F375521

General Info

Members Datasets Scaffolds Average Seq Length
268 161 268 99

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10349905|Ga0163163_103499053
Length 107
Sequence MAEWELAQNDVSEELAQLHFFSIKKKQPGGDIEFQIVVRQYATPLDRAQNPLMRFFAQANRQTNQSIAPYTPCGWGPTVGAAVSECVKEIRRFPYEGPMPDDDAATS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
139 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
140 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
147 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
148 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
149 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
150 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
151 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 8.58
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3861750 2162886012 Unclassified 1247
2 Ga0065714_10408460 3300005288 Unclassified 584
3 Ga0065704_10099711 3300005289 Unclassified 2300
4 Ga0065704_10327378 3300005289 Bacteria 843
5 Ga0065712_10077385 3300005290 Unclassified 3504
6 Ga0065712_10102243 3300005290 Bacteria 2010
7 Ga0065712_10142785 3300005290 Bacteria 1434
8 Ga0065715_10107142 3300005293 Bacteria 2788
9 Ga0065715_10134102 3300005293 Bacteria 1923
10 Ga0065715_10165522 3300005293 Bacteria 1590
11 Ga0065715_10560131 3300005293 Bacteria 734
12 Ga0065715_10808105 3300005293 Unclassified 607
13 Ga0065715_11015276 3300005293 Unclassified 541
14 Ga0070676_10259378 3300005328 Unclassified 1163
15 Ga0070676_10980788 3300005328 Unclassified 633
16 Ga0070666_10624506 3300005335 Bacteria 787
17 Ga0070666_11487804 3300005335 Unclassified 506
18 Ga0070682_100211653 3300005337 Bacteria 1374
19 Ga0070660_100902445 3300005339 Unclassified 745
20 Ga0070661_100530582 3300005344 Bacteria 945
21 Ga0070692_10784526 3300005345 Unclassified 649
22 Ga0070669_100894881 3300005353 Unclassified 758
23 Ga0070669_101012540 3300005353 Unclassified 713
24 Ga0070675_100237612 3300005354 Bacteria 1591
25 Ga0070671_100107284 3300005355 Bacteria 2345
26 Ga0070674_100009709 3300005356 Bacteria 5777
27 Ga0070674_100886235 3300005356 Unclassified 776
28 Ga0070673_100313901 3300005364 Unclassified 1383
29 Ga0070688_101710637 3300005365 Unclassified 515
30 Ga0070659_100136968 3300005366 Bacteria 1991
31 Ga0070667_100174786 3300005367 Bacteria 1897
32 Ga0070705_100907160 3300005440 Unclassified 709
33 Ga0070694_100073217 3300005444 Unclassified 2366
34 Ga0070708_100570303 3300005445 Bacteria 1067
35 Ga0070678_100848637 3300005456 Unclassified 832
36 Ga0070662_100392476 3300005457 Bacteria 1144
37 Ga0070662_100407748 3300005457 Bacteria 1123
38 Ga0068867_102217904 3300005459 Unclassified 521
39 Ga0070706_101919585 3300005467 Unclassified 537
40 Ga0070707_100000059 3300005468 Bacteria 98057
41 Ga0070707_100007879 3300005468 Bacteria 9889
42 Ga0070707_101476339 3300005468 Bacteria 647
43 Ga0070699_100029535 3300005518 Bacteria 4726
44 Ga0070699_100541467 3300005518 Bacteria 1059
45 Ga0070699_100654477 3300005518 Unclassified 959
46 Ga0070679_101574090 3300005530 Bacteria 605
47 Ga0070684_100001371 3300005535 Bacteria 17501
48 Ga0070697_101210223 3300005536 Unclassified 673
49 Ga0070672_101073083 3300005543 Unclassified 715
50 Ga0070686_100179185 3300005544 Unclassified 1504
51 Ga0070695_101645899 3300005545 Unclassified 536
52 Ga0070696_100979361 3300005546 Unclassified 705
53 Ga0070696_101385295 3300005546 Unclassified 599
54 Ga0070696_101821308 3300005546 Unclassified 526
55 Ga0070693_100025947 3300005547 Unclassified 3157
56 Ga0070704_100101322 3300005549 Bacteria 2170
57 Ga0070704_100487234 3300005549 Bacteria 1068
58 Ga0070664_100000963 3300005564 Bacteria 22509
59 Ga0068857_101082882 3300005577 Unclassified 773
60 Ga0068854_100816076 3300005578 Unclassified 814
61 Ga0070702_100216469 3300005615 Unclassified 1278
62 Ga0068864_101282872 3300005618 Unclassified 732
63 Ga0068866_10708024 3300005718 Unclassified 691
64 Ga0068870_10746178 3300005840 Unclassified 679
65 Ga0068863_100917975 3300005841 Unclassified 876
