | JGI24741J21665_10219271 | 124 |
| 71 | 3300001990 | JGI24737J22298_10000106 | JGI24737J22298_1000010633 | 124 |
| 72 | 3300002067 | JGI24735J21928_10000083 | JGI24735J21928_1000008317 | 124 |
| 73 | 3300005328 | Ga0070676_10479601 | Ga0070676_104796012 | 124 |
| 74 | 3300005329 | Ga0070683_100285794 | Ga0070683_1002857942 | 124 |
| 75 | 3300005535 | Ga0070684_100001744 | Ga0070684_10000174410 | 124 |
| 76 | 3300005614 | Ga0068856_100001797 | Ga0068856_10000179739 | 124 |
| 77 | 3300005616 | Ga0068852_100021496 | Ga0068852_1000214968 | 124 |
| 78 | 3300005937 | Ga0081455_10000001 | Ga0081455_10000001151 | 124 |
| 79 | 3300009093 | Ga0105240_10040725 | Ga0105240_100407255 | 124 |
| 80 | 3300009174 | Ga0105241_10081719 | Ga0105241_100817192 | 124 |
| 81 | 3300013100 | Ga0157373_10000583 | Ga0157373_1000058317 | 124 |
| 82 | 3300013104 | Ga0157370_10338346 | Ga0157370_103383463 | 124 |
| 83 | 3300013296 | Ga0157374_12162785 | Ga0157374_121627852 | 124 |
| 84 | 3300013297 | Ga0157378_11091740 | Ga0157378_110917402 | 124 |
| 85 | 3300025911 | Ga0207654_10001365 | Ga0207654_1000136516 | 124 |
| 86 | 3300025911 | Ga0207654_10386355 | Ga0207654_103863552 | 124 |
| 87 | 3300025913 | Ga0207695_10051029 | Ga0207695_1005102910 | 124 |
| 88 | 3300025944 | Ga0207661_10002824 | Ga0207661_1000282422 | 124 |
| 89 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001836 | 124 |
| 90 | 3300026078 | Ga0207702_10003219 | Ga0207702_1000321928 | 124 |
| 91 | 3300026142 | Ga0207698_10188895 | Ga0207698_101888953 | 124 |
| 92 | 3300028800 | Ga0265338_10000178 | Ga0265338_1000017896 | 124 |
| 93 | 3300031711 | Ga0265314_10318428 | Ga0265314_103184282 | 124 |
| 94 | 3300050491 | nmdc:mga00v17_770426_c1 | nmdc:mga00v17_770426_c1_105_488 | 124 |
| 95 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_533014_533391 | 124 |
| 96 | 3300001915 | JGI24741J21665_1000163 | JGI24741J21665_100016325 | 125 |
| 97 | 3300001979 | JGI24740J21852_10004196 | JGI24740J21852_1000419613 | 125 |
| 98 | 3300005546 | Ga0070696_100597431 | Ga0070696_1005974311 | 125 |
| 99 | 3300006038 | Ga0075365_10040790 | Ga0075365_100407904 | 125 |
| 100 | 3300006051 | Ga0075364_10008868 | Ga0075364_1000886810 | 125 |
| 101 | 3300006195 | Ga0075366_10006218 | Ga0075366_100062184 | 125 |
| 102 | 3300013296 | Ga0157374_10903970 | Ga0157374_109039702 | 125 |
| 103 | 3300014745 | Ga0157377_10730207 | Ga0157377_107302071 | 125 |
| 104 | 3300046694 | Ga0495649_0000182 | Ga0495649_0000182_7903_8292 | 125 |
| 105 | 3300050491 | nmdc:mga00v17_501503_c1 | nmdc:mga00v17_501503_c1_37_423 | 125 |
| 106 | 3300050492 | nmdc:mga0yw44_45419_c1 | nmdc:mga0yw44_45419_c1_2108_2494 | 125 |
| 107 | 3300050493 | nmdc:mga0k408_24_c2 | nmdc:mga0k408_24_c2_56816_57202 | 125 |
| 108 | 3300050493 | nmdc:mga0k408_6815_c1 | nmdc:mga0k408_6815_c1_4444_4830 | 125 |
| 109 | 3300053732 | Ga0500656_024784 | Ga0500656_024784_65_478 | 125 |
| 110 | 3300053142 | Ga0500577_0211815 | Ga0500577_0211815_61_471 | 126 |
| 111 | 3300005614 | Ga0068856_101910983 | Ga0068856_1019109832 | 127 |
| 112 | 3300005616 | Ga0068852_100000135 | Ga0068852_10000013533 | 127 |
| 113 | 3300006042 | Ga0075368_10000022 | Ga0075368_1000002246 | 127 |
