F375677

General Info

Members Datasets Scaffolds Average Seq Length
268 193 536 290

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0204458|Ga0451793_0204458_302_1288
Length 328
Sequence MDPDTTAGDTKEFCMSSNDSPLSGKVAIVTGSGRGLGLAYAAELARQGASVVINDVDAATAADAVASIEAAGGRAVAVVAPVGPTETARQLVAAAAENFGRLDILVTNAGVLRDTVLWKMSDDDFDTVINVHLRGTFTCVREAAVHMRANGVAGRIICIGSPTGQRGNFGQTNYAAAKAGIVGMVRTWALELRKAEVTVNAVIPVAATAMTATVPYFAAAVEADAKGEPMPEFFRHELGFGTADDVSGLVAYLASDAAAGVTGQAIGVGGDRIQLWSHPEPVETRYREGGWSYDDLAASFDAEFGGSLQSVGETFPPLPPELQRDAAS

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
162 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
163 2643221546 Microbacterium sp. Root53 Isolate Unclassified
164 2643221575 Microbacterium sp. Root61 Isolate Unclassified
165 2643221597 Microbacterium sp. Root180 Isolate Unclassified
166 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
167 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
168 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
169 2808606372 Agromyces sp. 23-23 Isolate Unclassified
170 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
171 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
172 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
173 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
174 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
175 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
176 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
177 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
178 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
179 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
180 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
181 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
182 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
183 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
184 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
185 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
186 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
187 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
188 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
189 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
190 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
191 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
192 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
193 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.31
Metatranscriptomes 0.75
Isolates 11.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0.37
Rhizoplane 7.09
Rhizosphere 69.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0204458 3300041452 Bacteria 1323
2 JGI24735J21928_10026603 3300002067 Bacteria 1738
3 rootH1_10003338 3300003316 Bacteria 2255
4 rootH1_10093599 3300003323 Bacteria 3768
5 Ga0070658_10007942 3300005327 Bacteria 8543
6 Ga0070658_10013664 3300005327 Bacteria 6514
7 Ga0070683_100045794 3300005329 Bacteria 4038
8 Ga0070683_100116845 3300005329 Bacteria 2519
9 Ga0070670_100153442 3300005331 Bacteria 1994
10 Ga0068869_100257768 3300005334 Bacteria 1395
11 Ga0070680_100025883 3300005336 Bacteria 4691
12 Ga0070682_100001299 3300005337 Bacteria 14147
13 Ga0070682_100005479 3300005337 Bacteria 7064
14 Ga0070682_100324879 3300005337 Bacteria 1138
15 Ga0068868_100083604 3300005338 Bacteria 2563
16 Ga0068868_100228404 3300005338 Bacteria 1560
17 Ga0070660_100088335 3300005339 Bacteria 2441
18 Ga0070689_100000047 3300005340 Bacteria 75697
19 Ga0070689_100003909 3300005340 Bacteria 9987
20 Ga0070689_100432066 3300005340 Bacteria 1118
21 Ga0070687_100102831 3300005343 Bacteria 1603
22 Ga0070692_10045778 3300005345 Bacteria 2258
23 Ga0070669_100024499 3300005353 Bacteria 4326
24 Ga0070673_100000416 3300005364 Bacteria 22479
25 Ga0070673_100031342 3300005364 Bacteria 3988
26 Ga0070688_100009254 3300005365 Bacteria 5377
27 Ga0070659_100107352 3300005366 Bacteria 2251
28 Ga0070659_100123604 3300005366 Bacteria 2098
29 Ga0070713_100149694 3300005436 Bacteria 2075
30 Ga0070681_10525070 3300005458 Bacteria 1097
31 Ga0068867_100024978 3300005459 Bacteria 4285
32 Ga0070679_100000180 3300005530 Bacteria 50879
33 Ga0070679_100046295 3300005530 Bacteria 4335
34 Ga0070679_100058250 3300005530 Bacteria 3849
35 Ga0070684_100000578 3300005535 Bacteria 25373
36 Ga0070684_100013218 3300005535 Bacteria 6648
37 Ga0070684_100057336 3300005535 Bacteria 3401
38 Ga0070684_100144029 3300005535 Bacteria 2156
39 Ga0068853_100011277 3300005539 Bacteria 7253
40 Ga0068853_100109971 3300005539 Bacteria 2447
41 Ga0070672_100006714 3300005543 Bacteria 7759
42 Ga0070672_100178246 3300005543 Bacteria 1770
43 Ga0070672_100275098 3300005543 Bacteria 1423
44 Ga0070686_100013522 3300005544 Bacteria 4677
45 Ga0070686_100099896 3300005544 Bacteria 1958
46 Ga0070665_100345879 3300005548 Bacteria 1492
47 Ga0068855_100221970 3300005563 Bacteria 2118
48 Ga0068855_100644229 3300005563 Bacteria 1138
49 Ga0068857_100297578 3300005577 Bacteria 1487
50 Ga0068856_100078170 3300005614 Bacteria 3280
51 Ga0068852_100035711 3300005616 Bacteria 4149
52 Ga0068864_100397008 3300005618 Bacteria 1310
53 Ga0068860_100239397 3300005843 Bacteria 1765
54 Ga0075367_10125505 3300006178 Bacteria 1584
55 Ga0075370_10060075 3300006353 Bacteria 2165
56 Ga0068871_100050332 3300006358 Bacteria 3370
57 Ga0075430_100000856 3300006846 Bacteria 23866
58 Ga0068865_100011901 3300006881 Bacteria 5460
59 Ga0068865_100320697 3300006881 Bacteria 1246
60 Ga0105244_10023906 3300009036 Bacteria 3342
61 Ga0105244_10053055 3300009036 Bacteria 2062
62 Ga0105240_10000369 3300009093 Bacteria 84513
63 Ga0111539_10007875 3300009094 Bacteria 13601
64 Ga0105243_10007540 3300009148 Bacteria 8364
65 Ga0105237_10000102 3300009545 Bacteria 118684
66 Ga0105237_10000989 3300009545 Bacteria 38202
67 Ga0105238_10101291 3300009551 Bacteria 2863
68 Ga0105239_10001012 3300010375 Bacteria 39279
69 Ga0157380_10023707 3300014326 Bacteria 4633
70 Ga0157379_10026679 3300014968 Bacteria 5142
71 Ga0157379_10161090 3300014968 Bacteria 2025
72 Ga0157376_10304052 3300014969 Bacteria 1511
73 Ga0206356_10161964 3300020070 Bacteria 4504
74 Ga0206353_10467035 3300020082 Bacteria 4546
75 Ga0209677_100275 3300025253 Bacteria 34315
76 Ga0207655_1003189 3300025728 Bacteria 12360
77 Ga0207655_1007711 3300025728 Bacteria 6945
78 Ga0207645_10018892 3300025907 Bacteria 4527
79 Ga0207705_10007694 3300025909 Bacteria 7920
80 Ga0207705_10205535 3300025909 Bacteria 1493
81 Ga0207707_10351366 3300025912 Bacteria 1270
82 Ga0207695_10000923 3300025913 Bacteria 52620
83 Ga0207671_10000201 3300025914 Bacteria 91167
84 Ga0207671_10006521 3300025914 Bacteria 10371
85 Ga0207660_10017691 3300025917 Bacteria 4741
86 Ga0207662_10131339 3300025918 Bacteria 1579
87 Ga0207657_10151787 3300025919 Bacteria 1886
88 Ga0207652_10008219 3300025921 Bacteria 8381
89 Ga0207652_10058449 3300025921 Bacteria 3323
90 Ga0207652_10077787 3300025921 Bacteria 2895
91 Ga0207652_10208906 3300025921 Bacteria 1757
92 Ga0207646_10102410 3300025922 Bacteria 2567
93 Ga0207681_10001721 3300025923 Bacteria 14068
94 Ga0207694_10006864 3300025924 Bacteria 8645
95 Ga0207694_10029267 3300025924 Bacteria 4202
96 Ga0207659_10056139 3300025926 Bacteria 2819
97 Ga0207659_10119327 3300025926 Bacteria 2019
98 Ga0207700_10080167 3300025928 Bacteria 2545
99 Ga0207690_10073362 3300025932 Bacteria 2367
100 Ga0207690_10094211 3300025932 Bacteria 2124
101 Ga0207690_10134838 3300025932 Bacteria 1812
102 Ga0207706_10017215 3300025933 Bacteria 6515
103 Ga0207709_10003631 3300025935 Bacteria 9108
104 Ga0207670_10000064 3300025936 Bacteria 75795
105 Ga0207670_10044356 3300025936 Bacteria 2941
106 Ga0207670_10091713 3300025936 Bacteria 2149
107 Ga0207704_10001676 3300025938 Bacteria 9919
108 Ga0207704_10259424 3300025938 Bacteria 1310
109 Ga0207691_10014659 3300025940 Bacteria 7473
110 Ga0207691_10055287 3300025940 Bacteria 3618
111 Ga0207711_10474364 3300025941 Bacteria 1165
112 Ga0207689_10240658 3300025942 Bacteria 1496
113 Ga0207661_10003808 3300025944 Bacteria 10516
114 Ga0207661_10014380 3300025944 Bacteria 5799
115 Ga0207661_10157580 3300025944 Bacteria 1968
116 Ga0207667_10014505 3300025949 Bacteria 8981
117 Ga0207667_10077636 3300025949 Bacteria 3444
118 Ga0207667_10206452 3300025949 Bacteria 2014
119 Ga0207651_10053980 3300025960 Bacteria 2750
120 Ga0207651_10083148 3300025960 Bacteria 2314
121 Ga0207668_10132773 3300025972 Bacteria 1903
122 Ga0207677_10097328 3300026023 Bacteria 2156
123 Ga0207703_10012473 3300026035 Bacteria 6626
124 Ga0207639_10013213 3300026041 Bacteria 5772
125 Ga0207708_10000345 3300026075 Bacteria 36410
126 Ga0207708_10300067 3300026075 Bacteria 1306
127 Ga0207702_10222130 3300026078 Bacteria 1761
128 Ga0207648_10018918 3300026089 Bacteria 6221
129 Ga0207674_10029201 3300026116 Bacteria 5808
130 Ga0207674_10272984 3300026116 Bacteria 1638
131 Ga0207675_100106772 3300026118 Bacteria 2640
132 Ga0207675_100207252 3300026118 Bacteria 1884
133 Ga0207683_10081592 3300026121 Bacteria 2871
134 Ga0207698_10069710 3300026142 Bacteria 2782
135 Ga0207428_10138098 3300027907 Bacteria 1863
136 Ga0268266_10320073 3300028379 Bacteria 1451
137 Ga0268266_10330151 3300028379 Bacteria 1429
138 Ga0268264_10106301 3300028381 Bacteria 2450
139 Ga0265319_1031149 3300028563 Bacteria 1859
140 Ga0307515_10001030 3300028794 Bacteria 63698
141 Ga0307512_10002715 3300030522 Bacteria 21708
142 Ga0265332_10023842 3300031238 Bacteria 2697
143 Ga0307508_10140083 3300031616 Bacteria 2022
144 Ga0316575_10000001 3300031665 Bacteria 151281
145 Ga0307405_10267661 3300031731 Bacteria 1280
146 Ga0307410_10080053 3300031852 Bacteria 2291
147 Ga0307410_10110048 3300031852 Bacteria 1992
148 Ga0307406_10000260 3300031901 Bacteria 31960
149 Ga0307407_10093861 3300031903 Bacteria 1846
150 Ga0307407_10308806 3300031903 Bacteria 1106
151 Ga0307412_10240589 3300031911 Bacteria 1400
152 Ga0307409_100065891 3300031995 Bacteria 2853
153 Ga0307409_100491059 3300031995 Bacteria 1193
154 Ga0307507_10015555 3300033179 Bacteria 8937
155 Ga0307510_10082116 3300033180 Bacteria 3120
156 Ga0373954_0000838 3300035118 Bacteria 11944
157 Ga0373956_0002081 3300035119 Bacteria 8293
158 Ga0373955_0003268 3300035172 Bacteria 7106
159 Ga0373955_0085528 3300035172 Bacteria 1790
160 Ga0373937_0003286 3300036401 Bacteria 13564
161 Ga0373937_0040166 3300036401 Bacteria 4265
162 Ga0395899_0000716 3300037312 Bacteria 33232
163 Ga0436361_0847953 3300039447 Bacteria 1883
164 Ga0436363_1608341 3300039450 Bacteria 1542
165 Ga0451793_0925193 3300041452 Bacteria 1487
166 Ga0451795_0507694 3300041456 Bacteria 2686
167 Ga0451843_0021775 3300041509 Bacteria 2912
168 Ga0451853_0504170 3300041512 Bacteria 3951
169 Ga0466970_0000036 3300044765 Bacteria 48597
170 Ga0466960_0017343 3300044901 Bacteria 3138
171 Ga0495638_0072871 3300046460 Bacteria 2098
172 Ga0495650_0000546 3300046471 Bacteria 53831
173 Ga0495650_0048250 3300046471 Bacteria 1776
174 Ga0495664_0254367 3300046477 Bacteria 1062
175 Ga0495632_0027616 3300046519 Bacteria 2971
176 Ga0495634_0111028 3300046642 Bacteria 1763
177 Ga0496100_0043322 3300048903 Bacteria 2878
178 Ga0496101_0003440 3300048904 Bacteria 9879
179 Ga0496104_0005983 3300048907 Bacteria 10657
180 Ga0496105_0072907 3300048908 Bacteria 2837
181 Ga0496105_0188914 3300048908 Bacteria 1685
182 Ga0496108_0316968 3300048911 Bacteria 1359
183 Ga0496110_0415022 3300048913 Bacteria 1227
184 Ga0496111_0259433 3300048914 Bacteria 1290
185 Ga0496112_0087691 3300048915 Bacteria 3079
186 Ga0496114_0000501 3300048917 Bacteria 28631
187 Ga0496114_0004316 3300048917 Bacteria 11000
188 Ga0496114_0006547 3300048917 Bacteria 9181
189 Ga0496114_0168341 3300048917 Bacteria 1909
190 Ga0496114_0414359 3300048917 Bacteria 1193
191 Ga0496115_0016063 3300048918 Bacteria 5693
192 Ga0496115_0256291 3300048918 Bacteria 1439
193 Ga0496117_0041851 3300048920 Bacteria 3350
194 Ga0496117_0091826 3300048920 Bacteria 1951
195 Ga0496118_0003593 3300048921 Bacteria 19299
196 Ga0496118_0009260 3300048921 Bacteria 9989
197 Ga0496118_0064902 3300048921 Bacteria 2675
198 Ga0496119_0001684 3300048922 Bacteria 25841
199 Ga0496119_0002946 3300048922 Bacteria 18089
200 Ga0496119_0007391 3300048922 Bacteria 9910
201 Ga0496120_0006761 3300048923 Bacteria 8709
202 Ga0496120_0056330 3300048923 Bacteria 2219
203 Ga0496122_0000358 3300048925 Bacteria 98103
204 Ga0496122_0117203 3300048925 Bacteria 1729
205 Ga0496122_0225162 3300048925 Bacteria 1072
206 Ga0496123_0000011 3300048926 Bacteria 493925
207 Ga0496123_0000280 3300048926 Bacteria 100544
208 Ga0496123_0045975 3300048926 Bacteria 2966
209 Ga0496124_0000899 3300048927 Bacteria 48070
210 Ga0496124_0015167 3300048927 Bacteria 7401
211 Ga0496125_0015535 3300048928 Bacteria 7358
212 Ga0496125_0018179 3300048928 Bacteria 6680
213 Ga0496125_0029138 3300048928 Bacteria 4968
214 Ga0496126_0065599 3300048929 Bacteria 3248
215 Ga0501033_0056012 3300049570 Bacteria 2915
216 Ga0501034_0021981 3300049571 Bacteria 6499
217 Ga0501034_0159112 3300049571 Bacteria 2231
218 Ga0501037_0062844 3300049573 Bacteria 2707
219 Ga0501042_0151766 3300049578 Bacteria 1671
220 Ga0501043_0144604 3300049579 Bacteria 1862
221 Ga0501067_0017284 3300049583 Bacteria 3986
222 Ga0501070_0009782 3300049586 Bacteria 8112
223 Ga0501070_0019118 3300049586 Bacteria 5746
224 Ga0501073_0000052 3300049589 Bacteria 73681
225 Ga0501079_0211987 3300049741 Bacteria 1513
226 Ga0501080_0091880 3300049742 Bacteria 2819
227 nmdc:mga07m45_43701_c1 3300050496 Bacteria 2512
228 nmdc:mga0qj67_654_c1 3300050509 Bacteria 23875
229 nmdc:mga08y16_1688_c1 3300050511 Bacteria 22410
230 Ga0500556_0000028 3300053104 Bacteria 165503
231 Ga0500556_0001032 3300053104 Bacteria 14543
232 Ga0500652_014170 3300053131 Bacteria 2844
233 Ga0500568_0000009 3300053139 Bacteria 270298
234 Ga0500600_0039520 3300053149 Bacteria 2729
235 Ga0500616_0002712 3300053153 Bacteria 14368
236 Ga0500599_004770 3300053736 Bacteria 1685
237 2523384506 2523231044 Bacteria 6434991
238 2643753961 2643221546 Bacteria 2910897
239 2643887871 2643221575 Bacteria 4022601
240 2643997800 2643221597 Bacteria 3347721
241 2644680784 2643221724 Bacteria 3593515
242 2772642093 2772190715 Bacteria 6959372
243 2774397716 2773857763 Bacteria 4180068
244 2808900378 2808606372 Bacteria 4649509
245 2809226070 2808606447 Bacteria 3572005
246 2812325014 2811994872 Bacteria 4121241
247 2821271286 2821268502 Bacteria 3750023
248 2831937719 2831935698 Bacteria 5963223
249 2832007022 2832004796 Bacteria 6538017
250 2852632359 2852632344 Bacteria 3463163
251 2866070328 2866065130 Bacteria 6518152
252 2867508404 2867507094 Bacteria 6506033
253 2868095547 2868088558 Bacteria 7609351
254 2880490442 2880489317 Bacteria 7096270
255 2880502076 2880495981 Bacteria 7340502
256 2891400974 2891395885 Bacteria 9251614
257 2904766919 2904765812 Bacteria 5369154
258 2904775069 2904770941 Bacteria 5580202
259 2906802373 2906799679 Bacteria 4031749
260 2919420646 2919420072 Bacteria 5390363
261 2919433596 2919432681 Bacteria 5390474
262 2945969450 2945968032 Bacteria 4111363
263 8003873694 8003870546 Bacteria 7396674
264 8016256750 8016254467 Bacteria 3797036
265 8045831352 8045830549 Bacteria 4444727
266 8054734114 8054727385 Bacteria 7558670
267 8055034794 8055034563 Bacteria 3562128
268 8055039620 8055037949 Bacteria 3337834
269 Ga0451793_0204458
270 JGI24735J21928_10026603
271 rootH1_10003338
272 rootH1_10093599
273 Ga0070658_10007942
274 Ga0070658_10013664
275 Ga0070683_100045794
276 Ga0070683_100116845
277 Ga0070670_100153442
278 Ga0068869_100257768
279 Ga0070680_100025883
280 Ga0070682_100001299
281 Ga0070682_100005479
282 Ga0070682_100324879
283 Ga0068868_100083604
284 Ga0068868_100228404
285 Ga0070660_100088335
286 Ga0070689_100000047
287 Ga0070689_100003909
288 Ga0070689_100432066
289 Ga0070687_100102831
290 Ga0070692_10045778
291 Ga0070669_100024499
292 Ga0070673_100000416
293 Ga0070673_100031342
294 Ga0070688_100009254
295 Ga0070659_100107352
296 Ga0070659_100123604
297 Ga0070713_100149694
298 Ga0070681_10525070
299 Ga0068867_100024978
300 Ga0070679_100000180
301 Ga0070679_100046295
302 Ga0070679_100058250
303 Ga0070684_100000578
304 Ga0070684_100013218
305 Ga0070684_100057336
306 Ga0070684_100144029
307 Ga0068853_100011277
308 Ga0068853_100109971
309 Ga0070672_100006714
310 Ga0070672_100178246
311 Ga0070672_100275098
312 Ga0070686_100013522
313 Ga0070686_100099896
314 Ga0070665_100345879
315 Ga0068855_100221970
316 Ga0068855_100644229
317 Ga0068857_100297578
318 Ga0068856_100078170
319 Ga0068852_100035711
320 Ga0068864_100397008
321 Ga0068860_100239397
322 Ga0075367_10125505
323 Ga0075370_10060075
324 Ga0068871_100050332
325 Ga0075430_100000856
326 Ga0068865_100011901
327 Ga0068865_100320697
328 Ga0105244_10023906
329 Ga0105244_10053055
330 Ga0105240_10000369
331 Ga0111539_10007875
332 Ga0105243_10007540
333 Ga0105237_10000102
334 Ga0105237_10000989
335 Ga0105238_10101291
336 Ga0105239_10001012
337 Ga0157380_10023707
338 Ga0157379_10026679
339 Ga0157379_10161090
340 Ga0157376_10304052
341 Ga0206356_10161964
342 Ga0206353_10467035
343 Ga0209677_100275
344 Ga0207655_1003189
345 Ga0207655_1007711
346 Ga0207645_10018892
347 Ga0207705_10007694
348 Ga0207705_10205535
349 Ga0207707_10351366
350 Ga0207695_10000923
351 Ga0207671_10000201
352 Ga0207671_10006521
353 Ga0207660_10017691
354 Ga0207662_10131339
355 Ga0207657_10151787
356 Ga0207652_10008219
357 Ga0207652_10058449
358 Ga0207652_10077787
359 Ga0207652_10208906
360 Ga0207646_10102410
361 Ga0207681_10001721
362 Ga0207694_10006864
363 Ga0207694_10029267
364 Ga0207659_10056139
365 Ga0207659_10119327
366 Ga0207700_10080167
367 Ga0207690_10073362
368 Ga0207690_10094211
369 Ga0207690_10134838
370 Ga0207706_10017215
371 Ga0207709_10003631
372 Ga0207670_10000064
373 Ga0207670_10044356
374 Ga0207670_10091713
375 Ga0207704_10001676
376 Ga0207704_10259424
377 Ga0207691_10014659
378 Ga0207691_10055287
379 Ga0207711_10474364
380 Ga0207689_10240658
381 Ga0207661_10003808
382 Ga0207661_10014380
383 Ga0207661_10157580
384 Ga0207667_10014505
385 Ga0207667_10077636
386 Ga0207667_10206452
387 Ga0207651_10053980
388 Ga0207651_10083148
389 Ga0207668_10132773
390 Ga0207677_10097328
391 Ga0207703_10012473
392 Ga0207639_10013213
393 Ga0207708_10000345
394 Ga0207708_10300067
395 Ga0207702_10222130
396 Ga0207648_10018918
397 Ga0207674_10029201
398 Ga0207674_10272984
399 Ga0207675_100106772
400 Ga0207675_100207252
401 Ga0207683_10081592
402 Ga0207698_10069710
403 Ga0207428_10138098
404 Ga0268266_10320073
405 Ga0268266_10330151
406 Ga0268264_10106301
407 Ga0265319_1031149
408 Ga0307515_10001030
409 Ga0307512_10002715
410 Ga0265332_10023842
411 Ga0307508_10140083
412 Ga0316575_10000001
413 Ga0307405_10267661
414 Ga0307410_10080053
415 Ga0307410_10110048
416 Ga0307406_10000260
417 Ga0307407_10093861
418 Ga0307407_10308806
419 Ga0307412_10240589
420 Ga0307409_100065891
421 Ga0307409_100491059
422 Ga0307507_10015555
423 Ga0307510_10082116
424 Ga0373954_0000838
425 Ga0373956_0002081
426 Ga0373955_0003268
427 Ga0373955_0085528
428 Ga0373937_0003286
429 Ga0373937_0040166
430 Ga0395899_0000716
431 Ga0436361_0847953
432 Ga0436363_1608341
433 Ga0451793_0925193
434 Ga0451795_0507694
435 Ga0451843_0021775
436 Ga0451853_0504170
437 Ga0466970_0000036
438 Ga0466960_0017343
439 Ga0495638_0072871
440 Ga0495650_0000546
441 Ga0495650_0048250
442 Ga0495664_0254367
443 Ga0495632_0027616
444 Ga0495634_0111028
445 Ga0496100_0043322
446 Ga0496101_0003440
447 Ga0496104_0005983
448 Ga0496105_0072907
449 Ga0496105_0188914
450 Ga0496108_0316968
451 Ga0496110_0415022
452 Ga0496111_0259433
453 Ga0496112_0087691
454 Ga0496114_0000501
455 Ga0496114_0004316
456 Ga0496114_0006547
457 Ga0496114_0168341
458 Ga0496114_0414359
459 Ga0496115_0016063
460 Ga0496115_0256291
461 Ga0496117_0041851
462 Ga0496117_0091826
463 Ga0496118_0003593
464 Ga0496118_0009260
465 Ga0496118_0064902
466 Ga0496119_0001684
467 Ga0496119_0002946
468 Ga0496119_0007391
469 Ga0496120_0006761
470 Ga0496120_0056330
471 Ga0496122_0000358
472 Ga0496122_0117203
473 Ga0496122_0225162
474 Ga0496123_0000011
475 Ga0496123_0000280
476 Ga0496123_0045975
477 Ga0496124_0000899
478 Ga0496124_0015167
479 Ga0496125_0015535
480 Ga0496125_0018179
481 Ga0496125_0029138
482 Ga0496126_0065599
483 Ga0501033_0056012
484 Ga0501034_0021981
485 Ga0501034_0159112
486 Ga0501037_0062844
487 Ga0501042_0151766
488 Ga0501043_0144604
489 Ga0501067_0017284
490 Ga0501070_0009782
491 Ga0501070_0019118
492 Ga0501073_0000052
493 Ga0501079_0211987
494 Ga0501080_0091880
495 nmdc:mga07m45_43701_c1
496 nmdc:mga0qj67_654_c1
497 nmdc:mga08y16_1688_c1
498 Ga0500556_0000028
499 Ga0500556_0001032
500 Ga0500652_014170
501 Ga0500568_0000009
502 Ga0500600_0039520
503 Ga0500616_0002712
504 Ga0500599_004770
505 2523384506
506 2643753961
507 2643887871
508 2643997800
509 2644680784
510 2772642093
511 2774397716
512 2808900378
513 2809226070
514 2812325014
515 2821271286
516 2831937719
517 2832007022
518 2852632359
519 2866070328
520 2867508404
521 2868095547
522 2880490442
523 2880502076
524 2891400974
525 2904766919
526 2904775069
527 2906802373
528 2919420646
529 2919433596
530 2945969450
531 8003873694
532 8016256750
533 8045831352
534 8054734114
535 8055034794
536 8055039620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

216

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

31

270

0.93

PF08659

KR

KR domain

25

203

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9358 31 155
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9334 32 221
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.926 20 220
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9249 29 221
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9245 32 221
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 35 152 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 31 155 3.40.50.720
af_Q54IQ3_9_285_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 32 155 3.40.50.720
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 32 155 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 29 221 3.40.50.720
ID Description Score Start End GO Terms
AF-S3JGM5-F1-model_v4 Glucose 1-dehydrogenase 2 (EC 1.1.1.47) 0.9512 16 136 GO:0047936
AF-A0A1Q6KX94-F1-model_v4 deleted 0.9434 29 148
AF-A0A1B6D7U7-F1-model_v4 Uncharacterized protein 0.9434 34 155 GO:0016491
AF-U4KRH9-F1-model_v4 Putative acetoin dehydrogenase BudC (EC 1.1.1.303) 0.9429 18 155 GO:0052587
AF-A0A2J8XZ97-F1-model_v4 L-xylulose reductase (EC 1.1.1.10) (Dicarbonyl/L-xylulose reductase) 0.9401 57 148 GO:0004090
GO:0005997
GO:0006006
GO:0016020
GO:0042732
GO:0050038

Map