F375521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 161 | 268 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10349905|Ga0163163_103499053 |
| Length | 107 |
| Sequence | MAEWELAQNDVSEELAQLHFFSIKKKQPGGDIEFQIVVRQYATPLDRAQNPLMRFFAQANRQTNQSIAPYTPCGWGPTVGAAVSECVKEIRRFPYEGPMPDDDAATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 120 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 131 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 139 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 140 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 141 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 143 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 144 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 145 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 146 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 147 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 148 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 149 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 150 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 151 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 152 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 153 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 8.58 |
| Rhizosphere | 90.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3861750 | 2162886012 | Unclassified | 1247 |
| 2 | Ga0065714_10408460 | 3300005288 | Unclassified | 584 |
| 3 | Ga0065704_10099711 | 3300005289 | Unclassified | 2300 |
| 4 | Ga0065704_10327378 | 3300005289 | Bacteria | 843 |
| 5 | Ga0065712_10077385 | 3300005290 | Unclassified | 3504 |
| 6 | Ga0065712_10102243 | 3300005290 | Bacteria | 2010 |
| 7 | Ga0065712_10142785 | 3300005290 | Bacteria | 1434 |
| 8 | Ga0065715_10107142 | 3300005293 | Bacteria | 2788 |
| 9 | Ga0065715_10134102 | 3300005293 | Bacteria | 1923 |
| 10 | Ga0065715_10165522 | 3300005293 | Bacteria | 1590 |
| 11 | Ga0065715_10560131 | 3300005293 | Bacteria | 734 |
| 12 | Ga0065715_10808105 | 3300005293 | Unclassified | 607 |
| 13 | Ga0065715_11015276 | 3300005293 | Unclassified | 541 |
| 14 | Ga0070676_10259378 | 3300005328 | Unclassified | 1163 |
| 15 | Ga0070676_10980788 | 3300005328 | Unclassified | 633 |
| 16 | Ga0070666_10624506 | 3300005335 | Bacteria | 787 |
| 17 | Ga0070666_11487804 | 3300005335 | Unclassified | 506 |
| 18 | Ga0070682_100211653 | 3300005337 | Bacteria | 1374 |
| 19 | Ga0070660_100902445 | 3300005339 | Unclassified | 745 |
| 20 | Ga0070661_100530582 | 3300005344 | Bacteria | 945 |
| 21 | Ga0070692_10784526 | 3300005345 | Unclassified | 649 |
| 22 | Ga0070669_100894881 | 3300005353 | Unclassified | 758 |
| 23 | Ga0070669_101012540 | 3300005353 | Unclassified | 713 |
| 24 | Ga0070675_100237612 | 3300005354 | Bacteria | 1591 |
| 25 | Ga0070671_100107284 | 3300005355 | Bacteria | 2345 |
| 26 | Ga0070674_100009709 | 3300005356 | Bacteria | 5777 |
| 27 | Ga0070674_100886235 | 3300005356 | Unclassified | 776 |
| 28 | Ga0070673_100313901 | 3300005364 | Unclassified | 1383 |
| 29 | Ga0070688_101710637 | 3300005365 | Unclassified | 515 |
| 30 | Ga0070659_100136968 | 3300005366 | Bacteria | 1991 |
| 31 | Ga0070667_100174786 | 3300005367 | Bacteria | 1897 |
| 32 | Ga0070705_100907160 | 3300005440 | Unclassified | 709 |
| 33 | Ga0070694_100073217 | 3300005444 | Unclassified | 2366 |
| 34 | Ga0070708_100570303 | 3300005445 | Bacteria | 1067 |
| 35 | Ga0070678_100848637 | 3300005456 | Unclassified | 832 |
| 36 | Ga0070662_100392476 | 3300005457 | Bacteria | 1144 |
| 37 | Ga0070662_100407748 | 3300005457 | Bacteria | 1123 |
| 38 | Ga0068867_102217904 | 3300005459 | Unclassified | 521 |
| 39 | Ga0070706_101919585 | 3300005467 | Unclassified | 537 |
| 40 | Ga0070707_100000059 | 3300005468 | Bacteria | 98057 |
| 41 | Ga0070707_100007879 | 3300005468 | Bacteria | 9889 |
| 42 | Ga0070707_101476339 | 3300005468 | Bacteria | 647 |
| 43 | Ga0070699_100029535 | 3300005518 | Bacteria | 4726 |
| 44 | Ga0070699_100541467 | 3300005518 | Bacteria | 1059 |
| 45 | Ga0070699_100654477 | 3300005518 | Unclassified | 959 |
| 46 | Ga0070679_101574090 | 3300005530 | Bacteria | 605 |
| 47 | Ga0070684_100001371 | 3300005535 | Bacteria | 17501 |
| 48 | Ga0070697_101210223 | 3300005536 | Unclassified | 673 |
| 49 | Ga0070672_101073083 | 3300005543 | Unclassified | 715 |
| 50 | Ga0070686_100179185 | 3300005544 | Unclassified | 1504 |
| 51 | Ga0070695_101645899 | 3300005545 | Unclassified | 536 |
| 52 | Ga0070696_100979361 | 3300005546 | Unclassified | 705 |
| 53 | Ga0070696_101385295 | 3300005546 | Unclassified | 599 |
| 54 | Ga0070696_101821308 | 3300005546 | Unclassified | 526 |
| 55 | Ga0070693_100025947 | 3300005547 | Unclassified | 3157 |
| 56 | Ga0070704_100101322 | 3300005549 | Bacteria | 2170 |
| 57 | Ga0070704_100487234 | 3300005549 | Bacteria | 1068 |
| 58 | Ga0070664_100000963 | 3300005564 | Bacteria | 22509 |