| 114 | 3300006048 | Ga0075363_100013867 | Ga0075363_1000138676 | 127 |
| 115 | 3300006051 | Ga0075364_10033950 | Ga0075364_100339506 | 127 |
| 116 | 3300006177 | Ga0075362_10012646 | Ga0075362_100126465 | 127 |
| 117 | 3300006186 | Ga0075369_10000098 | Ga0075369_1000009832 | 127 |
| 118 | 3300006195 | Ga0075366_10447295 | Ga0075366_104472952 | 127 |
| 119 | 3300006353 | Ga0075370_10662885 | Ga0075370_106628852 | 127 |
| 120 | 3300009036 | Ga0105244_10093216 | Ga0105244_100932162 | 127 |
| 121 | 3300009098 | Ga0105245_10054078 | Ga0105245_100540783 | 127 |
| 122 | 3300012503 | Ga0157313_1006494 | Ga0157313_10064942 | 127 |
| 123 | 3300013100 | Ga0157373_10300959 | Ga0157373_103009592 | 127 |
| 124 | 3300013102 | Ga0157371_10016956 | Ga0157371_100169561 | 127 |
| 125 | 3300013105 | Ga0157369_10053031 | Ga0157369_100530315 | 127 |
| 126 | 3300013296 | Ga0157374_10005678 | Ga0157374_1000567812 | 127 |
| 127 | 3300013307 | Ga0157372_10014740 | Ga0157372_1001474014 | 127 |
| 128 | 3300013308 | Ga0157375_10989865 | Ga0157375_109898652 | 127 |
| 129 | 3300014745 | Ga0157377_10006077 | Ga0157377_100060777 | 127 |
| 130 | 3300026078 | Ga0207702_10164384 | Ga0207702_101643844 | 127 |
| 131 | 3300026142 | Ga0207698_10000100 | Ga0207698_1000010033 | 127 |
| 132 | 3300030745 | Ga0316182_1003781 | Ga0316182_10037812 | 127 |
| 133 | 3300030745 | Ga0316182_1375605 | Ga0316182_13756053 | 127 |
| 134 | 3300031730 | Ga0307516_10007665 | Ga0307516_1000766517 | 127 |
| 135 | 3300042016 | Ga0439463_011598 | Ga0439463_011598_399_806 | 127 |
| 136 | 3300042146 | Ga0450907_059341 | Ga0450907_059341_59_460 | 127 |
| 137 | 3300042156 | Ga0439446_0000001 | Ga0439446_0000001_143211_143624 | 127 |
| 138 | 3300042435 | Ga0439434_0029982 | Ga0439434_0029982_556_969 | 127 |
| 139 | 3300042439 | Ga0439464_0000015 | Ga0439464_0000015_40_447 | 127 |
| 140 | 3300050491 | nmdc:mga00v17_313528_c1 | nmdc:mga00v17_313528_c1_103_498 | 127 |
| 141 | 3300050493 | nmdc:mga0k408_2531_c1 | nmdc:mga0k408_2531_c1_8461_8868 | 127 |
| 142 | 3300050496 | nmdc:mga07m45_147414_c2 | nmdc:mga07m45_147414_c2_87_482 | 127 |
| 143 | 3300005466 | Ga0070685_11251976 | Ga0070685_112519761 | 128 |
| 144 | 3300005564 | Ga0070664_100044797 | Ga0070664_1000447975 | 128 |
| 145 | 3300006195 | Ga0075366_10568627 | Ga0075366_105686272 | 128 |
| 146 | 3300006237 | Ga0097621_100000003 | Ga0097621_10000000395 | 128 |
| 147 | 3300006353 | Ga0075370_10019329 | Ga0075370_100193294 | 128 |
| 148 | 3300006358 | Ga0068871_100000013 | Ga0068871_10000001393 | 128 |
| 149 | 3300006844 | Ga0075428_100002637 | Ga0075428_10000263713 | 128 |
| 150 | 3300013102 | Ga0157371_10033667 | Ga0157371_100336674 | 128 |
| 151 | 3300013307 | Ga0157372_11939184 | Ga0157372_119391842 | 128 |
| 152 | 3300025945 | Ga0207679_10543215 | Ga0207679_105432152 | 128 |
| 153 | 3300030745 | Ga0316182_1196677 | Ga0316182_11966773 | 128 |
| 154 | 3300042115 | Ga0450911_010626 | Ga0450911_010626_216_620 | 128 |
| 155 | 3300042122 | Ga0450920_000153 | Ga0450920_000153_5585_5989 | 128 |
| 156 | 3300042145 | Ga0450906_003262 | Ga0450906_003262_55_459 | 128 |
| 157 | 3300042184 | Ga0450908_038826 | Ga0450908_038826_206_610 | 128 |
| 158 | 3300042531 | Ga0450918_051557 | Ga0450918_051557_123_527 | 128 |
