F375693

General Info

Members Datasets Scaffolds Average Seq Length
268 164 536 234

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0112111|Ga0466963_0112111_1017_1826
Length 269
Sequence LPTPSSRIIAPSEEAAGELLGADSSEAAVAFMPVTLLVGDGISIQPSCYSRLVNKWYCTDYLKDRHHDLTSALGQHLEITAWSLLLGVAIAFPLALIARRLPRLQGLILGASTMIYTIPSLALFPFLVPFTGLSMRTVVIGLALYALTILVRSMLAGLLGVPDEVRESATGLGYGRTRLLFRIELPLALPVIMAGLRVATVSTVALTTVGTLVSYGGLGNLIRDGVQNDFKAEILAASVLCVVLAVALDAVIVGCQWLATPWTHRRRTA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 2643221641 Nocardioides sp. Root122 Isolate Unclassified
160 2739367898 Nocardioides sp. CF479 Isolate Unclassified
161 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
162 2867369537 Streptomyces sp. Z26 Isolate Unclassified
163 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
164 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.37
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0.37
Rhizoplane 11.94
Rhizosphere 77.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0112111 3300044694 Bacteria 1873
2 rootL2_10271948 3300003322 Bacteria 2087
3 rootH1_10232983 3300003323 Bacteria 1500
4 Ga0070658_10009547 3300005327 Bacteria 7792
5 Ga0070658_10015652 3300005327 Bacteria 6066
6 Ga0070683_100013671 3300005329 Bacteria 7087
7 Ga0070683_100050325 3300005329 Bacteria 3857
8 Ga0070683_100051349 3300005329 Bacteria 3818
9 Ga0070682_100003667 3300005337 Bacteria 8520
10 Ga0070682_100436714 3300005337 Bacteria 999
11 Ga0068868_100116484 3300005338 Bacteria 2176
12 Ga0070660_100027410 3300005339 Bacteria 4251
13 Ga0070660_100110726 3300005339 Bacteria 2184
14 Ga0070661_100154624 3300005344 Bacteria 1735
15 Ga0070692_10015738 3300005345 Bacteria 3584
16 Ga0070659_100022867 3300005366 Bacteria 4777
17 Ga0070659_100027020 3300005366 Bacteria 4419
18 Ga0070714_100382745 3300005435 Bacteria 1327
19 Ga0070700_100121492 3300005441 Bacteria 1751
20 Ga0070663_100115846 3300005455 Bacteria 2019
21 Ga0070679_100442897 3300005530 Bacteria 1244
22 Ga0070684_100011875 3300005535 Bacteria 6954
23 Ga0070684_100135379 3300005535 Bacteria 2225
24 Ga0070686_100109678 3300005544 Bacteria 1878
25 Ga0070693_100095110 3300005547 Bacteria 1804
26 Ga0070665_100001178 3300005548 Bacteria 32035
27 Ga0068856_100263531 3300005614 Bacteria 1739
28 Ga0070702_100040338 3300005615 Bacteria 2611
29 Ga0068852_100147490 3300005616 Bacteria 2184
30 Ga0068852_100243373 3300005616 Bacteria 1720
31 Ga0068864_100038664 3300005618 Bacteria 4076
32 Ga0068861_100039291 3300005719 Bacteria 3530
33 Ga0068870_10215034 3300005840 Bacteria 1173
34 Ga0068858_100098765 3300005842 Bacteria 2722
35 Ga0068860_100000365 3300005843 Bacteria 59835
36 Ga0068862_100197370 3300005844 Bacteria 1813
37 Ga0081455_10137698 3300005937 Bacteria 1900
38 Ga0075365_10104390 3300006038 Bacteria 1943
39 Ga0075365_10112414 3300006038 Bacteria 1873
40 Ga0075365_10114565 3300006038 Bacteria 1855
41 Ga0075365_10123815 3300006038 Bacteria 1785
42 Ga0075365_10171598 3300006038 Bacteria 1514
43 Ga0075365_10199507 3300006038 Bacteria 1401
44 Ga0075365_10217759 3300006038 Bacteria 1339
45 Ga0075365_10349979 3300006038 Bacteria 1041
46 Ga0075368_10027830 3300006042 Bacteria 2182
47 Ga0075364_10088239 3300006051 Bacteria 2056
48 Ga0075370_10172434 3300006353 Bacteria 1272
49 Ga0068871_100132788 3300006358 Bacteria 2112
50 Ga0111539_10654360 3300009094 Bacteria 1223
51 Ga0105245_10016196 3300009098 Bacteria 6497
52 Ga0105245_10303353 3300009098 Bacteria 1568
53 Ga0105245_10319531 3300009098 Bacteria 1529
54 Ga0105245_10480344 3300009098 Bacteria 1256
55 Ga0105245_10835779 3300009098 Bacteria 960
56 Ga0105243_10028652 3300009148 Bacteria 4276
57 Ga0105248_10073237 3300009177 Bacteria 3850
58 Ga0105238_10248119 3300009551 Bacteria 1758
59 Ga0105249_10034175 3300009553 Bacteria 4605
60 Ga0105239_10009882 3300010375 Bacteria 10717
61 Ga0105239_10102771 3300010375 Bacteria 3163
62 Ga0105246_10003036 3300011119 Bacteria 10187
63 Ga0105246_10109259 3300011119 Bacteria 2028
64 Ga0157371_10097180 3300013102 Bacteria 2087
65 Ga0157369_10045135 3300013105 Bacteria 4795
66 Ga0157369_10529898 3300013105 Bacteria 1218
67 Ga0157374_10095758 3300013296 Bacteria 2839
68 Ga0157378_10635832 3300013297 Bacteria 1081
69 Ga0163162_10022080 3300013306 Bacteria 6271
70 Ga0157372_10021504 3300013307 Bacteria 6970
71 Ga0157372_10914921 3300013307 Bacteria 1017
72 Ga0157375_10103372 3300013308 Bacteria 2936
73 Ga0157380_10089686 3300014326 Bacteria 2534
74 Ga0157379_10094936 3300014968 Bacteria 2676
75 Ga0163161_10059103 3300017792 Bacteria 2787
76 Ga0163161_10270066 3300017792 Bacteria 1331
77 Ga0206353_11353733 3300020082 Bacteria 804
78 Ga0207688_10010479 3300025901 Bacteria 5044
79 Ga0207647_10010406 3300025904 Bacteria 6569
80 Ga0207647_10049734 3300025904 Bacteria 2599
81 Ga0207647_10067257 3300025904 Bacteria 2172
82 Ga0207705_10005912 3300025909 Bacteria 9099
83 Ga0207705_10039628 3300025909 Bacteria 3377
84 Ga0207705_10051843 3300025909 Bacteria 2953
85 Ga0207705_10063837 3300025909 Bacteria 2661
86 Ga0207657_10011263 3300025919 Bacteria 8886
87 Ga0207652_10296506 3300025921 Bacteria 1459
88 Ga0207694_10215299 3300025924 Bacteria 1566
89 Ga0207687_10029038 3300025927 Bacteria 3718
90 Ga0207690_10039837 3300025932 Bacteria 3068
91 Ga0207690_10147160 3300025932 Bacteria 1742
92 Ga0207690_10712240 3300025932 Bacteria 826
93 Ga0207706_10375646 3300025933 Bacteria 1234
94 Ga0207709_10033922 3300025935 Bacteria 3003
95 Ga0207711_10020758 3300025941 Bacteria 5481
96 Ga0207661_10020394 3300025944 Bacteria 4954
97 Ga0207661_10024010 3300025944 Bacteria 4614
98 Ga0207661_10102121 3300025944 Bacteria 2410
99 Ga0207712_10033609 3300025961 Bacteria 3468
100 Ga0207658_10097793 3300025986 Bacteria 2292
101 Ga0207703_10061302 3300026035 Bacteria 3079
102 Ga0207678_10452519 3300026067 Bacteria 1116
103 Ga0207708_10061981 3300026075 Bacteria 2856
104 Ga0207702_10468387 3300026078 Bacteria 1225
105 Ga0207676_10056814 3300026095 Bacteria 3079
106 Ga0207674_10049330 3300026116 Bacteria 4306
107 Ga0207675_100017146 3300026118 Bacteria 6763
108 Ga0207683_10199412 3300026121 Bacteria 1819
109 Ga0207698_10117369 3300026142 Bacteria 2245
110 Ga0207428_10347348 3300027907 Bacteria 1092
111 Ga0268266_10002984 3300028379 Bacteria 17445
112 Ga0268266_10247129 3300028379 Bacteria 1649
113 Ga0268264_10000249 3300028381 Bacteria 101309
114 Ga0316181_1113292 3300030744 Bacteria 1643
115 Ga0307408_100588049 3300031548 Bacteria 987
116 Ga0307413_10191190 3300031824 Bacteria 1470
117 Ga0307412_10034863 3300031911 Bacteria 3210
118 Ga0307409_100185988 3300031995 Bacteria 1844
119 Ga0307416_100199759 3300032002 Bacteria 1896
120 Ga0307411_10170092 3300032005 Bacteria 1642
121 Ga0307411_10204637 3300032005 Bacteria 1519
122 Ga0307411_10215416 3300032005 Bacteria 1486
123 Ga0395899_0465119 3300037312 Bacteria 826
124 Ga0395900_0010285 3300037418 Bacteria 9572
125 Ga0395900_0086524 3300037418 Bacteria 3221
126 Ga0395898_0005639 3300037466 Bacteria 13494
127 Ga0395898_0047392 3300037466 Bacteria 4218
128 Ga0395901_0059092 3300038443 Bacteria 3989
129 Ga0451797_0568466 3300041453 Bacteria 1171
130 Ga0451797_1508134 3300041453 Bacteria 1368
131 Ga0451849_1176481 3300041505 Bacteria 1331
132 Ga0439446_0005962 3300042156 Bacteria 3157
133 Ga0466972_0083277 3300044658 Bacteria 1522
134 Ga0466965_0045730 3300044683 Bacteria 2166
135 Ga0466966_0012506 3300044684 Bacteria 5621
136 Ga0466961_0048954 3300044693 Bacteria 2702
137 Ga0466961_0057761 3300044693 Bacteria 2469
138 Ga0466963_0001511 3300044694 Bacteria 12579
139 Ga0466963_0070069 3300044694 Bacteria 2358
140 Ga0466963_0101871 3300044694 Bacteria 1966
141 Ga0466964_0005184 3300044706 Bacteria 4831
142 Ga0466964_0078866 3300044706 Bacteria 1409
143 Ga0466968_0124944 3300044735 Bacteria 1167
144 Ga0466970_0050914 3300044765 Bacteria 2209
145 Ga0466970_0151045 3300044765 Bacteria 1282
146 Ga0466970_0151787 3300044765 Bacteria 1279
147 Ga0466957_0246911 3300044842 Bacteria 1186
148 Ga0466957_0318892 3300044842 Bacteria 1048
149 Ga0466960_0024477 3300044901 Bacteria 2724
150 Ga0466959_0033526 3300045049 Bacteria 3797
151 Ga0451576_0152068 3300045051 Bacteria 2414
152 Ga0466958_0166792 3300045836 Bacteria 1393
153 Ga0466967_0204605 3300045976 Bacteria 1870
154 Ga0466967_0241861 3300045976 Bacteria 1722
155 Ga0466967_0252027 3300045976 Bacteria 1686
156 Ga0495653_0248756 3300046463 Bacteria 1181
157 Ga0495653_0473567 3300046463 Bacteria 784
158 Ga0495622_0089702 3300046557 Bacteria 1413
159 Ga0495604_0711243 3300047317 Bacteria 637
160 Ga0495674_0172372 3300047319 Bacteria 1805
161 Ga0495680_0179479 3300047322 Bacteria 1529
162 Ga0496100_0051044 3300048903 Bacteria 2683
163 Ga0496100_0140128 3300048903 Bacteria 1713
164 Ga0496101_0287499 3300048904 Bacteria 1286
165 Ga0496101_0409895 3300048904 Bacteria 1068
166 Ga0496102_0009562 3300048905 Bacteria 8339
167 Ga0496102_0072447 3300048905 Bacteria 3166
168 Ga0496102_0112144 3300048905 Bacteria 2543
169 Ga0496103_0010437 3300048906 Bacteria 5496
170 Ga0496104_0007837 3300048907 Bacteria 9465
171 Ga0496104_0298102 3300048907 Bacteria 1524
172 Ga0496105_0456776 3300048908 Bacteria 1007
173 Ga0496107_0228987 3300048910 Bacteria 1383
174 Ga0496108_0277960 3300048911 Bacteria 1458
175 Ga0496109_0018886 3300048912 Bacteria 6068
176 Ga0496109_0022772 3300048912 Bacteria 5551
177 Ga0496109_0223128 3300048912 Bacteria 1772
178 Ga0496109_0293902 3300048912 Bacteria 1532
179 Ga0496109_0789973 3300048912 Bacteria 887
180 Ga0496110_0022888 3300048913 Bacteria 5310
181 Ga0496110_0122060 3300048913 Bacteria 2348
182 Ga0496111_0015675 3300048914 Bacteria 5209
183 Ga0496113_0033754 3300048916 Bacteria 3729
184 Ga0496114_0011404 3300048917 Bacteria 7102
185 Ga0496114_0049743 3300048917 Bacteria 3488
186 Ga0496114_0053317 3300048917 Bacteria 3371
187 Ga0496114_0088577 3300048917 Bacteria 2625
188 Ga0496114_0137330 3300048917 Bacteria 2115
189 Ga0496114_0199196 3300048917 Bacteria 1754
190 Ga0496115_0003375 3300048918 Bacteria 11456
191 Ga0496115_0033977 3300048918 Bacteria 4030
192 Ga0501031_0175166 3300049568 Bacteria 1401
193 Ga0501032_0046033 3300049569 Bacteria 2949
194 Ga0501032_0077504 3300049569 Bacteria 2213
195 Ga0501033_0542273 3300049570 Bacteria 802
196 Ga0501034_0039270 3300049571 Bacteria 4794
197 Ga0501039_0069387 3300049575 Bacteria 2737
198 Ga0501039_0330299 3300049575 Bacteria 1198
199 Ga0501039_0374109 3300049575 Bacteria 1119
200 Ga0501041_0057905 3300049577 Bacteria 2370
201 Ga0501042_0280545 3300049578 Bacteria 1203
202 Ga0501042_0310945 3300049578 Bacteria 1138
203 Ga0501047_0066600 3300049581 Bacteria 3472
204 Ga0501067_0000967 3300049583 Bacteria 15416
205 Ga0501067_0005029 3300049583 Bacteria 7342
206 Ga0501068_0007437 3300049584 Bacteria 6066
207 Ga0501068_0012383 3300049584 Bacteria 4835
208 Ga0501069_0025219 3300049585 Bacteria 3248
209 Ga0501069_0223975 3300049585 Bacteria 1094
210 Ga0501069_0233389 3300049585 Bacteria 1071
211 Ga0501070_0002693 3300049586 Bacteria 15512
212 Ga0501070_0008445 3300049586 Bacteria 8697
213 Ga0501070_0142171 3300049586 Bacteria 1981
214 Ga0501070_0188264 3300049586 Bacteria 1697
215 Ga0501071_0037485 3300049587 Bacteria 3462
216 Ga0501071_0059394 3300049587 Bacteria 2767
217 Ga0501072_0021580 3300049588 Bacteria 4995
218 Ga0501072_0135588 3300049588 Bacteria 1963
219 Ga0501072_0228349 3300049588 Bacteria 1483
220 Ga0501074_0001370 3300049590 Bacteria 16151
221 Ga0501074_0007028 3300049590 Bacteria 8128
222 Ga0501074_0011241 3300049590 Bacteria 6505
223 Ga0501074_0237487 3300049590 Bacteria 1297
224 Ga0501076_0088235 3300049592 Bacteria 2493
225 Ga0501076_0268961 3300049592 Bacteria 1396
226 Ga0501077_0003517 3300049593 Bacteria 9407
227 Ga0501079_0037418 3300049741 Bacteria 3740
228 Ga0501079_0268916 3300049741 Bacteria 1333
229 Ga0501079_0280117 3300049741 Bacteria 1304
230 Ga0501080_0039676 3300049742 Bacteria 4394
231 Ga0501080_0083250 3300049742 Bacteria 2972
232 Ga0501080_0095474 3300049742 Bacteria 2761
233 Ga0501080_0217071 3300049742 Bacteria 1751
234 Ga0501081_0191707 3300049743 Bacteria 1480
235 Ga0501083_0012551 3300049744 Bacteria 5926
236 Ga0501083_0043909 3300049744 Bacteria 3027
237 Ga0501035_0316405 3300049822 Bacteria 1312
238 Ga0501044_0325479 3300049823 Bacteria 1461
239 Ga0501045_0051126 3300049824 Bacteria 3016
240 Ga0501045_0093419 3300049824 Bacteria 2225
241 Ga0501045_0128372 3300049824 Bacteria 1884
242 nmdc:mga0yw44_103282_c1 3300050492 Bacteria 1818
243 nmdc:mga0yw44_203443_c1 3300050492 Bacteria 1308
244 nmdc:mga0yw44_36228_c1 3300050492 Bacteria 2906
245 nmdc:mga0yw44_412497_c1 3300050492 Bacteria 914
246 nmdc:mga0yw44_60619_c1 3300050492 Bacteria 2318
247 nmdc:mga0yw44_72013_c1 3300050492 Bacteria 2147
248 nmdc:mga0yw44_80481_c1 3300050492 Bacteria 2041
249 nmdc:mga0yw44_90853_c1 3300050492 Bacteria 1929
250 nmdc:mga06z11_175401_c1 3300050494 Bacteria 1233
251 nmdc:mga08y16_595236_c1 3300050511 Bacteria 1115
252 Ga0495619_0258249 3300053085 Bacteria 1207
253 Ga0500554_020454 3300053102 Bacteria 1820
254 Ga0500573_0007959 3300053140 Bacteria 5818
255 Ga0501084_0090192 3300054114 Bacteria 2573
256 Ga0501084_0173690 3300054114 Bacteria 1819
257 Ga0501084_0367405 3300054114 Bacteria 1216
258 Ga0501082_0119343 3300060353 Bacteria 2285
259 Ga0501082_0131233 3300060353 Bacteria 2174
260 Ga0501082_0216137 3300060353 Bacteria 1668
261 Ga0501082_0323716 3300060353 Bacteria 1343
262 Ga0530510_0172533 3300061734 Bacteria 1602
263 2644229610 2643221641 Bacteria 4490190
264 2740168362 2739367898 Bacteria 4367674
265 2768642037 2767802112 Bacteria 6465194
266 2867372987 2867369537 Bacteria 6501581
267 8054614243 8054609563 Bacteria 5170090
268 8056454029 8056447290 Bacteria 7680491
269 Ga0466963_0112111
270 rootL2_10271948
271 rootH1_10232983
272 Ga0070658_10009547
273 Ga0070658_10015652
274 Ga0070683_100013671
275 Ga0070683_100050325
276 Ga0070683_100051349
277 Ga0070682_100003667
278 Ga0070682_100436714
279 Ga0068868_100116484
280 Ga0070660_100027410
281 Ga0070660_100110726
282 Ga0070661_100154624
283 Ga0070692_10015738
284 Ga0070659_100022867
285 Ga0070659_100027020
286 Ga0070714_100382745
287 Ga0070700_100121492
288 Ga0070663_100115846
289 Ga0070679_100442897
290 Ga0070684_100011875
291 Ga0070684_100135379
292 Ga0070686_100109678
293 Ga0070693_100095110
294 Ga0070665_100001178
295 Ga0068856_100263531
296 Ga0070702_100040338
297 Ga0068852_100147490
298 Ga0068852_100243373
299 Ga0068864_100038664
300 Ga0068861_100039291
301 Ga0068870_10215034
302 Ga0068858_100098765
303 Ga0068860_100000365
304 Ga0068862_100197370
305 Ga0081455_10137698
306 Ga0075365_10104390
307 Ga0075365_10112414
308 Ga0075365_10114565
309 Ga0075365_10123815
310 Ga0075365_10171598
311 Ga0075365_10199507
312 Ga0075365_10217759
313 Ga0075365_10349979
314 Ga0075368_10027830
315 Ga0075364_10088239
316 Ga0075370_10172434
317 Ga0068871_100132788
318 Ga0111539_10654360
319 Ga0105245_10016196
320 Ga0105245_10303353
321 Ga0105245_10319531
322 Ga0105245_10480344
323 Ga0105245_10835779
324 Ga0105243_10028652
325 Ga0105248_10073237
326 Ga0105238_10248119
327 Ga0105249_10034175
328 Ga0105239_10009882
329 Ga0105239_10102771
330 Ga0105246_10003036
331 Ga0105246_10109259
332 Ga0157371_10097180
333 Ga0157369_10045135
334 Ga0157369_10529898
335 Ga0157374_10095758
336 Ga0157378_10635832
337 Ga0163162_10022080
338 Ga0157372_10021504
339 Ga0157372_10914921
340 Ga0157375_10103372
341 Ga0157380_10089686
342 Ga0157379_10094936
343 Ga0163161_10059103
344 Ga0163161_10270066
345 Ga0206353_11353733
346 Ga0207688_10010479
347 Ga0207647_10010406
348 Ga0207647_10049734
349 Ga0207647_10067257
350 Ga0207705_10005912
351 Ga0207705_10039628
352 Ga0207705_10051843
353 Ga0207705_10063837
354 Ga0207657_10011263
355 Ga0207652_10296506
356 Ga0207694_10215299
357 Ga0207687_10029038
358 Ga0207690_10039837
359 Ga0207690_10147160
360 Ga0207690_10712240
361 Ga0207706_10375646
362 Ga0207709_10033922
363 Ga0207711_10020758
364 Ga0207661_10020394
365 Ga0207661_10024010
366 Ga0207661_10102121
367 Ga0207712_10033609
368 Ga0207658_10097793
369 Ga0207703_10061302
370 Ga0207678_10452519
371 Ga0207708_10061981
372 Ga0207702_10468387
373 Ga0207676_10056814
374 Ga0207674_10049330
375 Ga0207675_100017146
376 Ga0207683_10199412
377 Ga0207698_10117369
378 Ga0207428_10347348
379 Ga0268266_10002984
380 Ga0268266_10247129
381 Ga0268264_10000249
382 Ga0316181_1113292
383 Ga0307408_100588049
384 Ga0307413_10191190
385 Ga0307412_10034863
386 Ga0307409_100185988
387 Ga0307416_100199759
388 Ga0307411_10170092
389 Ga0307411_10204637
390 Ga0307411_10215416
391 Ga0395899_0465119
392 Ga0395900_0010285
393 Ga0395900_0086524
394 Ga0395898_0005639
395 Ga0395898_0047392
396 Ga0395901_0059092
397 Ga0451797_0568466
398 Ga0451797_1508134
399 Ga0451849_1176481
400 Ga0439446_0005962
401 Ga0466972_0083277
402 Ga0466965_0045730
403 Ga0466966_0012506
404 Ga0466961_0048954
405 Ga0466961_0057761
406 Ga0466963_0001511
407 Ga0466963_0070069
408 Ga0466963_0101871
409 Ga0466964_0005184
410 Ga0466964_0078866
411 Ga0466968_0124944
412 Ga0466970_0050914
413 Ga0466970_0151045
414 Ga0466970_0151787
415 Ga0466957_0246911
416 Ga0466957_0318892
417 Ga0466960_0024477
418 Ga0466959_0033526
419 Ga0451576_0152068
420 Ga0466958_0166792
421 Ga0466967_0204605
422 Ga0466967_0241861
423 Ga0466967_0252027
424 Ga0495653_0248756
425 Ga0495653_0473567
426 Ga0495622_0089702
427 Ga0495604_0711243
428 Ga0495674_0172372
429 Ga0495680_0179479
430 Ga0496100_0051044
431 Ga0496100_0140128
432 Ga0496101_0287499
433 Ga0496101_0409895
434 Ga0496102_0009562
435 Ga0496102_0072447
436 Ga0496102_0112144
437 Ga0496103_0010437
438 Ga0496104_0007837
439 Ga0496104_0298102
440 Ga0496105_0456776
441 Ga0496107_0228987
442 Ga0496108_0277960
443 Ga0496109_0018886
444 Ga0496109_0022772
445 Ga0496109_0223128
446 Ga0496109_0293902
447 Ga0496109_0789973
448 Ga0496110_0022888
449 Ga0496110_0122060
450 Ga0496111_0015675
451 Ga0496113_0033754
452 Ga0496114_0011404
453 Ga0496114_0049743
454 Ga0496114_0053317
455 Ga0496114_0088577
456 Ga0496114_0137330
457 Ga0496114_0199196
458 Ga0496115_0003375
459 Ga0496115_0033977
460 Ga0501031_0175166
461 Ga0501032_0046033
462 Ga0501032_0077504
463 Ga0501033_0542273
464 Ga0501034_0039270
465 Ga0501039_0069387
466 Ga0501039_0330299
467 Ga0501039_0374109
468 Ga0501041_0057905
469 Ga0501042_0280545
470 Ga0501042_0310945
471 Ga0501047_0066600
472 Ga0501067_0000967
473 Ga0501067_0005029
474 Ga0501068_0007437
475 Ga0501068_0012383
476 Ga0501069_0025219
477 Ga0501069_0223975
478 Ga0501069_0233389
479 Ga0501070_0002693
480 Ga0501070_0008445
481 Ga0501070_0142171
482 Ga0501070_0188264
483 Ga0501071_0037485
484 Ga0501071_0059394
485 Ga0501072_0021580
486 Ga0501072_0135588
487 Ga0501072_0228349
488 Ga0501074_0001370
489 Ga0501074_0007028
490 Ga0501074_0011241
491 Ga0501074_0237487
492 Ga0501076_0088235
493 Ga0501076_0268961
494 Ga0501077_0003517
495 Ga0501079_0037418
496 Ga0501079_0268916
497 Ga0501079_0280117
498 Ga0501080_0039676
499 Ga0501080_0083250
500 Ga0501080_0095474
501 Ga0501080_0217071
502 Ga0501081_0191707
503 Ga0501083_0012551
504 Ga0501083_0043909
505 Ga0501035_0316405
506 Ga0501044_0325479
507 Ga0501045_0051126
508 Ga0501045_0093419
509 Ga0501045_0128372
510 nmdc:mga0yw44_103282_c1
511 nmdc:mga0yw44_203443_c1
512 nmdc:mga0yw44_36228_c1
513 nmdc:mga0yw44_412497_c1
514 nmdc:mga0yw44_60619_c1
515 nmdc:mga0yw44_72013_c1
516 nmdc:mga0yw44_80481_c1
517 nmdc:mga0yw44_90853_c1
518 nmdc:mga06z11_175401_c1
519 nmdc:mga08y16_595236_c1
520 Ga0495619_0258249
521 Ga0500554_020454
522 Ga0500573_0007959
523 Ga0501084_0090192
524 Ga0501084_0173690
525 Ga0501084_0367405
526 Ga0501082_0119343
527 Ga0501082_0131233
528 Ga0501082_0216137
529 Ga0501082_0323716
530 Ga0530510_0172533
531 2644229610
532 2740168362
533 2768642037
534 2867372987
535 8054614243
536 8056454029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

83

262

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.8412 26 208
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8317 26 208
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7978 32 207
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7887 23 216
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7704 23 224
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8804 29 213 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8678 32 211 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8632 32 211 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8623 31 213 1.10.3720.10
af_P33361_169_379_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8561 28 214 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A327U5H3-F1-model_v4 Osmoprotectant transport system permease protein 0.9077 12 220 GO:0005886
GO:0031460
GO:0055085
AF-A0A2X3LP55-F1-model_v4 deleted 0.9038 11 220
AF-A0A1E7LAL4-F1-model_v4 ABC transporter permease 0.901 15 220 GO:0005886
GO:0031460
GO:0055085
AF-A9B7N0-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.8983 23 215 GO:0005886
GO:0031460
GO:0055085
AF-A0A6L9J0K4-F1-model_v4 ABC transporter permease 0.8957 23 217 GO:0005886
GO:0031460
GO:0055085

Map