| 59 | Ga0068857_101082882 | 3300005577 | Unclassified | 773 |
| 60 | Ga0068854_100816076 | 3300005578 | Unclassified | 814 |
| 61 | Ga0070702_100216469 | 3300005615 | Unclassified | 1278 |
| 62 | Ga0068864_101282872 | 3300005618 | Unclassified | 732 |
| 63 | Ga0068866_10708024 | 3300005718 | Unclassified | 691 |
| 64 | Ga0068870_10746178 | 3300005840 | Unclassified | 679 |
| 65 | Ga0068863_100917975 | 3300005841 | Unclassified | 876 |
| 66 | Ga0068858_101628283 | 3300005842 | Unclassified | 637 |
| 67 | Ga0068862_100294611 | 3300005844 | Bacteria | 1491 |
| 68 | Ga0068862_100365011 | 3300005844 | Bacteria | 1343 |
| 69 | Ga0070717_10025353 | 3300006028 | Bacteria | 4715 |
| 70 | Ga0070717_11914345 | 3300006028 | Unclassified | 535 |
| 71 | Ga0075427_10046716 | 3300006194 | Bacteria | 739 |
| 72 | Ga0075366_10701058 | 3300006195 | Unclassified | 629 |
| 73 | Ga0075428_100000864 | 3300006844 | Bacteria | 31871 |
| 74 | Ga0075428_100001462 | 3300006844 | Bacteria | 25269 |
| 75 | Ga0075428_100003486 | 3300006844 | Bacteria | 17221 |
| 76 | Ga0075428_100025362 | 3300006844 | Bacteria | 6561 |
| 77 | Ga0075428_100249388 | 3300006844 | Bacteria | 1914 |
| 78 | Ga0075428_102649888 | 3300006844 | Bacteria | 512 |
| 79 | Ga0075430_100015109 | 3300006846 | Bacteria | 6572 |
| 80 | Ga0075430_101331500 | 3300006846 | Bacteria | 590 |
| 81 | Ga0075431_100011907 | 3300006847 | Bacteria | 8776 |
| 82 | Ga0075431_100035298 | 3300006847 | Bacteria | 5147 |
| 83 | Ga0075431_100086286 | 3300006847 | Bacteria | 3239 |
| 84 | Ga0075431_100124104 | 3300006847 | Bacteria | 2664 |
| 85 | Ga0075431_100896635 | 3300006847 | Bacteria | 857 |
| 86 | Ga0075431_101854400 | 3300006847 | Bacteria | 559 |
| 87 | Ga0075433_10203325 | 3300006852 | Unclassified | 1761 |
| 88 | Ga0075433_10412712 | 3300006852 | Bacteria | 1191 |
| 89 | Ga0075433_10757132 | 3300006852 | Unclassified | 849 |
| 90 | Ga0075433_10944916 | 3300006852 | Unclassified | 752 |
| 91 | Ga0075433_11176342 | 3300006852 | Bacteria | 666 |
| 92 | Ga0075433_11593986 | 3300006852 | Bacteria | 563 |
| 93 | Ga0075434_100397516 | 3300006871 | Bacteria | 1399 |
| 94 | Ga0075434_100397782 | 3300006871 | Bacteria | 1399 |
| 95 | Ga0075434_100401509 | 3300006871 | Bacteria | 1392 |
| 96 | Ga0075434_100848670 | 3300006871 | Unclassified | 929 |
| 97 | Ga0075434_101103260 | 3300006871 | Unclassified | 807 |
| 98 | Ga0075429_100007862 | 3300006880 | Bacteria | 9261 |
| 99 | Ga0075429_100108412 | 3300006880 | Bacteria | 2427 |
| 100 | Ga0075429_100431046 | 3300006880 | Unclassified | 1155 |
| 101 | Ga0068865_102101253 | 3300006881 | Unclassified | 513 |
| 102 | Ga0075436_100698400 | 3300006914 | Unclassified | 751 |
| 103 | Ga0075436_101270243 | 3300006914 | Bacteria | 557 |
| 104 | Ga0075435_100013703 | 3300007076 | Bacteria | 6041 |
| 105 | Ga0075435_100602353 | 3300007076 | Unclassified | 953 |
| 106 | Ga0075435_101136498 | 3300007076 | Unclassified | 683 |
| 107 | Ga0105240_10001098 | 3300009093 | Bacteria | 47733 |
| 108 | Ga0111539_10008615 | 3300009094 | Bacteria | 12956 |
| 109 | Ga0111539_10088982 | 3300009094 | Bacteria | 3628 |
| 110 | Ga0111539_10642853 | 3300009094 | Bacteria | 1235 |
| 111 | Ga0111539_13414815 | 3300009094 | Unclassified | 511 |
| 112 | Ga0105245_10398485 | 3300009098 | Unclassified | 1375 |
| 113 | Ga0114129_10002782 | 3300009147 | Bacteria | 24386 |
| 114 | Ga0114129_10038109 | 3300009147 | Bacteria | 6783 |
| 115 | Ga0114129_10099005 | 3300009147 | Bacteria | 4036 |
| 116 | Ga0114129_10466754 | 3300009147 | Unclassified | 1654 |
| 117 | Ga0114129_11224592 | 3300009147 | Bacteria | 934 |
| 118 | Ga0105237_10116653 | 3300009545 | Bacteria | 2663 |
| 119 | Ga0105239_11363834 | 3300010375 | Bacteria | 818 |
| 120 | Ga0105239_13117407 | 3300010375 | Unclassified | 540 |
| 121 | Ga0105246_10512822 | 3300011119 | Bacteria | 1020 |
| 122 | Ga0157374_11185120 | 3300013296 | Bacteria | 785 |
| 123 | Ga0157378_10608427 | 3300013297 | Bacteria | 1105 |
| 124 | Ga0157378_12518861 | 3300013297 | Unclassified | 567 |
| 125 | Ga0163162_12609489 | 3300013306 | Unclassified | 581 |
| 126 | Ga0157375_11252580 | 3300013308 | Bacteria | 871 |
| 127 | Ga0163163_10285996 | 3300014325 | Unclassified | 1701 |
| 128 | Ga0163163_10349905 | 3300014325 | Unclassified | 1534 |
| 129 | Ga0157380_10411867 | 3300014326 | Bacteria | 1286 |
| 130 | Ga0157380_10818130 | 3300014326 | Unclassified | 950 |
| 131 | Ga0157380_10833533 | 3300014326 | Unclassified | 942 |
| 132 | Ga0157380_11863239 | 3300014326 | Bacteria | 661 |
| 133 | Ga0157380_12899378 | 3300014326 | Unclassified | 546 |
| 134 | Ga0157379_12087747 | 3300014968 | Unclassified | 561 |
| 135 | Ga0157376_11121012 | 3300014969 | Unclassified | 813 |
| 136 | Ga0207697_10000278 | 3300025315 | Bacteria | 28321 |
| 137 | Ga0207697_10325491 | 3300025315 | Unclassified | 682 |
| 138 | Ga0207642_10565762 | 3300025899 | Unclassified | 704 |