| 159 | 3300049571 | Ga0501034_0911382 | Ga0501034_0911382_178_582 | 128 |
| 160 | 3300050493 | nmdc:mga0k408_498831_c1 | nmdc:mga0k408_498831_c1_54_452 | 128 |
| 161 | 3300050496 | nmdc:mga07m45_81995_c1 | nmdc:mga07m45_81995_c1_19_417 | 128 |
| 162 | 3300053103 | Ga0500555_000006 | Ga0500555_000006_182410_182808 | 128 |
| 163 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_518898_519296 | 128 |
| 164 | 3300001979 | JGI24740J21852_10017869 | JGI24740J21852_100178692 | 129 |
| 165 | 3300005327 | Ga0070658_11250604 | Ga0070658_112506041 | 129 |
| 166 | 3300005445 | Ga0070708_100022492 | Ga0070708_1000224927 | 129 |
| 167 | 3300005563 | Ga0068855_100000011 | Ga0068855_10000001189 | 129 |
| 168 | 3300005563 | Ga0068855_100005792 | Ga0068855_1000057929 | 129 |
| 169 | 3300005577 | Ga0068857_100004496 | Ga0068857_1000044969 | 129 |
| 170 | 3300005578 | Ga0068854_100170322 | Ga0068854_1001703222 | 129 |
| 171 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001570 | 129 |
| 172 | 3300005616 | Ga0068852_100076235 | Ga0068852_1000762355 | 129 |
| 173 | 3300006038 | Ga0075365_10000049 | Ga0075365_1000004917 | 129 |
| 174 | 3300006195 | Ga0075366_10007166 | Ga0075366_100071667 | 129 |
| 175 | 3300009093 | Ga0105240_10000789 | Ga0105240_1000078922 | 129 |
| 176 | 3300009174 | Ga0105241_10017679 | Ga0105241_100176795 | 129 |
| 177 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002462 | 129 |
| 178 | 3300009551 | Ga0105238_10000463 | Ga0105238_1000046320 | 129 |
| 179 | 3300011119 | Ga0105246_10395631 | Ga0105246_103956312 | 129 |
| 180 | 3300013105 | Ga0157369_10000009 | Ga0157369_10000009284 | 129 |
| 181 | 3300013105 | Ga0157369_10019411 | Ga0157369_100194113 | 129 |
| 182 | 3300013296 | Ga0157374_10151826 | Ga0157374_101518262 | 129 |
| 183 | 3300013307 | Ga0157372_10000008 | Ga0157372_1000000825 | 129 |
| 184 | 3300013307 | Ga0157372_10607497 | Ga0157372_106074973 | 129 |
| 185 | 3300020077 | Ga0206351_10378828 | Ga0206351_103788285 | 129 |
| 186 | 3300020610 | Ga0154015_1106666 | Ga0154015_11066662 | 129 |
| 187 | 3300025911 | Ga0207654_10010971 | Ga0207654_100109714 | 129 |
| 188 | 3300025913 | Ga0207695_10002053 | Ga0207695_1000205322 | 129 |
| 189 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008567 | 129 |
| 190 | 3300025924 | Ga0207694_10001212 | Ga0207694_1000121221 | 129 |
| 191 | 3300025949 | Ga0207667_10000042 | Ga0207667_10000042201 | 129 |
| 192 | 3300025949 | Ga0207667_10008206 | Ga0207667_100082069 | 129 |
| 193 | 3300025981 | Ga0207640_10166736 | Ga0207640_101667363 | 129 |
| 194 | 3300026116 | Ga0207674_10006337 | Ga0207674_100063377 | 129 |
| 195 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001520 | 129 |
| 196 | 3300026142 | Ga0207698_10058476 | Ga0207698_100584765 | 129 |
| 197 | 3300046642 | Ga0495634_0175662 | Ga0495634_0175662_497_904 | 129 |
| 198 | 3300047320 | Ga0495672_0110051 | Ga0495672_0110051_139_546 | 129 |
| 199 | 3300048921 | Ga0496118_0478294 | Ga0496118_0478294_127_531 | 129 |
| 200 | 3300050492 | nmdc:mga0yw44_63_c1 | nmdc:mga0yw44_63_c1_7678_8079 | 129 |
| 201 | 3300050493 | nmdc:mga0k408_3588_c1 | nmdc:mga0k408_3588_c1_5025_5423 | 129 |
| 202 | 3300005339 | Ga0070660_100000786 | Ga0070660_10000078617 | 130 |