66 Ga0068858_101628283 3300005842 Unclassified 637
67 Ga0068862_100294611 3300005844 Bacteria 1491
68 Ga0068862_100365011 3300005844 Bacteria 1343
69 Ga0070717_10025353 3300006028 Bacteria 4715
70 Ga0070717_11914345 3300006028 Unclassified 535
71 Ga0075427_10046716 3300006194 Bacteria 739
72 Ga0075366_10701058 3300006195 Unclassified 629
73 Ga0075428_100000864 3300006844 Bacteria 31871
74 Ga0075428_100001462 3300006844 Bacteria 25269
75 Ga0075428_100003486 3300006844 Bacteria 17221
76 Ga0075428_100025362 3300006844 Bacteria 6561
77 Ga0075428_100249388 3300006844 Bacteria 1914
78 Ga0075428_102649888 3300006844 Bacteria 512
79 Ga0075430_100015109 3300006846 Bacteria 6572
80 Ga0075430_101331500 3300006846 Bacteria 590
81 Ga0075431_100011907 3300006847 Bacteria 8776
82 Ga0075431_100035298 3300006847 Bacteria 5147
83 Ga0075431_100086286 3300006847 Bacteria 3239
84 Ga0075431_100124104 3300006847 Bacteria 2664
85 Ga0075431_100896635 3300006847 Bacteria 857
86 Ga0075431_101854400 3300006847 Bacteria 559
87 Ga0075433_10203325 3300006852 Unclassified 1761
88 Ga0075433_10412712 3300006852 Bacteria 1191
89 Ga0075433_10757132 3300006852 Unclassified 849
90 Ga0075433_10944916 3300006852 Unclassified 752
91 Ga0075433_11176342 3300006852 Bacteria 666
92 Ga0075433_11593986 3300006852 Bacteria 563
93 Ga0075434_100397516 3300006871 Bacteria 1399
94 Ga0075434_100397782 3300006871 Bacteria 1399
95 Ga0075434_100401509 3300006871 Bacteria 1392
96 Ga0075434_100848670 3300006871 Unclassified 929
97 Ga0075434_101103260 3300006871 Unclassified 807
98 Ga0075429_100007862 3300006880 Bacteria 9261
99 Ga0075429_100108412 3300006880 Bacteria 2427
100 Ga0075429_100431046 3300006880 Unclassified 1155
101 Ga0068865_102101253 3300006881 Unclassified 513
102 Ga0075436_100698400 3300006914 Unclassified 751
103 Ga0075436_101270243 3300006914 Bacteria 557
104 Ga0075435_100013703 3300007076 Bacteria 6041
105 Ga0075435_100602353 3300007076 Unclassified 953
106 Ga0075435_101136498 3300007076 Unclassified 683
107 Ga0105240_10001098 3300009093 Bacteria 47733
108 Ga0111539_10008615 3300009094 Bacteria 12956
109 Ga0111539_10088982 3300009094 Bacteria 3628
110 Ga0111539_10642853 3300009094 Bacteria 1235
111 Ga0111539_13414815 3300009094 Unclassified 511
112 Ga0105245_10398485 3300009098 Unclassified 1375
113 Ga0114129_10002782 3300009147 Bacteria 24386
114 Ga0114129_10038109 3300009147 Bacteria 6783
115 Ga0114129_10099005 3300009147 Bacteria 4036
116 Ga0114129_10466754 3300009147 Unclassified 1654
117 Ga0114129_11224592 3300009147 Bacteria 934
118 Ga0105237_10116653 3300009545 Bacteria 2663
119 Ga0105239_11363834 3300010375 Bacteria 818
120 Ga0105239_13117407 3300010375 Unclassified 540
121 Ga0105246_10512822 3300011119 Bacteria 1020
122 Ga0157374_11185120 3300013296 Bacteria 785
123 Ga0157378_10608427 3300013297 Bacteria 1105
124 Ga0157378_12518861 3300013297 Unclassified 567
125 Ga0163162_12609489 3300013306 Unclassified 581
126 Ga0157375_11252580 3300013308 Bacteria 871
127 Ga0163163_10285996 3300014325 Unclassified 1701
128 Ga0163163_10349905 3300014325 Unclassified 1534
129 Ga0157380_10411867 3300014326 Bacteria 1286
130 Ga0157380_10818130 3300014326 Unclassified 950
131 Ga0157380_10833533 3300014326 Unclassified 942
132 Ga0157380_11863239 3300014326 Bacteria 661
133 Ga0157380_12899378 3300014326 Unclassified 546
134 Ga0157379_12087747 3300014968 Unclassified 561
135 Ga0157376_11121012 3300014969 Unclassified 813
136 Ga0207697_10000278 3300025315 Bacteria 28321
137 Ga0207697_10325491 3300025315 Unclassified 682
138 Ga0207642_10565762 3300025899 Unclassified 704
139 Ga0207688_10001904 3300025901 Bacteria 11179
140 Ga0207645_10348298 3300025907 Unclassified 991
141 Ga0207645_10849634 3300025907 Unclassified 620
142 Ga0207643_10823000 3300025908 Unclassified 602
143 Ga0207654_11199729 3300025911 Unclassified 553
144 Ga0207707_10441015 3300025912 Bacteria 1115
145 Ga0207695_10009070 3300025913 Bacteria 12358
146 Ga0207671_10104402 3300025914 Bacteria 2150
147 Ga0207663_11163576 3300025916 Bacteria 621
148 Ga0207660_10384845 3300025917 Bacteria 1128
149 Ga0207657_11054294 3300025919 Unclassified 622
150 Ga0207657_11497741 3300025919 Unclassified 504
151 Ga0207646_10000387 3300025922 Bacteria 59178
152 Ga0207646_10005622 3300025922 Bacteria 13165
153 Ga0207646_10316242 3300025922 Bacteria 1411
154 Ga0207659_10536087 3300025926 Bacteria 994
155 Ga0207687_11060698 3300025927 Bacteria 695
156 Ga0207644_10016020 3300025931 Bacteria 5040
157 Ga0207706_10373655 3300025933 Bacteria 1238
158 Ga0207669_10384770 3300025937 Bacteria 1094
159 Ga0207669_10967703 3300025937 Unclassified 714
160 Ga0207669_11801547 3300025937 Unclassified 523
161 Ga0207689_11559242 3300025942 Unclassified 550
162 Ga0207651_10293681 3300025960 Bacteria 1349
163 Ga0207678_10121877 3300026067 Bacteria 2225
164 Ga0207641_10856715 3300026088 Bacteria 901
165 Ga0207648_12024524 3300026089 Unclassified 537
166 Ga0207674_11364917 3300026116 Unclassified 678
167 Ga0207683_10937199 3300026121 Bacteria 804
168 Ga0207428_10011666 3300027907 Bacteria 7751
169 Ga0207428_11174969 3300027907 Unclassified 534
170 Ga0268265_10224306 3300028380 Unclassified 1647
171 Ga0268265_11400821 3300028380 Unclassified 701
172 Ga0265323_10000122 3300028653 Bacteria 44507
173 Ga0265330_10105198 3300031235 Unclassified 1207
174 Ga0307408_100003532 3300031548 Bacteria 10641
175 Ga0307408_100523853 3300031548 Unclassified 1041
176 Ga0307405_10168427 3300031731 Bacteria 1560
177 Ga0307413_11718777 3300031824 Unclassified 560
178 Ga0307406_10096621 3300031901 Bacteria 2002
179 Ga0307406_10158227 3300031901 Bacteria 1625
180 Ga0307409_100910274 3300031995 Unclassified 894
181 Ga0307416_100048610 3300032002 Bacteria 3367
182 Ga0307416_100778145 3300032002 Unclassified 1051
183 Ga0307411_10083827 3300032005 Bacteria 2203
184 Ga0307411_10481539 3300032005 Bacteria 1045
185 Ga0307411_10803461 3300032005 Bacteria 828
186 Ga0307415_100126613 3300032126 Unclassified 1926
187 Ga0373944_0106431 3300035089 Unclassified 953
188 Ga0373954_0422196 3300035118 Unclassified 660
189 Ga0373962_0368114 3300035242 Bacteria 523
190 Ga0373947_0359129 3300035725 Unclassified 978
191 Ga0373937_0540773 3300036401 Bacteria 1107
192 Ga0451802_0456017 3300041460 Unclassified 699
193 Ga0451804_0300849 3300041463 Unclassified 580
194 Ga0451853_2690176 3300041512 Unclassified 1048
195 Ga0439450_007645 3300042008 Bacteria 1989
196 Ga0451577_1013978 3300042876 Unclassified 745
197 Ga0453684_1238496 3300044712 Unclassified 781
198 Ga0495580_0525433 3300046472 Bacteria 788
199 Ga0496100_0658438 3300048903 Bacteria 816
200 Ga0496101_0281049 3300048904 Bacteria 1301
201 Ga0496102_0141848 3300048905 Bacteria 2253
202 Ga0496103_0090470 3300048906 Bacteria 1931
203 Ga0496104_0044172 3300048907 Bacteria 4187
204 Ga0496105_0018368 3300048908 Bacteria 5618
205 Ga0496106_0482338 3300048909 Bacteria 996
206 Ga0496107_0547884 3300048910 Unclassified 857
207 Ga0496108_0289752 3300048911 Bacteria 1425
208 Ga0496109_0001359 3300048912 Bacteria 20268
209 Ga0496109_0097829 3300048912 Bacteria 2720
210 Ga0496110_0009130 3300048913 Bacteria 8005
211 Ga0496110_0034256 3300048913 Bacteria 4398
212 Ga0496110_0554388 3300048913 Bacteria 1044
213 Ga0496111_0011518 3300048914 Bacteria 5963
214 Ga0496111_0036303 3300048914 Bacteria 3524
215 Ga0496112_0001096 3300048915 Bacteria 20044
216 Ga0496112_0076831 3300048915 Bacteria 3303
217 Ga0496114_0901107 3300048917 Bacteria 766
218 Ga0496114_1186580 3300048917 Bacteria 649
219 Ga0496114_1396405 3300048917 Bacteria 588
220 Ga0501292_006205 3300049515 Bacteria 1690
221 Ga0501295_154300 3300049518 Unclassified 568
222 Ga0501296_045507 3300049519 Unclassified 630
223 Ga0501073_0355401 3300049589 Unclassified 1012
224 Ga0501217_223775 3300049661 Unclassified 596
225 Ga0501235_241219 3300049669 Unclassified 502
226 Ga0501243_039267 3300049675 Bacteria 828
227 Ga0501249_032654 3300049679 Unclassified 1164
228 Ga0501253_066021 3300049683 Unclassified 790
229 Ga0501256_038984 3300049685 Unclassified 559
230 Ga0501219_027120 3300049703 Unclassified 524
231 Ga0501221_108061 3300049704 Unclassified 698
232 Ga0501269_035533 3300049766 Unclassified 651
233 Ga0501283_010435 3300049779 Bacteria 1366
234 Ga0501283_065289 3300049779 Unclassified 663
235 nmdc:mga06z11_882683_c1 3300050494 Unclassified 545
236 nmdc:mga05p37_1525245_c1 3300050507 Bacteria 664
237 nmdc:mga05p37_15414_c1 3300050507 Bacteria 9183
238 nmdc:mga05p37_33152_c1 3300050507 Bacteria 6325
239 nmdc:mga05p37_3376_c1 3300050507 Bacteria 18634
240 nmdc:mga05p37_520849_c1 3300050507 Bacteria 1360
241 nmdc:mga05p37_997889_c1 3300050507 Unclassified 890
242 nmdc:mga09592_164987_c1 3300050508 Unclassified 1914
243 nmdc:mga09592_38000_c1 3300050508 Bacteria 4040
244 nmdc:mga09592_92785_c1 3300050508 Bacteria 2581
245 nmdc:mga0qj67_161873_c1 3300050509 Bacteria 1817
246 nmdc:mga0qj67_4554_c1 3300050509 Bacteria 10047
247 nmdc:mga06r32_1264978_c1 3300050510 Unclassified 683
248 nmdc:mga06r32_1603361_c1 3300050510 Bacteria 589
249 nmdc:mga06r32_171094_c1 3300050510 Bacteria 2156
250 nmdc:mga06r32_20210_c1 3300050510 Bacteria 6127
251 nmdc:mga06r32_240680_c1 3300050510 Bacteria 1797
252 nmdc:mga06r32_25847_c1 3300050510 Bacteria 5466
253 nmdc:mga08y16_100756_c1 3300050511 Bacteria 3007
254 nmdc:mga08y16_1526336_c1 3300050511 Unclassified 628
255 nmdc:mga08y16_512_c1 3300050511 Bacteria 35786
256 nmdc:mga0n895_1009916_c1 3300050512 Unclassified 813
257 nmdc:mga0n895_1552805_c1 3300050512 Unclassified 627
258 nmdc:mga0n895_2123321_c1 3300050512 Unclassified 518
259 nmdc:mga0rr50_1209142_c1 3300050513 Unclassified 642
260 nmdc:mga0rr50_134369_c1 3300050513 Bacteria 1984
261 nmdc:mga0rr50_196602_c1 3300050513 Bacteria 1655
262 nmdc:mga0rr50_264200_c1 3300050513 Bacteria 1432
263 nmdc:mga0a205_1003981_c1 3300050515 Bacteria 681
264 nmdc:mga0a205_1195691_c1 3300050515 Bacteria 608
265 nmdc:mga0a205_161157_c1 3300050515 Unclassified 2140
266 nmdc:mga0a205_263537_c1 3300050515 Bacteria 1601
267 nmdc:mga0a205_87436_c1 3300050515 Bacteria 3011
268 Ga0530510_1491292 3300061734 Bacteria 519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006194 Ga0075427_10046716 Ga0075427_100467161 90
2 3300006852 Ga0075433_10944916 Ga0075433_109449161 90
3 3300009094 Ga0111539_10008615 Ga0111539_100086158 90
4 3300009094 Ga0111539_10642853 Ga0111539_106428532 90
5 3300009147 Ga0114129_10002782 Ga0114129_1000278214 90
6 3300009147 Ga0114129_10038109 Ga0114129_100381095 90
7 3300010375 Ga0105239_13117407 Ga0105239_131174071 90
8 3300013297 Ga0157378_12518861 Ga0157378_125188612 90
9 3300014326 Ga0157380_10411867 Ga0157380_104118672 90
10 3300031731 Ga0307405_10168427 Ga0307405_101684272 90
11 3300031824 Ga0307413_11718777 Ga0307413_117187771 90
12 3300035242 Ga0373962_0368114 Ga0373962_0368114_216_488 90
13 3300042008 Ga0439450_007645 Ga0439450_007645_81_353 90
14 3300048903 Ga0496100_0658438 Ga0496100_0658438_169_441 90
15 3300048904 Ga0496101_0281049 Ga0496101_0281049_256_528 90
16 3300048905 Ga0496102_0141848 Ga0496102_0141848_1750_2022 90
17 3300048906 Ga0496103_0090470 Ga0496103_0090470_818_1090 90
18 3300048909 Ga0496106_0482338 Ga0496106_0482338_711_983 90
19 3300048910 Ga0496107_0547884 Ga0496107_0547884_281_553 90
20 3300048912 Ga0496109_0097829 Ga0496109_0097829_1333_1605 90
21 3300048913 Ga0496110_0554388 Ga0496110_0554388_518_790 90
22 3300048914 Ga0496111_0036303 Ga0496111_0036303_679_951 90
23 3300048915 Ga0496112_0076831 Ga0496112_0076831_2635_2907 90
24 3300048917 Ga0496114_1396405 Ga0496114_1396405_225_497 90
25 3300049779 Ga0501283_010435 Ga0501283_010435_96_368 90
26 3300050507 nmdc:mga05p37_33152_c1 nmdc:mga05p37_33152_c1_5661_5933 90
27 3300050507 nmdc:mga05p37_3376_c1 nmdc:mga05p37_3376_c1_8493_8765 90
28 3300050509 nmdc:mga0qj67_4554_c1 nmdc:mga0qj67_4554_c1_8157_8429 90
29 3300050510 nmdc:mga06r32_25847_c1 nmdc:mga06r32_25847_c1_1589_1861 90
30 3300050511 nmdc:mga08y16_1526336_c1 nmdc:mga08y16_1526336_c1_248_520 90