| 139 | Ga0207688_10001904 | 3300025901 | Bacteria | 11179 |
| 140 | Ga0207645_10348298 | 3300025907 | Unclassified | 991 |
| 141 | Ga0207645_10849634 | 3300025907 | Unclassified | 620 |
| 142 | Ga0207643_10823000 | 3300025908 | Unclassified | 602 |
| 143 | Ga0207654_11199729 | 3300025911 | Unclassified | 553 |
| 144 | Ga0207707_10441015 | 3300025912 | Bacteria | 1115 |
| 145 | Ga0207695_10009070 | 3300025913 | Bacteria | 12358 |
| 146 | Ga0207671_10104402 | 3300025914 | Bacteria | 2150 |
| 147 | Ga0207663_11163576 | 3300025916 | Bacteria | 621 |
| 148 | Ga0207660_10384845 | 3300025917 | Bacteria | 1128 |
| 149 | Ga0207657_11054294 | 3300025919 | Unclassified | 622 |
| 150 | Ga0207657_11497741 | 3300025919 | Unclassified | 504 |
| 151 | Ga0207646_10000387 | 3300025922 | Bacteria | 59178 |
| 152 | Ga0207646_10005622 | 3300025922 | Bacteria | 13165 |
| 153 | Ga0207646_10316242 | 3300025922 | Bacteria | 1411 |
| 154 | Ga0207659_10536087 | 3300025926 | Bacteria | 994 |
| 155 | Ga0207687_11060698 | 3300025927 | Bacteria | 695 |
| 156 | Ga0207644_10016020 | 3300025931 | Bacteria | 5040 |
| 157 | Ga0207706_10373655 | 3300025933 | Bacteria | 1238 |
| 158 | Ga0207669_10384770 | 3300025937 | Bacteria | 1094 |
| 159 | Ga0207669_10967703 | 3300025937 | Unclassified | 714 |
| 160 | Ga0207669_11801547 | 3300025937 | Unclassified | 523 |
| 161 | Ga0207689_11559242 | 3300025942 | Unclassified | 550 |
| 162 | Ga0207651_10293681 | 3300025960 | Bacteria | 1349 |
| 163 | Ga0207678_10121877 | 3300026067 | Bacteria | 2225 |
| 164 | Ga0207641_10856715 | 3300026088 | Bacteria | 901 |
| 165 | Ga0207648_12024524 | 3300026089 | Unclassified | 537 |
| 166 | Ga0207674_11364917 | 3300026116 | Unclassified | 678 |
| 167 | Ga0207683_10937199 | 3300026121 | Bacteria | 804 |
| 168 | Ga0207428_10011666 | 3300027907 | Bacteria | 7751 |
| 169 | Ga0207428_11174969 | 3300027907 | Unclassified | 534 |
| 170 | Ga0268265_10224306 | 3300028380 | Unclassified | 1647 |
| 171 | Ga0268265_11400821 | 3300028380 | Unclassified | 701 |
| 172 | Ga0265323_10000122 | 3300028653 | Bacteria | 44507 |
| 173 | Ga0265330_10105198 | 3300031235 | Unclassified | 1207 |
| 174 | Ga0307408_100003532 | 3300031548 | Bacteria | 10641 |
| 175 | Ga0307408_100523853 | 3300031548 | Unclassified | 1041 |
| 176 | Ga0307405_10168427 | 3300031731 | Bacteria | 1560 |
| 177 | Ga0307413_11718777 | 3300031824 | Unclassified | 560 |
| 178 | Ga0307406_10096621 | 3300031901 | Bacteria | 2002 |
| 179 | Ga0307406_10158227 | 3300031901 | Bacteria | 1625 |
| 180 | Ga0307409_100910274 | 3300031995 | Unclassified | 894 |
| 181 | Ga0307416_100048610 | 3300032002 | Bacteria | 3367 |
| 182 | Ga0307416_100778145 | 3300032002 | Unclassified | 1051 |
| 183 | Ga0307411_10083827 | 3300032005 | Bacteria | 2203 |
| 184 | Ga0307411_10481539 | 3300032005 | Bacteria | 1045 |
| 185 | Ga0307411_10803461 | 3300032005 | Bacteria | 828 |
| 186 | Ga0307415_100126613 | 3300032126 | Unclassified | 1926 |
| 187 | Ga0373944_0106431 | 3300035089 | Unclassified | 953 |
| 188 | Ga0373954_0422196 | 3300035118 | Unclassified | 660 |
| 189 | Ga0373962_0368114 | 3300035242 | Bacteria | 523 |
| 190 | Ga0373947_0359129 | 3300035725 | Unclassified | 978 |
| 191 | Ga0373937_0540773 | 3300036401 | Bacteria | 1107 |
| 192 | Ga0451802_0456017 | 3300041460 | Unclassified | 699 |
| 193 | Ga0451804_0300849 | 3300041463 | Unclassified | 580 |
| 194 | Ga0451853_2690176 | 3300041512 | Unclassified | 1048 |
| 195 | Ga0439450_007645 | 3300042008 | Bacteria | 1989 |
| 196 | Ga0451577_1013978 | 3300042876 | Unclassified | 745 |
| 197 | Ga0453684_1238496 | 3300044712 | Unclassified | 781 |
| 198 | Ga0495580_0525433 | 3300046472 | Bacteria | 788 |
| 199 | Ga0496100_0658438 | 3300048903 | Bacteria | 816 |
| 200 | Ga0496101_0281049 | 3300048904 | Bacteria | 1301 |
| 201 | Ga0496102_0141848 | 3300048905 | Bacteria | 2253 |
| 202 | Ga0496103_0090470 | 3300048906 | Bacteria | 1931 |
| 203 | Ga0496104_0044172 | 3300048907 | Bacteria | 4187 |
| 204 | Ga0496105_0018368 | 3300048908 | Bacteria | 5618 |
| 205 | Ga0496106_0482338 | 3300048909 | Bacteria | 996 |
| 206 | Ga0496107_0547884 | 3300048910 | Unclassified | 857 |
| 207 | Ga0496108_0289752 | 3300048911 | Bacteria | 1425 |
| 208 | Ga0496109_0001359 | 3300048912 | Bacteria | 20268 |
| 209 | Ga0496109_0097829 | 3300048912 | Bacteria | 2720 |
| 210 | Ga0496110_0009130 | 3300048913 | Bacteria | 8005 |
| 211 | Ga0496110_0034256 | 3300048913 | Bacteria | 4398 |
| 212 | Ga0496110_0554388 | 3300048913 | Bacteria | 1044 |
| 213 | Ga0496111_0011518 | 3300048914 | Bacteria | 5963 |
| 214 | Ga0496111_0036303 | 3300048914 | Bacteria | 3524 |
| 215 | Ga0496112_0001096 | 3300048915 | Bacteria | 20044 |
| 216 | Ga0496112_0076831 | 3300048915 | Bacteria | 3303 |
| 217 | Ga0496114_0901107 | 3300048917 | Bacteria | 766 |
| 218 | Ga0496114_1186580 | 3300048917 | Bacteria | 649 |