| 203 | 3300009093 | Ga0105240_10000004 | Ga0105240_10000004333 | 130 |
| 204 | 3300009545 | Ga0105237_10000001 | Ga0105237_10000001765 | 130 |
| 205 | 3300009551 | Ga0105238_10027003 | Ga0105238_100270036 | 130 |
| 206 | 3300013104 | Ga0157370_10003644 | Ga0157370_100036441 | 130 |
| 207 | 3300013307 | Ga0157372_10000002 | Ga0157372_10000002310 | 130 |
| 208 | 3300034820 | Ga0373959_0000077 | Ga0373959_0000077_7909_8319 | 130 |
| 209 | 3300037312 | Ga0395899_0440383 | Ga0395899_0440383_284_691 | 130 |
| 210 | 3300047322 | Ga0495680_0209202 | Ga0495680_0209202_514_921 | 130 |
| 211 | 3300048904 | Ga0496101_0411248 | Ga0496101_0411248_254_661 | 130 |
| 212 | 3300048905 | Ga0496102_0601141 | Ga0496102_0601141_495_902 | 130 |
| 213 | 3300048927 | Ga0496124_0070099 | Ga0496124_0070099_448_855 | 130 |
| 214 | 3300053087 | Ga0500643_011833 | Ga0500643_011833_421_840 | 130 |
| 215 | 3300001904 | JGI24736J21556_1019759 | JGI24736J21556_10197592 | 132 |
| 216 | 3300001979 | JGI24740J21852_10006058 | JGI24740J21852_100060582 | 132 |
| 217 | 3300001989 | JGI24739J22299_10002659 | JGI24739J22299_100026597 | 132 |
| 218 | 3300001990 | JGI24737J22298_10001063 | JGI24737J22298_1000106311 | 132 |
| 219 | 3300002067 | JGI24735J21928_10000051 | JGI24735J21928_1000005117 | 132 |
| 220 | 3300002075 | JGI24738J21930_10000517 | JGI24738J21930_1000051713 | 132 |
| 221 | 3300003322 | rootL2_10155344 | rootL2_101553442 | 132 |
| 222 | 3300003323 | rootH1_10143678 | rootH1_101436783 | 132 |
| 223 | 3300005327 | Ga0070658_10000038 | Ga0070658_10000038126 | 132 |
| 224 | 3300005334 | Ga0068869_100167014 | Ga0068869_1001670142 | 132 |
| 225 | 3300005336 | Ga0070680_100370040 | Ga0070680_1003700402 | 132 |
| 226 | 3300005339 | Ga0070660_100024393 | Ga0070660_10002439311 | 132 |
| 227 | 3300005344 | Ga0070661_100147954 | Ga0070661_1001479542 | 132 |
| 228 | 3300005354 | Ga0070675_100238862 | Ga0070675_1002388623 | 132 |
| 229 | 3300005364 | Ga0070673_101291308 | Ga0070673_1012913081 | 132 |
| 230 | 3300005366 | Ga0070659_100958790 | Ga0070659_1009587901 | 132 |
| 231 | 3300005457 | Ga0070662_100007860 | Ga0070662_1000078605 | 132 |
| 232 | 3300005535 | Ga0070684_100420548 | Ga0070684_1004205483 | 132 |
| 233 | 3300005563 | Ga0068855_102444556 | Ga0068855_1024445562 | 132 |
| 234 | 3300005564 | Ga0070664_100669181 | Ga0070664_1006691813 | 132 |
| 235 | 3300005577 | Ga0068857_100012235 | Ga0068857_10001223510 | 132 |
| 236 | 3300005614 | Ga0068856_100094762 | Ga0068856_1000947621 | 132 |
| 237 | 3300006186 | Ga0075369_10002696 | Ga0075369_100026969 | 132 |
| 238 | 3300006195 | Ga0075366_10002227 | Ga0075366_100022273 | 132 |
| 239 | 3300006353 | Ga0075370_10019856 | Ga0075370_100198566 | 132 |
| 240 | 3300006358 | Ga0068871_100051755 | Ga0068871_1000517553 | 132 |
| 241 | 3300006881 | Ga0068865_100002319 | Ga0068865_10000231921 | 132 |
| 242 | 3300009174 | Ga0105241_10269717 | Ga0105241_102697172 | 132 |
| 243 | 3300009551 | Ga0105238_10086605 | Ga0105238_100866056 | 132 |
| 244 | 3300010375 | Ga0105239_10000261 | Ga0105239_1000026167 | 132 |
| 245 | 3300011119 | Ga0105246_11693675 | Ga0105246_116936751 | 132 |
| 246 | 3300013100 | Ga0157373_11119108 | Ga0157373_111191081 | 132 |