31 3300050511 nmdc:mga08y16_512_c1 nmdc:mga08y16_512_c1_31148_31420 90
32 3300050515 nmdc:mga0a205_263537_c1 nmdc:mga0a205_263537_c1_1218_1490 90
33 3300025916 Ga0207663_11163576 Ga0207663_111635762 92
34 3300006028 Ga0070717_10025353 Ga0070717_100253532 93
35 3300009093 Ga0105240_10001098 Ga0105240_1000109843 93
36 3300009545 Ga0105237_10116653 Ga0105237_101166533 93
37 3300025912 Ga0207707_10441015 Ga0207707_104410151 93
38 3300025913 Ga0207695_10009070 Ga0207695_100090703 93
39 3300025914 Ga0207671_10104402 Ga0207671_101044022 93
40 3300028653 Ga0265323_10000122 Ga0265323_1000012235 93
41 3300031235 Ga0265330_10105198 Ga0265330_101051982 93
42 3300005290 Ga0065712_10077385 Ga0065712_100773856 94
43 3300005293 Ga0065715_10107142 Ga0065715_101071421 94
44 3300005293 Ga0065715_10560131 Ga0065715_105601311 94
45 3300005293 Ga0065715_10808105 Ga0065715_108081051 94
46 3300005328 Ga0070676_10259378 Ga0070676_102593781 94
47 3300005335 Ga0070666_11487804 Ga0070666_114878041 94
48 3300005337 Ga0070682_100211653 Ga0070682_1002116532 94
49 3300005339 Ga0070660_100902445 Ga0070660_1009024452 94
50 3300005366 Ga0070659_100136968 Ga0070659_1001369682 94
51 3300005440 Ga0070705_100907160 Ga0070705_1009071601 94
52 3300005459 Ga0068867_102217904 Ga0068867_1022179041 94
53 3300005468 Ga0070707_100007879 Ga0070707_1000078798 94
54 3300005530 Ga0070679_101574090 Ga0070679_1015740902 94
55 3300005536 Ga0070697_101210223 Ga0070697_1012102232 94
56 3300005546 Ga0070696_100979361 Ga0070696_1009793612 94
57 3300005547 Ga0070693_100025947 Ga0070693_1000259473 94
58 3300005578 Ga0068854_100816076 Ga0068854_1008160762 94
59 3300005844 Ga0068862_100365011 Ga0068862_1003650112 94
60 3300006028 Ga0070717_11914345 Ga0070717_119143452 94
61 3300006195 Ga0075366_10701058 Ga0075366_107010581 94
62 3300006844 Ga0075428_100000864 Ga0075428_10000086416 94
63 3300006844 Ga0075428_100025362 Ga0075428_1000253626 94
64 3300006844 Ga0075428_102649888 Ga0075428_1026498882 94
65 3300006846 Ga0075430_100015109 Ga0075430_1000151092 94
66 3300006846 Ga0075430_101331500 Ga0075430_1013315002 94
67 3300006847 Ga0075431_100086286 Ga0075431_1000862865 94
68 3300006847 Ga0075431_100124104 Ga0075431_1001241042 94
69 3300006847 Ga0075431_101854400 Ga0075431_1018544002 94
70 3300006852 Ga0075433_10412712 Ga0075433_104127122 94
71 3300006871 Ga0075434_100397516 Ga0075434_1003975163 94
72 3300006871 Ga0075434_100397782 Ga0075434_1003977822 94
73 3300006871 Ga0075434_100401509 Ga0075434_1004015092 94
74 3300006880 Ga0075429_100431046 Ga0075429_1004310462 94
75 3300006914 Ga0075436_101270243 Ga0075436_1012702432 94
76 3300007076 Ga0075435_100602353 Ga0075435_1006023532 94
77 3300009094 Ga0111539_13414815 Ga0111539_134148151 94
78 3300013297 Ga0157378_10608427 Ga0157378_106084273 94
79 3300025907 Ga0207645_10348298 Ga0207645_103482981 94
80 3300025911 Ga0207654_11199729 Ga0207654_111997291 94
81 3300025919 Ga0207657_11054294 Ga0207657_110542941 94
82 3300025922 Ga0207646_10005622 Ga0207646_1000562212 94
83 3300025937 Ga0207669_11801547 Ga0207669_118015471 94
84 3300025942 Ga0207689_11559242 Ga0207689_115592421 94
85 3300026089 Ga0207648_12024524 Ga0207648_120245241 94
86 3300027907 Ga0207428_10011666 Ga0207428_100116665 94
87 3300027907 Ga0207428_11174969 Ga0207428_111749691 94
88 3300031548 Ga0307408_100003532 Ga0307408_1000035327 94
89 3300031548 Ga0307408_100523853 Ga0307408_1005238531 94
90 3300031901 Ga0307406_10096621 Ga0307406_100966212 94
91 3300031901 Ga0307406_10158227 Ga0307406_101582272 94
92 3300031995 Ga0307409_100910274 Ga0307409_1009102742 94
93 3300032002 Ga0307416_100048610 Ga0307416_1000486105 94
94 3300032002 Ga0307416_100778145 Ga0307416_1007781452 94
95 3300032005 Ga0307411_10083827 Ga0307411_100838275 94
96 3300032005 Ga0307411_10481539 Ga0307411_104815392 94
97 3300032005 Ga0307411_10803461 Ga0307411_108034612 94
98 3300032126 Ga0307415_100126613 Ga0307415_1001266133 94
99 3300035089 Ga0373944_0106431 Ga0373944_0106431_140_424 94
100 3300035118 Ga0373954_0422196 Ga0373954_0422196_344_628 94
101 3300035725 Ga0373947_0359129 Ga0373947_0359129_244_528 94
102 3300036401 Ga0373937_0540773 Ga0373937_0540773_177_461 94
103 3300041512 Ga0451853_2690176 Ga0451853_2690176_612_896 94
104 3300042876 Ga0451577_1013978 Ga0451577_1013978_146_430 94
105 3300044712 Ga0453684_1238496 Ga0453684_1238496_84_368 94
106 3300049515 Ga0501292_006205 Ga0501292_006205_1175_1459 94
107 3300049518 Ga0501295_154300 Ga0501295_154300_149_433 94
108 3300049519 Ga0501296_045507 Ga0501296_045507_269_553 94
109 3300049661 Ga0501217_223775 Ga0501217_223775_171_455 94
110 3300049669 Ga0501235_241219 Ga0501235_241219_106_390 94
111 3300049675 Ga0501243_039267 Ga0501243_039267_147_431 94
112 3300049679 Ga0501249_032654 Ga0501249_032654_584_868 94
113 3300049683 Ga0501253_066021 Ga0501253_066021_226_510 94
114 3300049685 Ga0501256_038984 Ga0501256_038984_61_345 94
115 3300049703 Ga0501219_027120 Ga0501219_027120_68_352 94
116 3300049704 Ga0501221_108061 Ga0501221_108061_269_553 94
117 3300049766 Ga0501269_035533 Ga0501269_035533_54_338 94
118 3300049779 Ga0501283_065289 Ga0501283_065289_332_616 94
119 3300050494 nmdc:mga06z11_882683_c1 nmdc:mga06z11_882683_c1_10_294 94
120 3300050507 nmdc:mga05p37_15414_c1 nmdc:mga05p37_15414_c1_5050_5334 94
121 3300050508 nmdc:mga09592_164987_c1 nmdc:mga09592_164987_c1_1318_1602 94
122 3300050509 nmdc:mga0qj67_161873_c1 nmdc:mga0qj67_161873_c1_79_363 94
123 3300050510 nmdc:mga06r32_1264978_c1 nmdc:mga06r32_1264978_c1_320_604 94
124 3300050510 nmdc:mga06r32_1603361_c1 nmdc:mga06r32_1603361_c1_36_320 94
125 3300050510 nmdc:mga06r32_171094_c1 nmdc:mga06r32_171094_c1_1431_1715 94
126 3300050512 nmdc:mga0n895_1552805_c1 nmdc:mga0n895_1552805_c1_178_462 94
127 3300050513 nmdc:mga0rr50_196602_c1 nmdc:mga0rr50_196602_c1_809_1093 94
128 3300061734 Ga0530510_1491292 Ga0530510_1491292_90_374 94
129 3300005293 Ga0065715_11015276 Ga0065715_110152761 95
130 3300005328 Ga0070676_10980788 Ga0070676_109807881 95
131 3300005356 Ga0070674_100886235 Ga0070674_1008862351 95
132 3300005365 Ga0070688_101710637 Ga0070688_1017106371 95
133 3300005456 Ga0070678_100848637 Ga0070678_1008486371 95
134 3300005457 Ga0070662_100392476 Ga0070662_1003924761 95
135 3300005468 Ga0070707_101476339 Ga0070707_1014763392 95
136 3300005518 Ga0070699_100541467 Ga0070699_1005414671 95
137 3300005577 Ga0068857_101082882 Ga0068857_1010828822 95
138 3300005718 Ga0068866_10708024 Ga0068866_107080242 95
139 3300005842 Ga0068858_101628283 Ga0068858_1016282832 95
140 3300006844 Ga0075428_100003486 Ga0075428_1000034867 95
141 3300006844 Ga0075428_100249388 Ga0075428_1002493883 95
142 3300006847 Ga0075431_100035298 Ga0075431_1000352984 95
143 3300006847 Ga0075431_100896635 Ga0075431_1008966351 95
144 3300006852 Ga0075433_11593986 Ga0075433_115939861 95
145 3300006880 Ga0075429_100007862 Ga0075429_1000078625 95
146 3300009147 Ga0114129_10466754 Ga0114129_104667542 95
147 3300009147 Ga0114129_11224592 Ga0114129_112245923 95
148 3300014326 Ga0157380_10833533 Ga0157380_108335332 95
149 3300025315 Ga0207697_10325491 Ga0207697_103254911 95
150 3300025899 Ga0207642_10565762 Ga0207642_105657621 95
151 3300025907 Ga0207645_10849634 Ga0207645_108496341 95
152 3300025908 Ga0207643_10823000 Ga0207643_108230001 95
153 3300025922 Ga0207646_10316242 Ga0207646_103162422 95
154 3300025933 Ga0207706_10373655 Ga0207706_103736552 95
155 3300025937 Ga0207669_10967703 Ga0207669_109677031 95
156 3300026116 Ga0207674_11364917 Ga0207674_113649172 95
157 3300026121 Ga0207683_10937199 Ga0207683_109371992 95
158 3300028380 Ga0268265_10224306 Ga0268265_102243063 95
159 3300041460 Ga0451802_0456017 Ga0451802_0456017_54_365 95
160 3300050507 nmdc:mga05p37_997889_c1 nmdc:mga05p37_997889_c1_93_380 95
161 3300050508 nmdc:mga09592_38000_c1 nmdc:mga09592_38000_c1_1816_2103 95
162 3300050510 nmdc:mga06r32_20210_c1 nmdc:mga06r32_20210_c1_3443_3730 95
163 3300050510 nmdc:mga06r32_240680_c1 nmdc:mga06r32_240680_c1_1337_1624 95
164 3300050515 nmdc:mga0a205_1195691_c1 nmdc:mga0a205_1195691_c1_117_404 95
165 3300005546 Ga0070696_101821308 Ga0070696_1018213082 96
166 3300013306 Ga0163162_12609489 Ga0163162_126094892 96
167 3300005289 Ga0065704_10099711 Ga0065704_100997115 97
168 3300005293 Ga0065715_10165522 Ga0065715_101655221 97
169 3300006844 Ga0075428_100001462 Ga0075428_10000146223 97
170 3300006847 Ga0075431_100011907 Ga0075431_1000119078 97
171 3300006852 Ga0075433_10203325 Ga0075433_102033253 97
172 3300006852 Ga0075433_10757132 Ga0075433_107571322 97
173 3300006852 Ga0075433_11176342 Ga0075433_111763422 97
174 3300006880 Ga0075429_100108412 Ga0075429_1001084124 97
175 3300007076 Ga0075435_100013703 Ga0075435_1000137039 97
176 3300009094 Ga0111539_10088982 Ga0111539_100889824 97
177 3300009147 Ga0114129_10099005 Ga0114129_100990054 97
178 3300014326 Ga0157380_10818130 Ga0157380_108181302 97
179 3300050507 nmdc:mga05p37_1525245_c1 nmdc:mga05p37_1525245_c1_352_645 97
180 3300050508 nmdc:mga09592_92785_c1 nmdc:mga09592_92785_c1_1887_2180 97
181 3300050511 nmdc:mga08y16_100756_c1 nmdc:mga08y16_100756_c1_1486_1779 97
182 3300050515 nmdc:mga0a205_1003981_c1 nmdc:mga0a205_1003981_c1_285_578 97
183 3300050515 nmdc:mga0a205_87436_c1 nmdc:mga0a205_87436_c1_2313_2606 97
184 3300005353 Ga0070669_101012540 Ga0070669_1010125401 98
185 3300005356 Ga0070674_100009709 Ga0070674_1000097097 98
186 3300005544 Ga0070686_100179185 Ga0070686_1001791854 98
187 3300014969 Ga0157376_11121012 Ga0157376_111210121 98
188 3300025937 Ga0207669_10384770 Ga0207669_103847701 98
189 3300041463 Ga0451804_0300849 Ga0451804_0300849_14_310 98
190 3300005345 Ga0070692_10784526 Ga0070692_107845261 99
191 3300005444 Ga0070694_100073217 Ga0070694_1000732173 99
192 3300005468 Ga0070707_100000059 Ga0070707_1000000596 99
193 3300005518 Ga0070699_100029535 Ga0070699_1000295352 99
194 3300005545 Ga0070695_101645899 Ga0070695_1016458991 99
195 3300005549 Ga0070704_100101322 Ga0070704_1001013222 99
196 3300014325 Ga0163163_10349905 Ga0163163_103499053 99
197 3300014326 Ga0157380_11863239 Ga0157380_118632391 99
198 3300025922 Ga0207646_10000387 Ga0207646_1000038724 99
199 3300050513 nmdc:mga0rr50_1209142_c1 nmdc:mga0rr50_1209142_c1_245_568 99
200 3300005289 Ga0065704_10327378 Ga0065704_103273781 100
201 3300005353 Ga0070669_100894881 Ga0070669_1008948811 100
202 3300005445 Ga0070708_100570303 Ga0070708_1005703031 100
203 3300005467 Ga0070706_101919585 Ga0070706_1019195851 100
204 3300005518 Ga0070699_100654477 Ga0070699_1006544771 100
205 3300005546 Ga0070696_101385295 Ga0070696_1013852951 100
206 3300005549 Ga0070704_100487234 Ga0070704_1004872342 100
207 3300005844 Ga0068862_100294611 Ga0068862_1002946112 100
208 3300006871 Ga0075434_101103260 Ga0075434_1011032602 100
209 3300006881 Ga0068865_102101253 Ga0068865_1021012531 100
210 3300006914 Ga0075436_100698400 Ga0075436_1006984001 100
211 3300007076 Ga0075435_101136498 Ga0075435_1011364981 100
212 3300014326 Ga0157380_12899378 Ga0157380_128993781 100
213 3300025917 Ga0207660_10384845 Ga0207660_103848452 100
214 3300050513 nmdc:mga0rr50_264200_c1 nmdc:mga0rr50_264200_c1_725_1027 100
215 3300006871 Ga0075434_100848670 Ga0075434_1008486702 101
216 3300050512 nmdc:mga0n895_1009916_c1 nmdc:mga0n895_1009916_c1_224_529 101
217 3300050513 nmdc:mga0rr50_134369_c1 nmdc:mga0rr50_134369_c1_363_668 101
218 3300050515 nmdc:mga0a205_161157_c1 nmdc:mga0a205_161157_c1_81_386 101
219 3300049589 Ga0501073_0355401 Ga0501073_0355401_592_903 103
220 3300028380 Ga0268265_11400821 Ga0268265_114008212 105
221 3300046472 Ga0495580_0525433 Ga0495580_0525433_332_664 106
222 3300005290 Ga0065712_10102243 Ga0065712_101022433 108
223 3300005535 Ga0070684_100001371 Ga0070684_10000137120 108
224 3300005564 Ga0070664_100000963 Ga0070664_10000096316 108
225 3300013296 Ga0157374_11185120 Ga0157374_111851201 108
226 3300013308 Ga0157375_11252580 Ga0157375_112525801 108
227 3300048907 Ga0496104_0044172 Ga0496104_0044172_534_860 108
228 3300048908 Ga0496105_0018368 Ga0496105_0018368_701_1027 108
229 3300048911 Ga0496108_0289752 Ga0496108_0289752_371_697 108
230 3300048912 Ga0496109_0001359 Ga0496109_0001359_14976_15302 108
231 3300048913 Ga0496110_0009130 Ga0496110_0009130_7237_7563 108
232 3300048914 Ga0496111_0011518 Ga0496111_0011518_2003_2329 108
233 3300048915 Ga0496112_0001096 Ga0496112_0001096_4759_5085 108
234 3300048917 Ga0496114_1186580 Ga0496114_1186580_124_450 108
235 3300005841 Ga0068863_100917975 Ga0068863_1009179752 109
236 3300026088 Ga0207641_10856715 Ga0207641_108567152 109
237 3300050507 nmdc:mga05p37_520849_c1 nmdc:mga05p37_520849_c1_191_520 109
238 3300050512 nmdc:mga0n895_2123321_c1 nmdc:mga0n895_2123321_c1_56_385 109
239 3300005293 Ga0065715_10134102 Ga0065715_101341021 110
240 3300025919 Ga0207657_11497741 Ga0207657_114977411 110
241 3300026067 Ga0207678_10121877 Ga0207678_101218772 110
242 3300005457 Ga0070662_100407748 Ga0070662_1004077481 114
243 2162886012 MBSR1b_contig_3861750 MBSR1b_0128.00000470 116
244 3300005288 Ga0065714_10408460 Ga0065714_104084601 116
245 3300005290 Ga0065712_10142785 Ga0065712_101427852 116
246 3300005335 Ga0070666_10624506 Ga0070666_106245062 116
247 3300005344 Ga0070661_100530582 Ga0070661_1005305822 116
248 3300005354 Ga0070675_100237612 Ga0070675_1002376121 116
249 3300005355 Ga0070671_100107284 Ga0070671_1001072842 116
250 3300005364 Ga0070673_100313901 Ga0070673_1003139012 116
251 3300005367 Ga0070667_100174786 Ga0070667_1001747862 116
252 3300005543 Ga0070672_101073083 Ga0070672_1010730832 116
253 3300005615 Ga0070702_100216469 Ga0070702_1002164692 116
254 3300005618 Ga0068864_101282872 Ga0068864_1012828721 116
255 3300005840 Ga0068870_10746178 Ga0068870_107461782 116
256 3300009098 Ga0105245_10398485 Ga0105245_103984852 116
257 3300010375 Ga0105239_11363834 Ga0105239_113638342 116
258 3300011119 Ga0105246_10512822 Ga0105246_105128222 116
259 3300014325 Ga0163163_10285996 Ga0163163_102859962 116
260 3300014968 Ga0157379_12087747 Ga0157379_120877471 116
261 3300025315 Ga0207697_10000278 Ga0207697_1000027817 116
262 3300025901 Ga0207688_10001904 Ga0207688_100019047 116
263 3300025926 Ga0207659_10536087 Ga0207659_105360872 116
264 3300025927 Ga0207687_11060698 Ga0207687_110606982 116
265 3300025931 Ga0207644_10016020 Ga0207644_100160202 116
266 3300025960 Ga0207651_10293681 Ga0207651_102936812 116
267 3300048913 Ga0496110_0034256 Ga0496110_0034256_998_1348 116
268 3300048917 Ga0496114_0901107 Ga0496114_0901107_234_584 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sm3-assembly1.cif.gz_A structure of bacillus cereus vd045 gabija gaja-gajb complex 0.5945 50 94
4tw1-assembly1.cif.gz_C crystal structure of the octameric pore complex of the staphylococcus aureus bi-component toxin lukgh 0.5928 32 74
7pub-assembly1.cif.gz_DU late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.56 26 62
4gex-assembly1.cif.gz_C structure of a stabilised cesas-6 dimer, second crystal form 0.5552 30 89
4gex-assembly2.cif.gz_B structure of a stabilised cesas-6 dimer, second crystal form 0.5493 31 89
ID Description Score Start End Superfamily
af_C7G071_31_244_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.6643 31 54 3.90.1200.10
af_Q4DFP6_3_162_3.30.1460.50 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.6276 15 72 3.30.1460.50
af_Q9C0U7_197_327_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6199 30 69 3.30.1520.10
af_Q9XXC4_140_305_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5897 32 75 2.60.40.640
af_Q20821_22_163_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.5889 34 71 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A2V8UXS9-F1-model_v4 Uncharacterized protein 0.9038 17 108
AF-A0A7Y8I239-F1-model_v4 Uncharacterized protein 0.8921 19 108
AF-A0A2V8KG64-F1-model_v4 Uncharacterized protein 0.889 19 108
AF-A0A1Q7KX26-F1-model_v4 Uncharacterized protein 0.876 17 108
AF-A0A2N9L3K3-F1-model_v4 Uncharacterized protein 0.8528 19 116

Feature Viewer

pLDDT pTM Quality
81.7 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map