| 219 | Ga0496114_1396405 | 3300048917 | Bacteria | 588 |
| 220 | Ga0501292_006205 | 3300049515 | Bacteria | 1690 |
| 221 | Ga0501295_154300 | 3300049518 | Unclassified | 568 |
| 222 | Ga0501296_045507 | 3300049519 | Unclassified | 630 |
| 223 | Ga0501073_0355401 | 3300049589 | Unclassified | 1012 |
| 224 | Ga0501217_223775 | 3300049661 | Unclassified | 596 |
| 225 | Ga0501235_241219 | 3300049669 | Unclassified | 502 |
| 226 | Ga0501243_039267 | 3300049675 | Bacteria | 828 |
| 227 | Ga0501249_032654 | 3300049679 | Unclassified | 1164 |
| 228 | Ga0501253_066021 | 3300049683 | Unclassified | 790 |
| 229 | Ga0501256_038984 | 3300049685 | Unclassified | 559 |
| 230 | Ga0501219_027120 | 3300049703 | Unclassified | 524 |
| 231 | Ga0501221_108061 | 3300049704 | Unclassified | 698 |
| 232 | Ga0501269_035533 | 3300049766 | Unclassified | 651 |
| 233 | Ga0501283_010435 | 3300049779 | Bacteria | 1366 |
| 234 | Ga0501283_065289 | 3300049779 | Unclassified | 663 |
| 235 | nmdc:mga06z11_882683_c1 | 3300050494 | Unclassified | 545 |
| 236 | nmdc:mga05p37_1525245_c1 | 3300050507 | Bacteria | 664 |
| 237 | nmdc:mga05p37_15414_c1 | 3300050507 | Bacteria | 9183 |
| 238 | nmdc:mga05p37_33152_c1 | 3300050507 | Bacteria | 6325 |
| 239 | nmdc:mga05p37_3376_c1 | 3300050507 | Bacteria | 18634 |
| 240 | nmdc:mga05p37_520849_c1 | 3300050507 | Bacteria | 1360 |
| 241 | nmdc:mga05p37_997889_c1 | 3300050507 | Unclassified | 890 |
| 242 | nmdc:mga09592_164987_c1 | 3300050508 | Unclassified | 1914 |
| 243 | nmdc:mga09592_38000_c1 | 3300050508 | Bacteria | 4040 |
| 244 | nmdc:mga09592_92785_c1 | 3300050508 | Bacteria | 2581 |
| 245 | nmdc:mga0qj67_161873_c1 | 3300050509 | Bacteria | 1817 |
| 246 | nmdc:mga0qj67_4554_c1 | 3300050509 | Bacteria | 10047 |
| 247 | nmdc:mga06r32_1264978_c1 | 3300050510 | Unclassified | 683 |
| 248 | nmdc:mga06r32_1603361_c1 | 3300050510 | Bacteria | 589 |
| 249 | nmdc:mga06r32_171094_c1 | 3300050510 | Bacteria | 2156 |
| 250 | nmdc:mga06r32_20210_c1 | 3300050510 | Bacteria | 6127 |
| 251 | nmdc:mga06r32_240680_c1 | 3300050510 | Bacteria | 1797 |
| 252 | nmdc:mga06r32_25847_c1 | 3300050510 | Bacteria | 5466 |
| 253 | nmdc:mga08y16_100756_c1 | 3300050511 | Bacteria | 3007 |
| 254 | nmdc:mga08y16_1526336_c1 | 3300050511 | Unclassified | 628 |
| 255 | nmdc:mga08y16_512_c1 | 3300050511 | Bacteria | 35786 |
| 256 | nmdc:mga0n895_1009916_c1 | 3300050512 | Unclassified | 813 |
| 257 | nmdc:mga0n895_1552805_c1 | 3300050512 | Unclassified | 627 |
| 258 | nmdc:mga0n895_2123321_c1 | 3300050512 | Unclassified | 518 |
| 259 | nmdc:mga0rr50_1209142_c1 | 3300050513 | Unclassified | 642 |
| 260 | nmdc:mga0rr50_134369_c1 | 3300050513 | Bacteria | 1984 |
| 261 | nmdc:mga0rr50_196602_c1 | 3300050513 | Bacteria | 1655 |
| 262 | nmdc:mga0rr50_264200_c1 | 3300050513 | Bacteria | 1432 |
| 263 | nmdc:mga0a205_1003981_c1 | 3300050515 | Bacteria | 681 |
| 264 | nmdc:mga0a205_1195691_c1 | 3300050515 | Bacteria | 608 |
| 265 | nmdc:mga0a205_161157_c1 | 3300050515 | Unclassified | 2140 |
| 266 | nmdc:mga0a205_263537_c1 | 3300050515 | Bacteria | 1601 |
| 267 | nmdc:mga0a205_87436_c1 | 3300050515 | Bacteria | 3011 |
| 268 | Ga0530510_1491292 | 3300061734 | Bacteria | 519 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006194 | Ga0075427_10046716 | Ga0075427_100467161 | 90 |
| 2 | 3300006852 | Ga0075433_10944916 | Ga0075433_109449161 | 90 |
| 3 | 3300009094 | Ga0111539_10008615 | Ga0111539_100086158 | 90 |
| 4 | 3300009094 | Ga0111539_10642853 | Ga0111539_106428532 | 90 |
| 5 | 3300009147 | Ga0114129_10002782 | Ga0114129_1000278214 | 90 |
| 6 | 3300009147 | Ga0114129_10038109 | Ga0114129_100381095 | 90 |
| 7 | 3300010375 | Ga0105239_13117407 | Ga0105239_131174071 | 90 |
| 8 | 3300013297 | Ga0157378_12518861 | Ga0157378_125188612 | 90 |
| 9 | 3300014326 | Ga0157380_10411867 | Ga0157380_104118672 | 90 |
| 10 | 3300031731 | Ga0307405_10168427 | Ga0307405_101684272 | 90 |
| 11 | 3300031824 | Ga0307413_11718777 | Ga0307413_117187771 | 90 |
| 12 | 3300035242 | Ga0373962_0368114 | Ga0373962_0368114_216_488 | 90 |
| 13 | 3300042008 | Ga0439450_007645 | Ga0439450_007645_81_353 | 90 |
| 14 | 3300048903 | Ga0496100_0658438 | Ga0496100_0658438_169_441 | 90 |
| 15 | 3300048904 | Ga0496101_0281049 | Ga0496101_0281049_256_528 | 90 |
| 16 | 3300048905 | Ga0496102_0141848 | Ga0496102_0141848_1750_2022 | 90 |
| 17 | 3300048906 | Ga0496103_0090470 | Ga0496103_0090470_818_1090 | 90 |
| 18 | 3300048909 | Ga0496106_0482338 | Ga0496106_0482338_711_983 | 90 |
| 19 | 3300048910 | Ga0496107_0547884 | Ga0496107_0547884_281_553 | 90 |
| 20 | 3300048912 | Ga0496109_0097829 | Ga0496109_0097829_1333_1605 | 90 |
| 21 | 3300048913 | Ga0496110_0554388 | Ga0496110_0554388_518_790 | 90 |
| 22 | 3300048914 | Ga0496111_0036303 | Ga0496111_0036303_679_951 | 90 |
| 23 | 3300048915 | Ga0496112_0076831 | Ga0496112_0076831_2635_2907 | 90 |