| 247 | 3300013104 | Ga0157370_10523302 | Ga0157370_105233023 | 132 |
| 248 | 3300013105 | Ga0157369_10053040 | Ga0157369_100530405 | 132 |
| 249 | 3300014969 | Ga0157376_10002503 | Ga0157376_100025032 | 132 |
| 250 | 3300025904 | Ga0207647_10000670 | Ga0207647_1000067019 | 132 |
| 251 | 3300025909 | Ga0207705_10000051 | Ga0207705_1000005164 | 132 |
| 252 | 3300025911 | Ga0207654_10090074 | Ga0207654_100900743 | 132 |
| 253 | 3300025919 | Ga0207657_10002122 | Ga0207657_1000212218 | 132 |
| 254 | 3300025924 | Ga0207694_10090801 | Ga0207694_100908012 | 132 |
| 255 | 3300025926 | Ga0207659_10350500 | Ga0207659_103505002 | 132 |
| 256 | 3300025927 | Ga0207687_10449382 | Ga0207687_104493822 | 132 |
| 257 | 3300025933 | Ga0207706_10000543 | Ga0207706_1000054318 | 132 |
| 258 | 3300025938 | Ga0207704_10010834 | Ga0207704_100108346 | 132 |
| 259 | 3300025942 | Ga0207689_10174303 | Ga0207689_101743032 | 132 |
| 260 | 3300025944 | Ga0207661_10020254 | Ga0207661_1002025410 | 132 |
| 261 | 3300025945 | Ga0207679_10001254 | Ga0207679_1000125418 | 132 |
| 262 | 3300026078 | Ga0207702_11322705 | Ga0207702_113227051 | 132 |
| 263 | 3300026116 | Ga0207674_10001283 | Ga0207674_1000128329 | 132 |
| 264 | 3300037312 | Ga0395899_0007520 | Ga0395899_0007520_5551_5973 | 132 |
| 265 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_96586_97008 | 132 |
| 266 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_78112_78534 | 132 |
| 267 | 3300038443 | Ga0395901_0000060 | Ga0395901_0000060_140689_141111 | 132 |
| 268 | 3300047472 | Ga0495686_0169707 | Ga0495686_0169707_209_643 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c8z-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9759 | 7 | 113 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9628 | 9 | 115 |
| 8c90-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9606 | 7 | 113 |
| 8c97-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.958 | 7 | 113 |
| 6czr-assembly2.cif.gz_2W | the structure of amicetin bound to the 70s ribosome | 0.951 | 7 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mmiT00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9344 | 8 | 116 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9323 | 7 | 117 | 3.90.470.10 |
| 5jvgP00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9312 | 10 | 116 | 3.90.470.10 |
| af_A0A0R0IDQ9_68_223_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9137 | 8 | 116 | 3.90.470.10 |
| af_P0C2C0_41_206_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9081 | 6 | 116 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-N0ACH3-F1-model_v4 | 50S ribosomal protein L22, chloroplastic | 0.9558 | 32 | 115 |
GO:0003735
GO:0006412 GO:0009507 GO:0015934 GO:0019843 |
| AF-A0A411L2I7-F1-model_v4 | Large ribosomal subunit protein uL22c | 0.9517 | 8 | 115 |
GO:0003735
GO:0006412 GO:0009507 GO:0015934 GO:0019843 |
| AF-A0A520N530-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9513 | 7 | 115 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1I1RJV0-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9502 | 7 | 113 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1Q5XPU4-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9495 | 7 | 115 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar