F375618

General Info

Members Datasets Scaffolds Average Seq Length
268 217 536 554

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10007120|Ga0307516_100071209
Length 552
Sequence MDADVIVVGAGLAGLAATAELADAGRRVLLLDQEPEQSLGGQAFWSFGGLFLVDSPEQRRMGVRDSVDLAWQDWLGSAAFDREEDHWPRQWARAYVDFAAGEKRAWLREMGHRLFPVVGWAERGAGAAEGHGNSVPRFHLTWGTGPGLVEPFERRVRAAAERGLVRFGFRHRVDGLVRTGGVVTGVRGRTLVASGVRRGESSSREESGEFAYAAQAVIVTSGGIGGDPDLVRKAWPARLGAPPKRMISGVPAHVDGRMLAITEAAGGRIINPDRMWHYVEGVRNWDPIWPQHGIRILPGPSSLWLDATGRRLPAPLFPGFDTLGTLKHLMGTGYDYSWFVLTQKIIEKEFALSGSEQNPDLTNKSIRQVLSRIRPGATPPVEAFKQHGADFVVAPGLAELVAGMNKLAAEHEGPELDLDLVRRTIESRDREMTNPFSKDAQITAIHGARRYRGDKLIRVATPHRLLDPAAGPLIAVRLNILTRKTLGGLQTDLSGRVLQPDGEPLPGVYAAGEVAGFGGGGMHGYNSLEGTFLGGCLFSGRTAGRAAAAATA

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2508501039 Frankia saprophytica CN3 Isolate Nodule
164 2582580736 Prauserella sp. Am3 Isolate Unclassified
165 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
166 2643221572 Leifsonia sp. Root60 Isolate Unclassified
167 2643221615 Nocardioides sp. Root224 Isolate Unclassified
168 2643221619 Agromyces sp. Root81 Isolate Unclassified
169 2643221649 Leifsonia sp. Root4 Isolate Unclassified
170 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
171 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
172 2643221679 Angustibacter sp. Root456 Isolate Unclassified
173 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
174 2643221711 Terrabacter sp. Root85 Isolate Unclassified
175 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
176 2687453737 Frankia sp. BMG5.36 Isolate Nodule
177 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
178 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
179 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
180 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
181 2808606372 Agromyces sp. 23-23 Isolate Unclassified
182 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
183 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
184 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
185 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
186 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
187 2857472729 Cohnella sp. R-74144 Isolate Unclassified
188 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
189 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
190 2867369537 Streptomyces sp. Z26 Isolate Unclassified
191 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
192 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
193 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
194 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
195 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
196 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
197 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
198 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
199 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
200 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
201 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
202 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
203 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
204 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
205 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
206 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
207 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
208 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
209 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
210 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
211 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
212 8002775197 Frankia nepalensis CN7 Isolate Nodule
213 8002784119 Frankia sp. AgB1.9 Isolate Nodule
214 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
215 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
216 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
217 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.1
Metatranscriptomes 0.37
Isolates 20.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 3.73
Nodule 2.61
Rhizoplane 7.46
Rhizosphere 66.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10007120 3300031730 Bacteria 12920
2 JGI24740J21852_10018436 3300001979 Bacteria 2475
3 JGI24739J22299_10011204 3300001989 Bacteria 3313
4 JGI25151J46595_10000086 3300003187 Bacteria 126250
5 JGI25406J46586_10002863 3300003203 Bacteria 8131
6 Ga0006562J51391_1092525 3300003578 Bacteria 2380
7 Ga0055538_1000125 3300003751 Bacteria 58790
8 Ga0070658_10038353 3300005327 Bacteria 3863
9 Ga0068869_100066556 3300005334 Bacteria 2655
10 Ga0070666_10075337 3300005335 Bacteria 2301
11 Ga0070682_100093407 3300005337 Bacteria 1972
12 Ga0070660_100041033 3300005339 Bacteria 3525
13 Ga0070691_10016837 3300005341 Bacteria 3361
14 Ga0070691_10020519 3300005341 Bacteria 3053
15 Ga0070687_100022921 3300005343 Bacteria 2960
16 Ga0070673_100083472 3300005364 Bacteria 2595
17 Ga0070659_100012528 3300005366 Bacteria 6286
18 Ga0070659_100020170 3300005366 Bacteria 5061
19 Ga0070659_100095183 3300005366 Bacteria 2392
20 Ga0070714_100019019 3300005435 Bacteria 5589
21 Ga0070714_100038807 3300005435 Bacteria 4006
22 Ga0070705_100007269 3300005440 Bacteria 5448
23 Ga0070700_100057281 3300005441 Bacteria 2445
24 Ga0070663_100097978 3300005455 Bacteria 2183
25 Ga0068867_100002704 3300005459 Bacteria 12500
26 Ga0070707_100127473 3300005468 Bacteria 2473
27 Ga0070698_100068237 3300005471 Bacteria 3574
28 Ga0070699_100003229 3300005518 Bacteria 14421
29 Ga0070697_100000321 3300005536 Bacteria 38067
30 Ga0068853_100056549 3300005539 Bacteria 3384
31 Ga0070686_100000148 3300005544 Bacteria 48006
32 Ga0068857_100116513 3300005577 Bacteria 2404
33 Ga0068857_100131605 3300005577 Bacteria 2256
34 Ga0068854_100036446 3300005578 Bacteria 3448
35 Ga0070702_100032177 3300005615 Bacteria 2877
36 Ga0068852_100007962 3300005616 Bacteria 7770
37 Ga0068859_100000027 3300005617 Bacteria 182371
38 Ga0068859_100104053 3300005617 Bacteria 2897
39 Ga0068861_100092106 3300005719 Bacteria 2394
40 Ga0068863_100000230 3300005841 Bacteria 59246
41 Ga0068863_100167626 3300005841 Bacteria 2106
42 Ga0068862_100000186 3300005844 Bacteria 68544
43 Ga0081540_1000469 3300005983 Bacteria 39957
44 Ga0081540_1032307 3300005983 Bacteria 2860
45 Ga0081539_10000182 3300005985 Bacteria 148133
46 Ga0081539_10040869 3300005985 Bacteria 2718
47 Ga0075365_10033488 3300006038 Bacteria 3311
48 Ga0075367_10023048 3300006178 Bacteria 3500
49 Ga0097620_100000027 3300006931 Bacteria 182371
50 Ga0097620_100104057 3300006931 Bacteria 2897
51 Ga0075435_100120330 3300007076 Bacteria 2190
52 Ga0105245_10005722 3300009098 Bacteria 10916
53 Ga0105245_10022964 3300009098 Bacteria 5473
54 Ga0105243_10015239 3300009148 Bacteria 5817
55 Ga0105243_10040428 3300009148 Bacteria 3642
56 Ga0105242_10108692 3300009176 Bacteria 2360
57 Ga0105248_10000039 3300009177 Bacteria 179700
58 Ga0105248_10151356 3300009177 Bacteria 2618
59 Ga0105238_10042800 3300009551 Bacteria 4584
60 Ga0105249_10005627 3300009553 Bacteria 10838
61 Ga0105249_10047435 3300009553 Bacteria 3914
62 Ga0105246_10061385 3300011119 Bacteria 2615
63 Ga0105246_10082726 3300011119 Bacteria 2292
64 Ga0157373_10031624 3300013100 Bacteria 3809
65 Ga0157371_10029721 3300013102 Bacteria 3948
66 Ga0157369_10004441 3300013105 Bacteria 16538
67 Ga0157372_10021228 3300013307 Bacteria 7015
68 Ga0157372_10028592 3300013307 Bacteria 6086
69 Ga0157375_10031684 3300013308 Bacteria 5004
70 Ga0157375_10105157 3300013308 Bacteria 2912
71 Ga0157380_10010224 3300014326 Bacteria 6743
72 Ga0157377_10004518 3300014745 Bacteria 6421
73 Ga0157377_10013718 3300014745 Bacteria 4108
74 Ga0213875_10000322 3300021388 Bacteria 45399
75 Ga0213875_10014796 3300021388 Bacteria 3802
76 Ga0209784_100125 3300025224 Bacteria 79828
77 Ga0209025_1000016 3300025294 Bacteria 770739
78 Ga0207653_10009674 3300025885 Bacteria 3005
79 Ga0207642_10011173 3300025899 Bacteria 3192
80 Ga0207688_10009827 3300025901 Bacteria 5206
81 Ga0207699_10052300 3300025906 Bacteria 2417
82 Ga0207643_10037018 3300025908 Bacteria 2737
83 Ga0207662_10005285 3300025918 Bacteria 6861
84 Ga0207657_10005249 3300025919 Bacteria 13570
85 Ga0207657_10007151 3300025919 Bacteria 11464
86 Ga0207646_10000876 3300025922 Bacteria 38907
87 Ga0207659_10046915 3300025926 Bacteria 3054
88 Ga0207687_10003294 3300025927 Bacteria 10926
89 Ga0207687_10124823 3300025927 Bacteria 1931
90 Ga0207700_10021447 3300025928 Bacteria 4410
91 Ga0207709_10030443 3300025935 Bacteria 3140
92 Ga0207709_10035194 3300025935 Bacteria 2959
93 Ga0207691_10019358 3300025940 Bacteria 6441
94 Ga0207711_10000535 3300025941 Bacteria 38875
95 Ga0207689_10005663 3300025942 Bacteria 11116
96 Ga0207658_10025416 3300025986 Bacteria 4148
97 Ga0207678_10011445 3300026067 Bacteria 7789
98 Ga0207708_10002810 3300026075 Bacteria 12789
99 Ga0207641_10001554 3300026088 Bacteria 22488
100 Ga0207641_10091958 3300026088 Bacteria 2656
101 Ga0207648_10009301 3300026089 Bacteria 9422
102 Ga0207674_10111228 3300026116 Bacteria 2713
103 Ga0207675_100036381 3300026118 Bacteria 4592
104 Ga0207675_100047516 3300026118 Bacteria 4007
105 Ga0207675_100048618 3300026118 Bacteria 3959
106 Ga0207683_10000659 3300026121 Bacteria 31666
107 Ga0207683_10032001 3300026121 Bacteria 4568
108 Ga0209966_1000845 3300027695 Bacteria 5960
109 Ga0268265_10000206 3300028380 Bacteria 68565
110 Ga0307515_10000227 3300028794 Bacteria 139393
111 Ga0307515_10021485 3300028794 Bacteria 11443
112 Ga0265327_10000131 3300031251 Bacteria 164189
113 Ga0265327_10006992 3300031251 Bacteria 8849
114 Ga0307508_10109187 3300031616 Bacteria 2366
115 Ga0373926_0002913 3300035083 Bacteria 5487
116 Ga0373951_0000040 3300035091 Bacteria 51161
117 Ga0373936_0003641 3300035113 Bacteria 5787
118 Ga0373945_0001662 3300035116 Bacteria 6829
119 Ga0373943_0004809 3300035170 Bacteria 6100
120 Ga0373935_0084756 3300035692 Bacteria 2064
121 Ga0373947_0002258 3300035725 Bacteria 11640
122 Ga0395900_0203558 3300037418 Bacteria 2002
123 Ga0436364_0082500 3300037853 Bacteria 4516
124 Ga0436364_0251586 3300037853 Bacteria 45460
125 Ga0436364_0597923 3300037853 Bacteria 11346
126 Ga0436365_1353184 3300039437 Bacteria 2120
127 Ga0466969_0019384 3300044656 Bacteria 3537
128 Ga0466965_0031978 3300044683 Bacteria 2569
129 Ga0466965_0037376 3300044683 Bacteria 2384
130 Ga0466961_0013701 3300044693 Bacteria 5196
131 Ga0466970_0008925 3300044765 Bacteria 5055
132 Ga0466970_0036060 3300044765 Bacteria 2619
133 Ga0466958_0059454 3300045836 Bacteria 2325
134 Ga0495592_0011915 3300046454 Bacteria 6592
135 Ga0495638_0085448 3300046460 Bacteria 1908
136 Ga0495639_0006066 3300046475 Bacteria 5191
137 Ga0495594_0043366 3300046499 Bacteria 2466
138 Ga0495618_0009183 3300046514 Bacteria 5970
139 Ga0495628_0143477 3300046516 Bacteria 1821
140 Ga0495648_0057615 3300046524 Bacteria 2328
141 Ga0495666_0003103 3300046526 Bacteria 8350
142 Ga0495665_0000505 3300046531 Bacteria 19643
143 Ga0495640_0047247 3300046533 Bacteria 2979
144 Ga0495586_0010884 3300046535 Bacteria 4832
145 Ga0495668_0000390 3300046616 Bacteria 57867
146 Ga0495634_0031770 3300046642 Bacteria 3634
147 Ga0495625_0000161 3300046660 Bacteria 103972
148 Ga0495635_0014291 3300046663 Bacteria 5554
149 Ga0495599_0006967 3300046678 Bacteria 6837
150 Ga0495658_0003354 3300046683 Bacteria 7936
151 Ga0495600_0021523 3300046809 Bacteria 4130
152 Ga0495581_0003667 3300047315 Bacteria 8842
153 Ga0495604_0016128 3300047317 Bacteria 5968
154 Ga0495676_0011879 3300047321 Bacteria 7855
155 Ga0495675_0003254 3300047444 Bacteria 9753
156 Ga0495593_0002685 3300047673 Bacteria 10698
157 Ga0495626_0000051 3300048091 Bacteria 156449
158 Ga0496101_0104450 3300048904 Bacteria 2125
159 Ga0496102_0020103 3300048905 Bacteria 5893
160 Ga0496102_0058009 3300048905 Bacteria 3537
161 Ga0496103_0027266 3300048906 Bacteria 3460
162 Ga0496104_0029688 3300048907 Bacteria 5073
163 Ga0496104_0072334 3300048907 Bacteria 3279
164 Ga0496105_0021331 3300048908 Bacteria 5241
165 Ga0496106_0066492 3300048909 Bacteria 2746
166 Ga0496107_0023675 3300048910 Bacteria 4340
167 Ga0496109_0006594 3300048912 Bacteria 9774
168 Ga0496109_0041954 3300048912 Bacteria 4144
169 Ga0496110_0110966 3300048913 Bacteria 2465
170 Ga0496110_0112930 3300048913 Bacteria 2443
171 Ga0496110_0131446 3300048913 Bacteria 2261
172 Ga0496111_0011226 3300048914 Bacteria 6029
173 Ga0496113_0068117 3300048916 Bacteria 2700
174 Ga0496114_0059999 3300048917 Bacteria 3178
175 Ga0496114_0067258 3300048917 Bacteria 3005
176 Ga0496114_0117436 3300048917 Bacteria 2285
177 Ga0496115_0081846 3300048918 Bacteria 2629
178 Ga0496116_0002012 3300048919 Bacteria 21849
179 Ga0496116_0016527 3300048919 Bacteria 5768
180 Ga0496117_0087579 3300048920 Bacteria 2018
181 Ga0496118_0003141 3300048921 Bacteria 21138
182 Ga0496118_0023991 3300048921 Bacteria 5279
183 Ga0496119_0005831 3300048922 Bacteria 11642
184 Ga0496121_0018254 3300048924 Bacteria 7088
185 Ga0496122_0051127 3300048925 Bacteria 3144
186 Ga0496122_0052697 3300048925 Bacteria 3076
187 Ga0496123_0042615 3300048926 Bacteria 3130
188 Ga0496123_0061451 3300048926 Bacteria 2413
189 Ga0496124_0103518 3300048927 Bacteria 2303
190 Ga0501033_0057878 3300049570 Bacteria 2864
191 Ga0501034_0147026 3300049571 Bacteria 2334
192 Ga0501038_0007799 3300049574 Bacteria 9865
193 Ga0501038_0120955 3300049574 Bacteria 2159
194 Ga0501039_0040369 3300049575 Bacteria 3602
195 Ga0501043_0024104 3300049579 Bacteria 4774
196 Ga0501043_0092624 3300049579 Bacteria 2376
197 Ga0501047_0000670 3300049581 Bacteria 35678
198 Ga0501047_0024330 3300049581 Bacteria 5813
199 Ga0501047_0089059 3300049581 Bacteria 2963
200 Ga0501068_0045410 3300049584 Bacteria 2647
201 Ga0501070_0006395 3300049586 Bacteria 10020
202 Ga0501070_0092461 3300049586 Bacteria 2503
203 Ga0501080_0137424 3300049742 Bacteria 2261
204 Ga0501035_0001571 3300049822 Bacteria 23240
205 Ga0501035_0033262 3300049822 Bacteria 4689
206 Ga0501035_0102981 3300049822 Bacteria 2504
207 Ga0501035_0145621 3300049822 Bacteria 2057
208 Ga0501044_0000456 3300049823 Bacteria 49762
209 nmdc:mga0sz30_1098_c1 3300050516 Bacteria 9721
210 Ga0500556_0000467 3300053104 Bacteria 28516
211 Ga0500573_0008401 3300053140 Bacteria 5685
212 Ga0500616_0000078 3300053153 Bacteria 202009
213 Ga0466962_0009525 3300061719 Bacteria 4658
214 2508673654 2508501039 Bacteria 9978592
215 2583152680 2582580736 Bacteria 5325865
216 2587863366 2585428094 Bacteria 3604039
217 2643875484 2643221572 Bacteria 3614809
218 2644093488 2643221615 Bacteria 5487866
219 2644111304 2643221619 Bacteria 4158469
220 2644280636 2643221649 Bacteria 3867359
221 2644323098 2643221657 Bacteria 5490246
222 2644382539 2643221669 Bacteria 3611286
223 2644446767 2643221679 Bacteria 3839507
224 2644456257 2643221681 Bacteria 3707866
225 2644611690 2643221711 Bacteria 4865335
226 2676201462 2675902999 Bacteria 9438463
227 2689957405 2687453737 Bacteria 11203906
228 2723641897 2721755702 Bacteria 4373124
229 2739363892 2738543034 Bacteria 6084756
230 2774846038 2773857921 Bacteria 9435764
231 2791215246 2788500588 Bacteria 4584915
232 2808901845 2808606372 Bacteria 4649509
233 2812372843 2811994882 Bacteria 4688362
234 2819628179 2818991451 Bacteria 4697364
235 2819689638 2818991462 Bacteria 4320267
236 2819726808 2818991469 Bacteria 4644110
237 2857454696 2857453340 Bacteria 8090534
238 2857477172 2857472729 Bacteria 6568124
239 2857730084 2857729791 Bacteria 4040535
240 2861525517 2861520306 Bacteria 8348283
241 2867370197 2867369537 Bacteria 6501581
242 2870624000 2870622029 Bacteria 3643329
243 2887485390 2887478801 Bacteria 8972725
244 2895661574 2895660088 Bacteria 3782833
245 2904610458 2904606771 Bacteria 4684500
246 2904766295 2904765812 Bacteria 5369154
247 2904772360 2904770941 Bacteria 5580202
248 2908816542 2908811453 Bacteria 5478616
249 2919421278 2919420072 Bacteria 5390363
250 2919432964 2919432681 Bacteria 5390474
251 2919446424 2919443155 Bacteria 4072969
252 2929217908 2929212328 Bacteria 7708288
253 2935411236 2935409751 Bacteria 4179611
254 2939597426 2939593269 Bacteria 4798695
255 2939658481 2939657138 Bacteria 3740283
256 2971413147 2971410472 Bacteria 8311090
257 2977258072 2977254563 Bacteria 4828420
258 2984578635 2984576629 Bacteria 4248407
259 2990259441 2990256926 Bacteria 4252839
260 2990279098 2990275345 Bacteria 4887158
261 3006828953 3006826541 Bacteria 4678913
262 8001783900 8001781756 Bacteria 9586736
263 8002782030 8002775197 Bacteria 10728764
264 8002787114 8002784119 Bacteria 9788632
265 8055419079 8055412473 Bacteria 6257500
266 8055536377 8055531788 Bacteria 5249694
267 8057347905 8057345674 Bacteria 4160394
268 8057569998 8057568493 Bacteria 7221719
269 Ga0307516_10007120
270 JGI24740J21852_10018436
271 JGI24739J22299_10011204
272 JGI25151J46595_10000086
273 JGI25406J46586_10002863
274 Ga0006562J51391_1092525
275 Ga0055538_1000125
276 Ga0070658_10038353
277 Ga0068869_100066556
278 Ga0070666_10075337
279 Ga0070682_100093407
280 Ga0070660_100041033
281 Ga0070691_10016837
282 Ga0070691_10020519
283 Ga0070687_100022921
284 Ga0070673_100083472
285 Ga0070659_100012528
286 Ga0070659_100020170
287 Ga0070659_100095183
288 Ga0070714_100019019
289 Ga0070714_100038807
290 Ga0070705_100007269
291 Ga0070700_100057281
292 Ga0070663_100097978
293 Ga0068867_100002704
294 Ga0070707_100127473
295 Ga0070698_100068237
296 Ga0070699_100003229
297 Ga0070697_100000321
298 Ga0068853_100056549
299 Ga0070686_100000148
300 Ga0068857_100116513
301 Ga0068857_100131605
302 Ga0068854_100036446
303 Ga0070702_100032177
304 Ga0068852_100007962
305 Ga0068859_100000027
306 Ga0068859_100104053
307 Ga0068861_100092106
308 Ga0068863_100000230
309 Ga0068863_100167626
310 Ga0068862_100000186
311 Ga0081540_1000469
312 Ga0081540_1032307
313 Ga0081539_10000182
314 Ga0081539_10040869
315 Ga0075365_10033488
316 Ga0075367_10023048
317 Ga0097620_100000027
318 Ga0097620_100104057
319 Ga0075435_100120330
320 Ga0105245_10005722
321 Ga0105245_10022964
322 Ga0105243_10015239
323 Ga0105243_10040428
324 Ga0105242_10108692
325 Ga0105248_10000039
326 Ga0105248_10151356
327 Ga0105238_10042800
328 Ga0105249_10005627
329 Ga0105249_10047435
330 Ga0105246_10061385
331 Ga0105246_10082726
332 Ga0157373_10031624
333 Ga0157371_10029721
334 Ga0157369_10004441
335 Ga0157372_10021228
336 Ga0157372_10028592
337 Ga0157375_10031684
338 Ga0157375_10105157
339 Ga0157380_10010224
340 Ga0157377_10004518
341 Ga0157377_10013718
342 Ga0213875_10000322
343 Ga0213875_10014796
344 Ga0209784_100125
345 Ga0209025_1000016
346 Ga0207653_10009674
347 Ga0207642_10011173
348 Ga0207688_10009827
349 Ga0207699_10052300
350 Ga0207643_10037018
351 Ga0207662_10005285
352 Ga0207657_10005249
353 Ga0207657_10007151
354 Ga0207646_10000876
355 Ga0207659_10046915
356 Ga0207687_10003294
357 Ga0207687_10124823
358 Ga0207700_10021447
359 Ga0207709_10030443
360 Ga0207709_10035194
361 Ga0207691_10019358
362 Ga0207711_10000535
363 Ga0207689_10005663
364 Ga0207658_10025416
365 Ga0207678_10011445
366 Ga0207708_10002810
367 Ga0207641_10001554
368 Ga0207641_10091958
369 Ga0207648_10009301
370 Ga0207674_10111228
371 Ga0207675_100036381
372 Ga0207675_100047516
373 Ga0207675_100048618
374 Ga0207683_10000659
375 Ga0207683_10032001
376 Ga0209966_1000845
377 Ga0268265_10000206
378 Ga0307515_10000227
379 Ga0307515_10021485
380 Ga0265327_10000131
381 Ga0265327_10006992
382 Ga0307508_10109187
383 Ga0373926_0002913
384 Ga0373951_0000040
385 Ga0373936_0003641
386 Ga0373945_0001662
387 Ga0373943_0004809
388 Ga0373935_0084756
389 Ga0373947_0002258
390 Ga0395900_0203558
391 Ga0436364_0082500
392 Ga0436364_0251586
393 Ga0436364_0597923
394 Ga0436365_1353184
395 Ga0466969_0019384
396 Ga0466965_0031978
397 Ga0466965_0037376
398 Ga0466961_0013701
399 Ga0466970_0008925
400 Ga0466970_0036060
401 Ga0466958_0059454
402 Ga0495592_0011915
403 Ga0495638_0085448
404 Ga0495639_0006066
405 Ga0495594_0043366
406 Ga0495618_0009183
407 Ga0495628_0143477
408 Ga0495648_0057615
409 Ga0495666_0003103
410 Ga0495665_0000505
411 Ga0495640_0047247
412 Ga0495586_0010884
413 Ga0495668_0000390
414 Ga0495634_0031770
415 Ga0495625_0000161
416 Ga0495635_0014291
417 Ga0495599_0006967
418 Ga0495658_0003354
419 Ga0495600_0021523
420 Ga0495581_0003667
421 Ga0495604_0016128
422 Ga0495676_0011879
423 Ga0495675_0003254
424 Ga0495593_0002685
425 Ga0495626_0000051
426 Ga0496101_0104450
427 Ga0496102_0020103
428 Ga0496102_0058009
429 Ga0496103_0027266
430 Ga0496104_0029688
431 Ga0496104_0072334
432 Ga0496105_0021331
433 Ga0496106_0066492
434 Ga0496107_0023675
435 Ga0496109_0006594
436 Ga0496109_0041954
437 Ga0496110_0110966
438 Ga0496110_0112930
439 Ga0496110_0131446
440 Ga0496111_0011226
441 Ga0496113_0068117
442 Ga0496114_0059999
443 Ga0496114_0067258
444 Ga0496114_0117436
445 Ga0496115_0081846
446 Ga0496116_0002012
447 Ga0496116_0016527
448 Ga0496117_0087579
449 Ga0496118_0003141
450 Ga0496118_0023991
451 Ga0496119_0005831
452 Ga0496121_0018254
453 Ga0496122_0051127
454 Ga0496122_0052697
455 Ga0496123_0042615
456 Ga0496123_0061451
457 Ga0496124_0103518
458 Ga0501033_0057878
459 Ga0501034_0147026
460 Ga0501038_0007799
461 Ga0501038_0120955
462 Ga0501039_0040369
463 Ga0501043_0024104
464 Ga0501043_0092624
465 Ga0501047_0000670
466 Ga0501047_0024330
467 Ga0501047_0089059
468 Ga0501068_0045410
469 Ga0501070_0006395
470 Ga0501070_0092461
471 Ga0501080_0137424
472 Ga0501035_0001571
473 Ga0501035_0033262
474 Ga0501035_0102981
475 Ga0501035_0145621
476 Ga0501044_0000456
477 nmdc:mga0sz30_1098_c1
478 Ga0500556_0000467
479 Ga0500573_0008401
480 Ga0500616_0000078
481 Ga0466962_0009525
482 2508673654
483 2583152680
484 2587863366
485 2643875484
486 2644093488
487 2644111304
488 2644280636
489 2644323098
490 2644382539
491 2644446767
492 2644456257
493 2644611690
494 2676201462
495 2689957405
496 2723641897
497 2739363892
498 2774846038
499 2791215246
500 2808901845
501 2812372843
502 2819628179
503 2819689638
504 2819726808
505 2857454696
506 2857477172
507 2857730084
508 2861525517
509 2867370197
510 2870624000
511 2887485390
512 2895661574
513 2904610458
514 2904766295
515 2904772360
516 2908816542
517 2919421278
518 2919432964
519 2919446424
520 2929217908
521 2935411236
522 2939597426
523 2939658481
524 2971413147
525 2977258072
526 2984578635
527 2990259441
528 2990279098
529 3006828953
530 8001783900
531 8002782030
532 8002787114
533 8055419079
534 8055536377
535 8057347905
536 8057569998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

4

533

0.94

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

7

53

0.92

PF01494

FAD_binding_3

FAD binding domain

2

45

0.9

PF01134

GIDA

Glucose inhibited division protein A

4

50

0.87

PF12831

FAD_oxidored

FAD dependent oxidoreductase

4

109

0.78

PF01266

DAO

FAD dependent oxidoreductase

4

296

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9775 7 38
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9762 7 37
6dv2-assembly1.cif.gz_H crystal structure of human mitochondrial trifunctional protein 0.9696 7 35
6dv2-assembly3.cif.gz_L crystal structure of human mitochondrial trifunctional protein 0.9693 7 35
4oqy-assembly1.cif.gz_A streptomyces sp. gf3546 imine reductase 0.9619 7 36
ID Description Score Start End Superfamily
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.995 7 36 3.40.50.720
af_Q60E84_301_451_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9919 7 37 3.40.50.720
af_Q2G1C9_1_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9846 7 35 3.40.50.720
1sezB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.979 7 37 3.50.50.60
af_P71838_21_286_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9772 6 273 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2M9P2D1-F1-model_v4 FAD-binding dehydrogenase 0.9869 134 468 GO:0016627
AF-A0A4R6KUV7-F1-model_v4 FAD-dependent oxidoreductase 2 FAD binding domain-containing protein 0.9845 4 554 GO:0016627
AF-A0A2M9P2D1-F1-model_v4 FAD-binding dehydrogenase 0.984 134 468 GO:0016627
AF-A0A4R5Z9D1-F1-model_v4 deleted 0.983 4 552
AF-A0A4R6KUV7-F1-model_v4 FAD-dependent oxidoreductase 2 FAD binding domain-containing protein 0.9827 4 554 GO:0016627

Map