| 24 | 3300048917 | Ga0496114_1396405 | Ga0496114_1396405_225_497 | 90 |
| 25 | 3300049779 | Ga0501283_010435 | Ga0501283_010435_96_368 | 90 |
| 26 | 3300050507 | nmdc:mga05p37_33152_c1 | nmdc:mga05p37_33152_c1_5661_5933 | 90 |
| 27 | 3300050507 | nmdc:mga05p37_3376_c1 | nmdc:mga05p37_3376_c1_8493_8765 | 90 |
| 28 | 3300050509 | nmdc:mga0qj67_4554_c1 | nmdc:mga0qj67_4554_c1_8157_8429 | 90 |
| 29 | 3300050510 | nmdc:mga06r32_25847_c1 | nmdc:mga06r32_25847_c1_1589_1861 | 90 |
| 30 | 3300050511 | nmdc:mga08y16_1526336_c1 | nmdc:mga08y16_1526336_c1_248_520 | 90 |
| 31 | 3300050511 | nmdc:mga08y16_512_c1 | nmdc:mga08y16_512_c1_31148_31420 | 90 |
| 32 | 3300050515 | nmdc:mga0a205_263537_c1 | nmdc:mga0a205_263537_c1_1218_1490 | 90 |
| 33 | 3300025916 | Ga0207663_11163576 | Ga0207663_111635762 | 92 |
| 34 | 3300006028 | Ga0070717_10025353 | Ga0070717_100253532 | 93 |
| 35 | 3300009093 | Ga0105240_10001098 | Ga0105240_1000109843 | 93 |
| 36 | 3300009545 | Ga0105237_10116653 | Ga0105237_101166533 | 93 |
| 37 | 3300025912 | Ga0207707_10441015 | Ga0207707_104410151 | 93 |
| 38 | 3300025913 | Ga0207695_10009070 | Ga0207695_100090703 | 93 |
| 39 | 3300025914 | Ga0207671_10104402 | Ga0207671_101044022 | 93 |
| 40 | 3300028653 | Ga0265323_10000122 | Ga0265323_1000012235 | 93 |
| 41 | 3300031235 | Ga0265330_10105198 | Ga0265330_101051982 | 93 |
| 42 | 3300005290 | Ga0065712_10077385 | Ga0065712_100773856 | 94 |
| 43 | 3300005293 | Ga0065715_10107142 | Ga0065715_101071421 | 94 |
| 44 | 3300005293 | Ga0065715_10560131 | Ga0065715_105601311 | 94 |
| 45 | 3300005293 | Ga0065715_10808105 | Ga0065715_108081051 | 94 |
| 46 | 3300005328 | Ga0070676_10259378 | Ga0070676_102593781 | 94 |
| 47 | 3300005335 | Ga0070666_11487804 | Ga0070666_114878041 | 94 |
| 48 | 3300005337 | Ga0070682_100211653 | Ga0070682_1002116532 | 94 |
| 49 | 3300005339 | Ga0070660_100902445 | Ga0070660_1009024452 | 94 |
| 50 | 3300005366 | Ga0070659_100136968 | Ga0070659_1001369682 | 94 |
| 51 | 3300005440 | Ga0070705_100907160 | Ga0070705_1009071601 | 94 |
| 52 | 3300005459 | Ga0068867_102217904 | Ga0068867_1022179041 | 94 |
| 53 | 3300005468 | Ga0070707_100007879 | Ga0070707_1000078798 | 94 |
| 54 | 3300005530 | Ga0070679_101574090 | Ga0070679_1015740902 | 94 |
| 55 | 3300005536 | Ga0070697_101210223 | Ga0070697_1012102232 | 94 |
| 56 | 3300005546 | Ga0070696_100979361 | Ga0070696_1009793612 | 94 |
| 57 | 3300005547 | Ga0070693_100025947 | Ga0070693_1000259473 | 94 |
| 58 | 3300005578 | Ga0068854_100816076 | Ga0068854_1008160762 | 94 |
| 59 | 3300005844 | Ga0068862_100365011 | Ga0068862_1003650112 | 94 |
| 60 | 3300006028 | Ga0070717_11914345 | Ga0070717_119143452 | 94 |
| 61 | 3300006195 | Ga0075366_10701058 | Ga0075366_107010581 | 94 |
| 62 | 3300006844 | Ga0075428_100000864 | Ga0075428_10000086416 | 94 |
| 63 | 3300006844 | Ga0075428_100025362 | Ga0075428_1000253626 | 94 |
| 64 | 3300006844 | Ga0075428_102649888 | Ga0075428_1026498882 | 94 |
| 65 | 3300006846 | Ga0075430_100015109 | Ga0075430_1000151092 | 94 |
| 66 | 3300006846 | Ga0075430_101331500 | Ga0075430_1013315002 | 94 |
| 67 | 3300006847 | Ga0075431_100086286 | Ga0075431_1000862865 | 94 |
| 68 | 3300006847 | Ga0075431_100124104 | Ga0075431_1001241042 | 94 |
| 69 | 3300006847 | Ga0075431_101854400 | Ga0075431_1018544002 | 94 |
| 70 | 3300006852 | Ga0075433_10412712 | Ga0075433_104127122 | 94 |
| 71 | 3300006871 | Ga0075434_100397516 | Ga0075434_1003975163 | 94 |
| 72 | 3300006871 | Ga0075434_100397782 | Ga0075434_1003977822 | 94 |
| 73 | 3300006871 | Ga0075434_100401509 | Ga0075434_1004015092 | 94 |
| 74 | 3300006880 | Ga0075429_100431046 | Ga0075429_1004310462 | 94 |
| 75 | 3300006914 | Ga0075436_101270243 | Ga0075436_1012702432 | 94 |
| 76 | 3300007076 | Ga0075435_100602353 | Ga0075435_1006023532 | 94 |
| 77 | 3300009094 | Ga0111539_13414815 | Ga0111539_134148151 | 94 |
| 78 | 3300013297 | Ga0157378_10608427 | Ga0157378_106084273 | 94 |
| 79 | 3300025907 | Ga0207645_10348298 | Ga0207645_103482981 | 94 |
| 80 | 3300025911 | Ga0207654_11199729 | Ga0207654_111997291 | 94 |
| 81 | 3300025919 | Ga0207657_11054294 | Ga0207657_110542941 | 94 |
| 82 | 3300025922 | Ga0207646_10005622 | Ga0207646_1000562212 | 94 |
| 83 | 3300025937 | Ga0207669_11801547 | Ga0207669_118015471 | 94 |
| 84 | 3300025942 | Ga0207689_11559242 | Ga0207689_115592421 | 94 |
| 85 | 3300026089 | Ga0207648_12024524 | Ga0207648_120245241 | 94 |
| 86 | 3300027907 | Ga0207428_10011666 | Ga0207428_100116665 | 94 |
| 87 | 3300027907 | Ga0207428_11174969 | Ga0207428_111749691 | 94 |
| 88 | 3300031548 | Ga0307408_100003532 | Ga0307408_1000035327 | 94 |
| 89 | 3300031548 | Ga0307408_100523853 | Ga0307408_1005238531 | 94 |
| 90 | 3300031901 | Ga0307406_10096621 | Ga0307406_100966212 | 94 |
| 91 | 3300031901 | Ga0307406_10158227 | Ga0307406_101582272 | 94 |
| 92 | 3300031995 | Ga0307409_100910274 | Ga0307409_1009102742 | 94 |
| 93 | 3300032002 | Ga0307416_100048610 | Ga0307416_1000486105 | 94 |
| 94 | 3300032002 | Ga0307416_100778145 | Ga0307416_1007781452 | 94 |
| 95 | 3300032005 | Ga0307411_10083827 | Ga0307411_100838275 | 94 |
| 96 | 3300032005 | Ga0307411_10481539 | Ga0307411_104815392 | 94 |
| 97 | 3300032005 | Ga0307411_10803461 | Ga0307411_108034612 | 94 |
| 98 | 3300032126 | Ga0307415_100126613 | Ga0307415_1001266133 | 94 |
| 99 | 3300035089 | Ga0373944_0106431 | Ga0373944_0106431_140_424 | 94 |
| 100 | 3300035118 | Ga0373954_0422196 | Ga0373954_0422196_344_628 | 94 |
| 101 | 3300035725 | Ga0373947_0359129 | Ga0373947_0359129_244_528 | 94 |
| 102 | 3300036401 | Ga0373937_0540773 | Ga0373937_0540773_177_461 | 94 |
| 103 | 3300041512 | Ga0451853_2690176 | Ga0451853_2690176_612_896 | 94 |
| 104 | 3300042876 | Ga0451577_1013978 | Ga0451577_1013978_146_430 | 94 |
| 105 | 3300044712 | Ga0453684_1238496 | Ga0453684_1238496_84_368 | 94 |
| 106 | 3300049515 | Ga0501292_006205 | Ga0501292_006205_1175_1459 | 94 |
| 107 | 3300049518 | Ga0501295_154300 | Ga0501295_154300_149_433 | 94 |
| 108 | 3300049519 | Ga0501296_045507 | Ga0501296_045507_269_553 | 94 |
| 109 | 3300049661 | Ga0501217_223775 | Ga0501217_223775_171_455 | 94 |
| 110 | 3300049669 | Ga0501235_241219 | Ga0501235_241219_106_390 | 94 |
| 111 | 3300049675 | Ga0501243_039267 | Ga0501243_039267_147_431 | 94 |
| 112 | 3300049679 | Ga0501249_032654 | Ga0501249_032654_584_868 | 94 |
| 113 | 3300049683 | Ga0501253_066021 | Ga0501253_066021_226_510 | 94 |
| 114 | 3300049685 | Ga0501256_038984 | Ga0501256_038984_61_345 | 94 |
| 115 | 3300049703 | Ga0501219_027120 | Ga0501219_027120_68_352 | 94 |
| 116 | 3300049704 | Ga0501221_108061 | Ga0501221_108061_269_553 | 94 |
| 117 | 3300049766 | Ga0501269_035533 | Ga0501269_035533_54_338 | 94 |
| 118 | 3300049779 | Ga0501283_065289 | Ga0501283_065289_332_616 | 94 |
| 119 | 3300050494 | nmdc:mga06z11_882683_c1 | nmdc:mga06z11_882683_c1_10_294 | 94 |
| 120 | 3300050507 | nmdc:mga05p37_15414_c1 | nmdc:mga05p37_15414_c1_5050_5334 | 94 |
| 121 | 3300050508 | nmdc:mga09592_164987_c1 | nmdc:mga09592_164987_c1_1318_1602 | 94 |
| 122 | 3300050509 | nmdc:mga0qj67_161873_c1 | nmdc:mga0qj67_161873_c1_79_363 | 94 |
| 123 | 3300050510 | nmdc:mga06r32_1264978_c1 | nmdc:mga06r32_1264978_c1_320_604 | 94 |
| 124 | 3300050510 | nmdc:mga06r32_1603361_c1 | nmdc:mga06r32_1603361_c1_36_320 | 94 |
| 125 | 3300050510 | nmdc:mga06r32_171094_c1 | nmdc:mga06r32_171094_c1_1431_1715 | 94 |
| 126 | 3300050512 | nmdc:mga0n895_1552805_c1 | nmdc:mga0n895_1552805_c1_178_462 | 94 |
| 127 | 3300050513 | nmdc:mga0rr50_196602_c1 | nmdc:mga0rr50_196602_c1_809_1093 | 94 |
| 128 | 3300061734 | Ga0530510_1491292 | Ga0530510_1491292_90_374 | 94 |
| 129 | 3300005293 | Ga0065715_11015276 | Ga0065715_110152761 | 95 |
| 130 | 3300005328 | Ga0070676_10980788 | Ga0070676_109807881 | 95 |
| 131 | 3300005356 | Ga0070674_100886235 | Ga0070674_1008862351 | 95 |
| 132 | 3300005365 | Ga0070688_101710637 | Ga0070688_1017106371 | 95 |
| 133 | 3300005456 | Ga0070678_100848637 | Ga0070678_1008486371 | 95 |
| 134 | 3300005457 | Ga0070662_100392476 | Ga0070662_1003924761 | 95 |
| 135 | 3300005468 | Ga0070707_101476339 | Ga0070707_1014763392 | 95 |
| 136 | 3300005518 | Ga0070699_100541467 | Ga0070699_1005414671 | 95 |
| 137 | 3300005577 | Ga0068857_101082882 | Ga0068857_1010828822 | 95 |
| 138 | 3300005718 | Ga0068866_10708024 | Ga0068866_107080242 | 95 |
| 139 | 3300005842 | Ga0068858_101628283 | Ga0068858_1016282832 | 95 |
| 140 | 3300006844 | Ga0075428_100003486 | Ga0075428_1000034867 | 95 |
| 141 | 3300006844 | Ga0075428_100249388 | Ga0075428_1002493883 | 95 |
| 142 | 3300006847 | Ga0075431_100035298 | Ga0075431_1000352984 | 95 |
| 143 | 3300006847 | Ga0075431_100896635 | Ga0075431_1008966351 | 95 |
| 144 | 3300006852 | Ga0075433_11593986 | Ga0075433_115939861 | 95 |
| 145 | 3300006880 | Ga0075429_100007862 | Ga0075429_1000078625 | 95 |
| 146 | 3300009147 | Ga0114129_10466754 | Ga0114129_104667542 | 95 |
| 147 | 3300009147 | Ga0114129_11224592 | Ga0114129_112245923 | 95 |
| 148 | 3300014326 | Ga0157380_10833533 | Ga0157380_108335332 | 95 |
| 149 | 3300025315 | Ga0207697_10325491 | Ga0207697_103254911 | 95 |
| 150 | 3300025899 | Ga0207642_10565762 | Ga0207642_105657621 | 95 |
| 151 | 3300025907 | Ga0207645_10849634 | Ga0207645_108496341 | 95 |
| 152 | 3300025908 | Ga0207643_10823000 | Ga0207643_108230001 | 95 |
| 153 | 3300025922 | Ga0207646_10316242 | Ga0207646_103162422 | 95 |
| 154 | 3300025933 | Ga0207706_10373655 | Ga0207706_103736552 | 95 |
| 155 | 3300025937 | Ga0207669_10967703 | Ga0207669_109677031 | 95 |
| 156 | 3300026116 | Ga0207674_11364917 | Ga0207674_113649172 | 95 |
| 157 | 3300026121 | Ga0207683_10937199 | Ga0207683_109371992 | 95 |
| 158 | 3300028380 | Ga0268265_10224306 | Ga0268265_102243063 | 95 |
| 159 | 3300041460 | Ga0451802_0456017 | Ga0451802_0456017_54_365 | 95 |
| 160 | 3300050507 | nmdc:mga05p37_997889_c1 | nmdc:mga05p37_997889_c1_93_380 | 95 |
| 161 | 3300050508 | nmdc:mga09592_38000_c1 | nmdc:mga09592_38000_c1_1816_2103 | 95 |
| 162 | 3300050510 | nmdc:mga06r32_20210_c1 | nmdc:mga06r32_20210_c1_3443_3730 | 95 |
| 163 | 3300050510 | nmdc:mga06r32_240680_c1 | nmdc:mga06r32_240680_c1_1337_1624 | 95 |
| 164 | 3300050515 | nmdc:mga0a205_1195691_c1 | nmdc:mga0a205_1195691_c1_117_404 | 95 |
| 165 | 3300005546 | Ga0070696_101821308 | Ga0070696_1018213082 | 96 |
| 166 | 3300013306 | Ga0163162_12609489 | Ga0163162_126094892 | 96 |
| 167 | 3300005289 | Ga0065704_10099711 | Ga0065704_100997115 | 97 |
| 168 | 3300005293 | Ga0065715_10165522 | Ga0065715_101655221 | 97 |
| 169 | 3300006844 | Ga0075428_100001462 | Ga0075428_10000146223 | 97 |
| 170 | 3300006847 | Ga0075431_100011907 | Ga0075431_1000119078 | 97 |
| 171 | 3300006852 | Ga0075433_10203325 | Ga0075433_102033253 | 97 |
| 172 | 3300006852 | Ga0075433_10757132 | Ga0075433_107571322 | 97 |
| 173 | 3300006852 | Ga0075433_11176342 | Ga0075433_111763422 | 97 |
| 174 | 3300006880 | Ga0075429_100108412 | Ga0075429_1001084124 | 97 |
| 175 | 3300007076 | Ga0075435_100013703 | Ga0075435_1000137039 | 97 |
| 176 | 3300009094 | Ga0111539_10088982 | Ga0111539_100889824 | 97 |
| 177 | 3300009147 | Ga0114129_10099005 | Ga0114129_100990054 | 97 |
| 178 | 3300014326 | Ga0157380_10818130 | Ga0157380_108181302 | 97 |
| 179 | 3300050507 | nmdc:mga05p37_1525245_c1 | nmdc:mga05p37_1525245_c1_352_645 | 97 |
| 180 | 3300050508 | nmdc:mga09592_92785_c1 | nmdc:mga09592_92785_c1_1887_2180 | 97 |
| 181 | 3300050511 | nmdc:mga08y16_100756_c1 | nmdc:mga08y16_100756_c1_1486_1779 | 97 |
| 182 | 3300050515 | nmdc:mga0a205_1003981_c1 | nmdc:mga0a205_1003981_c1_285_578 | 97 |
| 183 | 3300050515 | nmdc:mga0a205_87436_c1 | nmdc:mga0a205_87436_c1_2313_2606 | 97 |
| 184 | 3300005353 | Ga0070669_101012540 | Ga0070669_1010125401 | 98 |
| 185 | 3300005356 | Ga0070674_100009709 | Ga0070674_1000097097 | 98 |
| 186 | 3300005544 | Ga0070686_100179185 | Ga0070686_1001791854 | 98 |
| 187 | 3300014969 | Ga0157376_11121012 | Ga0157376_111210121 | 98 |
| 188 | 3300025937 | Ga0207669_10384770 | Ga0207669_103847701 | 98 |
| 189 | 3300041463 | Ga0451804_0300849 | Ga0451804_0300849_14_310 | 98 |
| 190 | 3300005345 | Ga0070692_10784526 | Ga0070692_107845261 | 99 |
| 191 | 3300005444 | Ga0070694_100073217 | Ga0070694_1000732173 | 99 |
| 192 | 3300005468 | Ga0070707_100000059 | Ga0070707_1000000596 | 99 |
| 193 | 3300005518 | Ga0070699_100029535 | Ga0070699_1000295352 | 99 |
| 194 | 3300005545 | Ga0070695_101645899 | Ga0070695_1016458991 | 99 |
| 195 | 3300005549 | Ga0070704_100101322 | Ga0070704_1001013222 | 99 |
| 196 | 3300014325 | Ga0163163_10349905 | Ga0163163_103499053 | 99 |
| 197 | 3300014326 | Ga0157380_11863239 | Ga0157380_118632391 | 99 |
| 198 | 3300025922 | Ga0207646_10000387 | Ga0207646_1000038724 | 99 |
| 199 | 3300050513 | nmdc:mga0rr50_1209142_c1 | nmdc:mga0rr50_1209142_c1_245_568 | 99 |
| 200 | 3300005289 | Ga0065704_10327378 | Ga0065704_103273781 | 100 |
| 201 | 3300005353 | Ga0070669_100894881 | Ga0070669_1008948811 | 100 |
| 202 | 3300005445 | Ga0070708_100570303 | Ga0070708_1005703031 | 100 |
| 203 | 3300005467 | Ga0070706_101919585 | Ga0070706_1019195851 | 100 |
| 204 | 3300005518 | Ga0070699_100654477 | Ga0070699_1006544771 | 100 |
| 205 | 3300005546 | Ga0070696_101385295 | Ga0070696_1013852951 | 100 |
| 206 | 3300005549 | Ga0070704_100487234 | Ga0070704_1004872342 | 100 |
| 207 | 3300005844 | Ga0068862_100294611 | Ga0068862_1002946112 | 100 |
| 208 | 3300006871 | Ga0075434_101103260 | Ga0075434_1011032602 | 100 |
| 209 | 3300006881 | Ga0068865_102101253 | Ga0068865_1021012531 | 100 |
| 210 | 3300006914 | Ga0075436_100698400 | Ga0075436_1006984001 | 100 |
| 211 | 3300007076 | Ga0075435_101136498 | Ga0075435_1011364981 | 100 |
| 212 | 3300014326 | Ga0157380_12899378 | Ga0157380_128993781 | 100 |
| 213 | 3300025917 | Ga0207660_10384845 | Ga0207660_103848452 | 100 |
| 214 | 3300050513 | nmdc:mga0rr50_264200_c1 | nmdc:mga0rr50_264200_c1_725_1027 | 100 |
| 215 | 3300006871 | Ga0075434_100848670 | Ga0075434_1008486702 | 101 |
| 216 | 3300050512 | nmdc:mga0n895_1009916_c1 | nmdc:mga0n895_1009916_c1_224_529 | 101 |
| 217 | 3300050513 | nmdc:mga0rr50_134369_c1 | nmdc:mga0rr50_134369_c1_363_668 | 101 |
| 218 | 3300050515 | nmdc:mga0a205_161157_c1 | nmdc:mga0a205_161157_c1_81_386 | 101 |
| 219 | 3300049589 | Ga0501073_0355401 | Ga0501073_0355401_592_903 | 103 |
| 220 | 3300028380 | Ga0268265_11400821 | Ga0268265_114008212 | 105 |
| 221 | 3300046472 | Ga0495580_0525433 | Ga0495580_0525433_332_664 | 106 |
| 222 | 3300005290 | Ga0065712_10102243 | Ga0065712_101022433 | 108 |
| 223 | 3300005535 | Ga0070684_100001371 | Ga0070684_10000137120 | 108 |
| 224 | 3300005564 | Ga0070664_100000963 | Ga0070664_10000096316 | 108 |
| 225 | 3300013296 | Ga0157374_11185120 | Ga0157374_111851201 | 108 |
| 226 | 3300013308 | Ga0157375_11252580 | Ga0157375_112525801 | 108 |
| 227 | 3300048907 | Ga0496104_0044172 | Ga0496104_0044172_534_860 | 108 |
| 228 | 3300048908 | Ga0496105_0018368 | Ga0496105_0018368_701_1027 | 108 |
| 229 | 3300048911 | Ga0496108_0289752 | Ga0496108_0289752_371_697 | 108 |
| 230 | 3300048912 | Ga0496109_0001359 | Ga0496109_0001359_14976_15302 | 108 |
| 231 | 3300048913 | Ga0496110_0009130 | Ga0496110_0009130_7237_7563 | 108 |
| 232 | 3300048914 | Ga0496111_0011518 | Ga0496111_0011518_2003_2329 | 108 |
| 233 | 3300048915 | Ga0496112_0001096 | Ga0496112_0001096_4759_5085 | 108 |
| 234 | 3300048917 | Ga0496114_1186580 | Ga0496114_1186580_124_450 | 108 |
| 235 | 3300005841 | Ga0068863_100917975 | Ga0068863_1009179752 | 109 |
| 236 | 3300026088 | Ga0207641_10856715 | Ga0207641_108567152 | 109 |
| 237 | 3300050507 | nmdc:mga05p37_520849_c1 | nmdc:mga05p37_520849_c1_191_520 | 109 |
| 238 | 3300050512 | nmdc:mga0n895_2123321_c1 | nmdc:mga0n895_2123321_c1_56_385 | 109 |
| 239 | 3300005293 | Ga0065715_10134102 | Ga0065715_101341021 | 110 |
| 240 | 3300025919 | Ga0207657_11497741 | Ga0207657_114977411 | 110 |
| 241 | 3300026067 | Ga0207678_10121877 | Ga0207678_101218772 | 110 |
| 242 | 3300005457 | Ga0070662_100407748 | Ga0070662_1004077481 | 114 |
| 243 | 2162886012 | MBSR1b_contig_3861750 | MBSR1b_0128.00000470 | 116 |
| 244 | 3300005288 | Ga0065714_10408460 | Ga0065714_104084601 | 116 |
| 245 | 3300005290 | Ga0065712_10142785 | Ga0065712_101427852 | 116 |
| 246 | 3300005335 | Ga0070666_10624506 | Ga0070666_106245062 | 116 |
| 247 | 3300005344 | Ga0070661_100530582 | Ga0070661_1005305822 | 116 |
| 248 | 3300005354 | Ga0070675_100237612 | Ga0070675_1002376121 | 116 |
| 249 | 3300005355 | Ga0070671_100107284 | Ga0070671_1001072842 | 116 |
| 250 | 3300005364 | Ga0070673_100313901 | Ga0070673_1003139012 | 116 |
| 251 | 3300005367 | Ga0070667_100174786 | Ga0070667_1001747862 | 116 |
| 252 | 3300005543 | Ga0070672_101073083 | Ga0070672_1010730832 | 116 |
| 253 | 3300005615 | Ga0070702_100216469 | Ga0070702_1002164692 | 116 |
| 254 | 3300005618 | Ga0068864_101282872 | Ga0068864_1012828721 | 116 |
| 255 | 3300005840 | Ga0068870_10746178 | Ga0068870_107461782 | 116 |
| 256 | 3300009098 | Ga0105245_10398485 | Ga0105245_103984852 | 116 |
| 257 | 3300010375 | Ga0105239_11363834 | Ga0105239_113638342 | 116 |
| 258 | 3300011119 | Ga0105246_10512822 | Ga0105246_105128222 | 116 |
| 259 | 3300014325 | Ga0163163_10285996 | Ga0163163_102859962 | 116 |
| 260 | 3300014968 | Ga0157379_12087747 | Ga0157379_120877471 | 116 |
| 261 | 3300025315 | Ga0207697_10000278 | Ga0207697_1000027817 | 116 |
| 262 | 3300025901 | Ga0207688_10001904 | Ga0207688_100019047 | 116 |
| 263 | 3300025926 | Ga0207659_10536087 | Ga0207659_105360872 | 116 |
| 264 | 3300025927 | Ga0207687_11060698 | Ga0207687_110606982 | 116 |
| 265 | 3300025931 | Ga0207644_10016020 | Ga0207644_100160202 | 116 |
| 266 | 3300025960 | Ga0207651_10293681 | Ga0207651_102936812 | 116 |
| 267 | 3300048913 | Ga0496110_0034256 | Ga0496110_0034256_998_1348 | 116 |
| 268 | 3300048917 | Ga0496114_0901107 | Ga0496114_0901107_234_584 | 116 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sm3-assembly1.cif.gz_A | structure of bacillus cereus vd045 gabija gaja-gajb complex | 0.5945 | 50 | 94 |
| 4tw1-assembly1.cif.gz_C | crystal structure of the octameric pore complex of the staphylococcus aureus bi-component toxin lukgh | 0.5928 | 32 | 74 |
| 7pub-assembly1.cif.gz_DU | late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit | 0.56 | 26 | 62 |
| 4gex-assembly1.cif.gz_C | structure of a stabilised cesas-6 dimer, second crystal form | 0.5552 | 30 | 89 |
| 4gex-assembly2.cif.gz_B | structure of a stabilised cesas-6 dimer, second crystal form | 0.5493 | 31 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C7G071_31_244_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.6643 | 31 | 54 | 3.90.1200.10 |
| af_Q4DFP6_3_162_3.30.1460.50 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.6276 | 15 | 72 | 3.30.1460.50 |
| af_Q9C0U7_197_327_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.6199 | 30 | 69 | 3.30.1520.10 |
| af_Q9XXC4_140_305_2.60.40.640 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.5897 | 32 | 75 | 2.60.40.640 |
| af_Q20821_22_163_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.5889 | 34 | 71 | 3.30.1520.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8UXS9-F1-model_v4 | Uncharacterized protein | 0.9038 | 17 | 108 |
|
| AF-A0A7Y8I239-F1-model_v4 | Uncharacterized protein | 0.8921 | 19 | 108 |
|
| AF-A0A2V8KG64-F1-model_v4 | Uncharacterized protein | 0.889 | 19 | 108 |
|
| AF-A0A1Q7KX26-F1-model_v4 | Uncharacterized protein | 0.876 | 17 | 108 |
|
| AF-A0A2N9L3K3-F1-model_v4 | Uncharacterized protein | 0.8528 | 19 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar