F375383

General Info

Members Datasets Scaffolds Average Seq Length
268 150 269 487

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10029899|Ga0081539_100298992
Length 523
Sequence MKDKAFEDLVAAGKPVGEIIGIDSFLIKVRGLQPTNVHALIRFEDGSRGYVHHVYEDYVMVMKLGTTVLRIGMMAVIQHEELLAKVGKNFIGRVINAFGEPIDGKGEIEPDDVWDVFHSAPMLYERKLLDTQLETGITILDINYSLVRGQRMAVLGDGKVGKTAMTTQIAINQKNSDITVIYVLIAKRQRDVAQLVDRLEKNEAMHKAIIIVTNMFESLVTTYLAPYIGAAHGEYFWQKLAMDTLIIYDDLTSHAQAYREISLIAGVSPGRDSYPGDMFFTHSSLVERAGRLDRNGATQTILPIIYAPGGDITAYLPTNVMSMTDGQWILDTAIFKDTMKPAVSTGLSVTRVGGVGQNKRQKALAAALNKTLAGYRQAEEYAHFGTELSPEAQADYDKGKALFILMTQAIGEGYSLKDQQFLLDIVLNSQPDEKIDLQKMKSLVKDYSARLEEDKDLKGNYDQLRDELKTKVVIAGGKENKPGEKGGAVNGQEKPSTEKAEVGKDAGGAPEVGDKKDEEGDKK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
111 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
139 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
143 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
144 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
150 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.04
Nodule 0
Rhizoplane 0.75
Rhizosphere 82.09
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000282 3300001904 Bacteria 9322
2 JGI24740J21852_10002983 3300001979 Bacteria 7496
3 JGI24740J21852_10011974 3300001979 Bacteria 3284
4 JGI24739J22299_10003398 3300001989 Bacteria 6074
5 JGI24737J22298_10001760 3300001990 Bacteria 7741
6 JGI24735J21928_10000023 3300002067 Bacteria 96124
7 JGI24738J21930_10000703 3300002075 Bacteria 9648
8 rootH1_10003102 3300003316 Bacteria 65144
9 rootH1_10003102 3300003323 Bacteria 6079
10 rootL2_10086720 3300003322 Bacteria 17784
11 Ga0070658_10000009 3300005327 Bacteria 319868
12 Ga0070658_10000015 3300005327 Bacteria 230579
13 Ga0070658_10000061 3300005327 Bacteria 108607
14 Ga0070658_10000403 3300005327 Bacteria 37465
15 Ga0070658_10000447 3300005327 Bacteria 35694
16 Ga0070658_10003081 3300005327 Bacteria 13758
17 Ga0070658_10007958 3300005327 Bacteria 8530
18 Ga0070676_10012899 3300005328 Bacteria 4576
19 Ga0070683_100203310 3300005329 Bacteria 1881
20 Ga0070680_100001550 3300005336 Bacteria 16785
21 Ga0070680_100010789 3300005336 Bacteria 7053
22 Ga0070660_100000121 3300005339 Bacteria 49401
23 Ga0070660_100001371 3300005339 Bacteria 16539
24 Ga0070660_100037896 3300005339 Bacteria 3656
25 Ga0070691_10005270 3300005341 Bacteria 5872
26 Ga0070661_100020129 3300005344 Bacteria 4757
27 Ga0070661_100025270 3300005344 Bacteria 4268
28 Ga0070674_100073464 3300005356 Bacteria 2424
29 Ga0070673_100000373 3300005364 Bacteria 23472
30 Ga0070659_100001232 3300005366 Bacteria 18565
31 Ga0070659_100023651 3300005366 Bacteria 4704
32 Ga0070659_100038051 3300005366 Bacteria 3751
33 Ga0070678_100001558 3300005456 Bacteria 12268
34 Ga0070662_100027944 3300005457 Bacteria 3922
35 Ga0070681_10016020 3300005458 Bacteria 7474
36 Ga0070685_10000213 3300005466 Bacteria 38632
37 Ga0070685_10003592 3300005466 Bacteria 7873
38 Ga0070679_100002067 3300005530 Bacteria 18049
39 Ga0070679_100006339 3300005530 Bacteria 11015
40 Ga0070684_100014695 3300005535 Bacteria 6351
41 Ga0068853_100035335 3300005539 Bacteria 4245
42 Ga0070665_100009248 3300005548 Bacteria 9982
43 Ga0070665_100038875 3300005548 Bacteria 4784
44 Ga0068855_100000136 3300005563 Bacteria 93608
45 Ga0068855_100041725 3300005563 Bacteria 5437
46 Ga0070664_100000188 3300005564 Bacteria 43726
47 Ga0068857_100001220 3300005577 Bacteria 20028
48 Ga0068857_100007049 3300005577 Bacteria 9675
49 Ga0068857_100057044 3300005577 Bacteria 3466
50 Ga0068856_100000037 3300005614 Bacteria 120033
51 Ga0068856_100004541 3300005614 Bacteria 13800
52 Ga0068856_100004566 3300005614 Bacteria 13757
53 Ga0068856_100004747 3300005614 Bacteria 13490
54 Ga0068856_100010289 3300005614 Bacteria 9093
55 Ga0068852_100000011 3300005616 Bacteria 141147
56 Ga0068863_100031923 3300005841 Bacteria 5024
57 Ga0068863_100053770 3300005841 Unclassified 3817
58 Ga0068863_100107046 3300005841 Bacteria 2660
59 Ga0068858_100061508 3300005842 Unclassified 3472
60 Ga0068860_100063971 3300005843 Unclassified 3494
61 Ga0081455_10000001 3300005937 Bacteria 603871
62 Ga0081539_10029899 3300005985 Unclassified 3393
63 Ga0081539_10051981 3300005985 Unclassified 2305
64 Ga0075365_10000001 3300006038 Bacteria 371589
65 Ga0075365_10000060 3300006038 Bacteria 32892
66 Ga0075365_10000645 3300006038 Bacteria 13843
67 Ga0075368_10000728 3300006042 Bacteria 10070
68 Ga0075364_10005728 3300006051 Bacteria 7243
69 Ga0075364_10006948 3300006051 Bacteria 6686
70 Ga0075362_10012955 3300006177 Bacteria 3326
71 Ga0075367_10001062 3300006178 Bacteria 11348
72 Ga0075369_10019380 3300006186 Bacteria 2777
73 Ga0068871_100013656 3300006358 Bacteria 6033
74 Ga0068865_100000649 3300006881 Bacteria 19651
75 Ga0105240_10000003 3300009093 Bacteria 1183681
76 Ga0105240_10000048 3300009093 Bacteria 237451
77 Ga0105240_10001876 3300009093 Bacteria 34950
78 Ga0105240_10018131 3300009093 Bacteria 9464
79 Ga0105245_10000001 3300009098 Bacteria 939270
80 Ga0105245_10000034 3300009098 Bacteria 147951
81 Ga0105245_10013008 3300009098 Bacteria 7253
82 Ga0105245_10068241 3300009098 Bacteria 3222
83 Ga0105243_10000001 3300009148 Bacteria 1156578
84 Ga0105243_10014857 3300009148 Bacteria 5891
85 Ga0105241_10008471 3300009174 Bacteria 7563
86 Ga0105242_10000001 3300009176 Bacteria 574039
87 Ga0105248_10095103 3300009177 Unclassified 3355
88 Ga0105237_10000592 3300009545 Bacteria 50554
89 Ga0105237_10004094 3300009545 Bacteria 17005
90 Ga0105238_10002003 3300009551 Bacteria 20531
91 Ga0105238_10053065 3300009551 Bacteria 4075
92 Ga0105032_100822 3300009979 Bacteria 2933
93 Ga0105028_100391 3300009993 Bacteria 4697
94 Ga0105239_10000599 3300010375 Bacteria 51463
95 Ga0105239_10026925 3300010375 Bacteria 6328
96 Ga0105239_10038448 3300010375 Bacteria 5244
97 Ga0105239_10067471 3300010375 Unclassified 3929
98 Ga0105239_10200892 3300010375 Bacteria 2233
99 Ga0105246_10001296 3300011119 Bacteria 14678
100 Ga0105246_10023722 3300011119 Bacteria 3973
101 Ga0105246_10027963 3300011119 Bacteria 3701
102 Ga0157373_10001993 3300013100 Bacteria 15488
103 Ga0157373_10028210 3300013100 Bacteria 4050
104 Ga0157373_10036095 3300013100 Bacteria 3549
105 Ga0157373_10036539 3300013100 Unclassified 3525
106 Ga0157371_10008961 3300013102 Bacteria 7915
107 Ga0157371_10014297 3300013102 Bacteria 5995
108 Ga0157370_10000167 3300013104 Bacteria 81012
109 Ga0157370_10092223 3300013104 Bacteria 2843
110 Ga0157370_10275041 3300013104 Bacteria 1556
111 Ga0157369_10000026 3300013105 Bacteria 216023
112 Ga0157369_10000907 3300013105 Bacteria 37855
113 Ga0157369_10002222 3300013105 Bacteria 23372
114 Ga0157369_10014282 3300013105 Bacteria 8970
115 Ga0157374_10000269 3300013296 Bacteria 48118
116 Ga0157374_10004883 3300013296 Bacteria 11250
117 Ga0157374_10071774 3300013296 Bacteria 3266
118 Ga0157377_10000804 3300014745 Bacteria 12974
119 Ga0157376_10000001 3300014969 Bacteria 842910
120 Ga0157376_10000048 3300014969 Bacteria 104937
121 Ga0157376_10004708 3300014969 Bacteria 9511
122 Ga0207647_10002533 3300025904 Bacteria 13840
123 Ga0207647_10002818 3300025904 Bacteria 13115
124 Ga0207645_10014301 3300025907 Bacteria 5314
125 Ga0207705_10000010 3300025909 Bacteria 518023
126 Ga0207705_10000011 3300025909 Bacteria 517768
127 Ga0207705_10000202 3300025909 Bacteria 60086
128 Ga0207705_10000264 3300025909 Bacteria 50559
129 Ga0207705_10002925 3300025909 Bacteria 13054
130 Ga0207705_10010626 3300025909 Bacteria 6688
131 Ga0207705_10013553 3300025909 Bacteria 5884
132 Ga0207654_10007424 3300025911 Bacteria 5521
133 Ga0207707_10037410 3300025912 Bacteria 4242
134 Ga0207695_10000005 3300025913 Bacteria 1196715
135 Ga0207695_10001692 3300025913 Bacteria 35397
136 Ga0207695_10005280 3300025913 Bacteria 17222
137 Ga0207695_10024026 3300025913 Bacteria 6871
138 Ga0207671_10000014 3300025914 Bacteria 461481
139 Ga0207671_10003404 3300025914 Bacteria 15903
140 Ga0207660_10004945 3300025917 Bacteria 8686
141 Ga0207657_10001384 3300025919 Bacteria 25874
142 Ga0207657_10025579 3300025919 Bacteria 5440
143 Ga0207657_10030206 3300025919 Bacteria 4922
144 Ga0207649_10009627 3300025920 Bacteria 5291
145 Ga0207652_10007158 3300025921 Bacteria 8998
146 Ga0207652_10010494 3300025921 Bacteria 7456
147 Ga0207694_10002182 3300025924 Bacteria 16075
148 Ga0207687_10000001 3300025927 Bacteria 1130810
149 Ga0207687_10000004 3300025927 Bacteria 841177
150 Ga0207687_10000101 3300025927 Bacteria 62126
151 Ga0207687_10009158 3300025927 Bacteria 6476
152 Ga0207690_10000679 3300025932 Bacteria 21792
153 Ga0207690_10005998 3300025932 Bacteria 7199
154 Ga0207690_10015967 3300025932 Bacteria 4561
155 Ga0207706_10000004 3300025933 Bacteria 280765
156 Ga0207686_10000001 3300025934 Bacteria 1169580
157 Ga0207709_10000002 3300025935 Bacteria 1171536
158 Ga0207704_10000675 3300025938 Bacteria 15107
159 Ga0207679_10000074 3300025945 Bacteria 89341
160 Ga0207667_10000060 3300025949 Bacteria 192320
161 Ga0207651_10000740 3300025960 Bacteria 13995
162 Ga0207658_10000003 3300025986 Bacteria 1151934
163 Ga0207658_10013075 3300025986 Bacteria 5669
164 Ga0207703_10047632 3300026035 Unclassified 3457
165 Ga0207702_10000001 3300026078 Bacteria 895738
166 Ga0207702_10000051 3300026078 Bacteria 139040
167 Ga0207702_10000234 3300026078 Bacteria 64274
168 Ga0207702_10002414 3300026078 Bacteria 17778
169 Ga0207702_10033256 3300026078 Bacteria 4306
170 Ga0207641_10025619 3300026088 Unclassified 4862
171 Ga0207674_10000015 3300026116 Bacteria 183445
172 Ga0207674_10000032 3300026116 Bacteria 142389
173 Ga0207683_10001654 3300026121 Bacteria 19947
174 Ga0207698_10000024 3300026142 Bacteria 123946
175 Ga0209813_10002433 3300027866 Bacteria 4261
176 Ga0209974_10000507 3300027876 Bacteria 13004
177 Ga0268266_10003987 3300028379 Bacteria 14310
178 Ga0268264_10009487 3300028381 Bacteria 8059
179 Ga0265334_10000059 3300028573 Bacteria 79953
180 Ga0265338_10000313 3300028800 Bacteria 87846
181 Ga0265338_10000427 3300028800 Bacteria 75518
182 Ga0265338_10001232 3300028800 Bacteria 42281
183 Ga0265338_10001347 3300028800 Bacteria 40020
184 Ga0265338_10004969 3300028800 Bacteria 17608
185 Ga0265338_10008701 3300028800 Bacteria 12272
186 Ga0265338_10010423 3300028800 Bacteria 10904
187 Ga0265338_10014402 3300028800 Bacteria 8802
188 Ga0265324_10002783 3300029957 Bacteria 8659
189 Ga0265324_10012210 3300029957 Unclassified 3249
190 Ga0265332_10023157 3300031238 Bacteria 2739
191 Ga0265340_10000377 3300031247 Bacteria 23690
192 Ga0265327_10002613 3300031251 Bacteria 18624
193 Ga0265327_10005620 3300031251 Bacteria 10383
194 Ga0265316_10126899 3300031344 Unclassified 1923
195 Ga0307516_10003489 3300031730 Bacteria 20125
196 Ga0307406_10000001 3300031901 Bacteria 638191
197 Ga0307406_10000192 3300031901 Bacteria 36307
198 Ga0395899_0005177 3300037312 Bacteria 10148
199 Ga0395899_0016404 3300037312 Bacteria 5646
200 Ga0395900_0000001 3300037418 Bacteria 931146
201 Ga0395900_0028059 3300037418 Bacteria 5763
202 Ga0395898_0000002 3300037466 Bacteria 931013
203 Ga0395898_0006423 3300037466 Bacteria 12556
204 Ga0395898_0102291 3300037466 Bacteria 2750
205 Ga0395905_0009026 3300037471 Bacteria 9782
206 Ga0395905_0012827 3300037471 Bacteria 8058
207 Ga0395905_0120525 3300037471 Bacteria 2466
208 Ga0395901_0000006 3300038443 Bacteria 514112
209 Ga0395901_0001031 3300038443 Bacteria 30174
210 Ga0395901_0021768 3300038443 Bacteria 6570
211 Ga0395901_0024829 3300038443 Bacteria 6152
212 Ga0395901_0038813 3300038443 Bacteria 4925
213 Ga0395901_0046493 3300038443 Unclassified 4509
214 Ga0395901_0090638 3300038443 Bacteria 3200
215 Ga0439461_0000718 3300041410 Bacteria 4823
216 Ga0439464_0000003 3300042439 Bacteria 47582
217 Ga0466963_0039381 3300044694 Bacteria 3095
218 Ga0495671_0042828 3300046692 Bacteria 2274
219 Ga0495660_0000005 3300046810 Bacteria 574567
220 Ga0495672_0000010 3300047320 Bacteria 545038
221 Ga0495672_0020113 3300047320 Unclassified 4383
222 Ga0496112_0037951 3300048915 Unclassified 4704
223 Ga0496115_0000001 3300048918 Bacteria 367230
224 Ga0501032_0070869 3300049569 Bacteria 2324
225 Ga0501034_0000170 3300049571 Bacteria 120823
226 Ga0501034_0009486 3300049571 Bacteria 10187
227 Ga0501034_0048201 3300049571 Bacteria 4300
228 Ga0501034_0197844 3300049571 Bacteria 1969
229 Ga0501037_0000011 3300049573 Bacteria 196525
230 Ga0501037_0015630 3300049573 Bacteria 5587
231 Ga0501047_0000057 3300049581 Bacteria 140059
232 Ga0501048_0011778 3300049582 Bacteria 6518
233 Ga0501073_0124318 3300049589 Bacteria 1788
234 Ga0501080_0000114 3300049742 Bacteria 55765
235 Ga0501035_0000005 3300049822 Bacteria 392980
236 Ga0501044_0118630 3300049823 Bacteria 2648
237 nmdc:mga03683_2137_c2 3300050489 Bacteria 3833
238 nmdc:mga00v17_59618_c1 3300050491 Bacteria 2342
239 nmdc:mga00v17_761_c1 3300050491 Bacteria 17489
240 nmdc:mga0yw44_1005_c1 3300050492 Bacteria 10786
241 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
242 nmdc:mga0yw44_34_c1 3300050492 Bacteria 48269
243 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
244 nmdc:mga04h51_7458_c1 3300050495 Bacteria 2888
245 nmdc:mga07m45_47437_c1 3300050496 Bacteria 2415
246 Ga0500643_000202 3300053087 Bacteria 56591
247 Ga0500643_000264 3300053087 Bacteria 46383
248 Ga0500644_0004013 3300053088 Bacteria 3663
249 Ga0500646_0000002 3300053090 Bacteria 178770
250 Ga0500646_0002145 3300053090 Bacteria 5143
251 Ga0500583_0000401 3300053092 Bacteria 13856
252 Ga0500651_0000017 3300053093 Bacteria 156318
253 Ga0500651_0000220 3300053093 Bacteria 35794
254 Ga0500651_0010643 3300053093 Bacteria 5525
255 Ga0500641_0000001 3300053096 Bacteria 1115973
256 Ga0500650_0000001 3300053098 Bacteria 818797
257 Ga0500556_0000475 3300053104 Bacteria 28131
258 Ga0500562_000001 3300053108 Bacteria 1178987
259 Ga0500594_0000001 3300053118 Bacteria 1178472
260 Ga0500614_000265 3300053123 Bacteria 13520
261 Ga0500652_000001 3300053131 Bacteria 946868
262 Ga0500655_000649 3300053133 Bacteria 6943
263 Ga0500655_001407 3300053133 Bacteria 4561
264 Ga0500568_0008335 3300053139 Bacteria 5007
265 Ga0500577_0001159 3300053142 Bacteria 6742
266 Ga0500579_000849 3300053143 Bacteria 17560
267 Ga0500616_0004458 3300053153 Bacteria 9968
268 Ga0500627_0087153 3300053158 Bacteria 1396
269 Ga0500633_0002288 3300053160 Bacteria 3904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0087153 Ga0500627_0087153_122_1366 389
2 3300046692 Ga0495671_0042828 Ga0495671_0042828_808_2187 418
3 3300049589 Ga0501073_0124318 Ga0501073_0124318_372_1766 455
4 3300025921 Ga0207652_10010494 Ga0207652_100104947 456
5 3300049569 Ga0501032_0070869 Ga0501032_0070869_121_1611 464
6 3300049571 Ga0501034_0048201 Ga0501034_0048201_831_2321 464
7 3300049573 Ga0501037_0015630 Ga0501037_0015630_682_2172 464
8 3300049581 Ga0501047_0000057 Ga0501047_0000057_44243_45733 464
9 3300049582 Ga0501048_0011778 Ga0501048_0011778_276_1766 464
10 3300049822 Ga0501035_0000005 Ga0501035_0000005_340369_341859 464
11 3300049823 Ga0501044_0118630 Ga0501044_0118630_534_2024 464
12 3300053087 Ga0500643_000264 Ga0500643_000264_9410_11176 466
13 3300005339 Ga0070660_100000121 Ga0070660_10000012115 469
14 3300005327 Ga0070658_10000015 Ga0070658_10000015256 470
15 3300025909 Ga0207705_10000011 Ga0207705_1000001189 470
16 3300028800 Ga0265338_10001347 Ga0265338_1000134721 470
17 3300029957 Ga0265324_10012210 Ga0265324_100122103 470
18 3300031344 Ga0265316_10126899 Ga0265316_101268991 470
19 3300005327 Ga0070658_10007958 Ga0070658_100079585 471
20 3300025909 Ga0207705_10010626 Ga0207705_100106265 471
21 3300048918 Ga0496115_0000001 Ga0496115_0000001_179758_181377 471
22 3300053133 Ga0500655_001407 Ga0500655_001407_1668_3278 471
23 3300006038 Ga0075365_10000001 Ga0075365_10000001152 472
24 3300028800 Ga0265338_10000313 Ga0265338_1000031338 472
25 3300028800 Ga0265338_10004969 Ga0265338_100049699 472
26 3300044694 Ga0466963_0039381 Ga0466963_0039381_602_2020 472
27 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_232421_233845 472
28 3300005841 Ga0068863_100053770 Ga0068863_1000537704 473
29 3300005841 Ga0068863_100107046 Ga0068863_1001070462 473
30 3300005842 Ga0068858_100061508 Ga0068858_1000615083 473
31 3300009093 Ga0105240_10000048 Ga0105240_10000048141 473
32 3300013105 Ga0157369_10002222 Ga0157369_100022223 473
33 3300025909 Ga0207705_10002925 Ga0207705_1000292513 473
34 3300025913 Ga0207695_10001692 Ga0207695_1000169212 473
35 3300026035 Ga0207703_10047632 Ga0207703_100476322 473
36 3300031901 Ga0307406_10000001 Ga0307406_10000001460 473
37 3300049571 Ga0501034_0009486 Ga0501034_0009486_2958_4538 473
38 3300005327 Ga0070658_10000447 Ga0070658_1000044722 474
39 3300005336 Ga0070680_100001550 Ga0070680_10000155010 474
40 3300005530 Ga0070679_100006339 Ga0070679_1000063394 474
41 3300005535 Ga0070684_100014695 Ga0070684_1000146953 474
42 3300005563 Ga0068855_100041725 Ga0068855_1000417254 474
43 3300005985 Ga0081539_10051981 Ga0081539_100519812 474
44 3300009093 Ga0105240_10018131 Ga0105240_100181319 474
45 3300009148 Ga0105243_10014857 Ga0105243_100148575 474
46 3300009545 Ga0105237_10000592 Ga0105237_1000059231 474
47 3300009551 Ga0105238_10002003 Ga0105238_100020035 474
48 3300013104 Ga0157370_10275041 Ga0157370_102750412 474
49 3300025913 Ga0207695_10024026 Ga0207695_100240265 474
50 3300025914 Ga0207671_10000014 Ga0207671_10000014507 474
51 3300025919 Ga0207657_10025579 Ga0207657_100255793 474
52 3300025919 Ga0207657_10030206 Ga0207657_100302062 474
53 3300025924 Ga0207694_10002182 Ga0207694_100021829 474
54 3300028573 Ga0265334_10000059 Ga0265334_1000005951 474
55 3300028800 Ga0265338_10001232 Ga0265338_1000123213 474
56 3300031247 Ga0265340_10000377 Ga0265340_1000037714 474
57 3300031251 Ga0265327_10002613 Ga0265327_1000261316 474
58 3300031730 Ga0307516_10003489 Ga0307516_100034897 474
59 3300037471 Ga0395905_0120525 Ga0395905_0120525_205_1629 474
60 3300047320 Ga0495672_0020113 Ga0495672_0020113_2570_4000 474
61 3300049742 Ga0501080_0000114 Ga0501080_0000114_22698_24125 474
62 3300053093 Ga0500651_0000017 Ga0500651_0000017_16647_18377 474
63 3300053108 Ga0500562_000001 Ga0500562_000001_1169834_1171258 474
64 3300053123 Ga0500614_000265 Ga0500614_000265_6869_8599 474
65 3300053133 Ga0500655_000649 Ga0500655_000649_2932_4356 474
66 3300053139 Ga0500568_0008335 Ga0500568_0008335_2048_3472 474
67 3300005577 Ga0068857_100057044 Ga0068857_1000570442 475
68 3300006038 Ga0075365_10000645 Ga0075365_100006455 475
69 3300006051 Ga0075364_10005728 Ga0075364_100057285 475
70 3300009098 Ga0105245_10068241 Ga0105245_100682414 475
71 3300027876 Ga0209974_10000507 Ga0209974_100005075 475
72 3300028800 Ga0265338_10010423 Ga0265338_100104234 475
73 3300028800 Ga0265338_10014402 Ga0265338_100144021 475
74 3300038443 Ga0395901_0021768 Ga0395901_0021768_3725_5155 475
75 3300053093 Ga0500651_0000220 Ga0500651_0000220_33295_34725 475
76 3300005344 Ga0070661_100025270 Ga0070661_1000252704 476
77 3300005366 Ga0070659_100038051 Ga0070659_1000380513 476
78 3300005564 Ga0070664_100000188 Ga0070664_10000018846 476
79 3300006881 Ga0068865_100000649 Ga0068865_10000064917 476
80 3300011119 Ga0105246_10027963 Ga0105246_100279633 476
81 3300053093 Ga0500651_0010643 Ga0500651_0010643_2324_4078 476
82 3300005458 Ga0070681_10016020 Ga0070681_100160204 477
83 3300005614 Ga0068856_100004541 Ga0068856_1000045414 477
84 3300005937 Ga0081455_10000001 Ga0081455_10000001653 477
85 3300009093 Ga0105240_10000003 Ga0105240_10000003401 477
86 3300009098 Ga0105245_10000034 Ga0105245_1000003464 477
87 3300009098 Ga0105245_10013008 Ga0105245_100130088 477
88 3300009148 Ga0105243_10000001 Ga0105243_10000001849 477
89 3300009176 Ga0105242_10000001 Ga0105242_10000001410 477
90 3300009545 Ga0105237_10004094 Ga0105237_100040945 477
91 3300010375 Ga0105239_10000599 Ga0105239_1000059951 477
92 3300010375 Ga0105239_10026925 Ga0105239_100269256 477
93 3300014969 Ga0157376_10000001 Ga0157376_10000001499 477
94 3300025904 Ga0207647_10002818 Ga0207647_1000281812 477
95 3300025912 Ga0207707_10037410 Ga0207707_100374103 477
96 3300025913 Ga0207695_10000005 Ga0207695_10000005409 477
97 3300025914 Ga0207671_10003404 Ga0207671_100034045 477
98 3300025920 Ga0207649_10009627 Ga0207649_100096272 477
99 3300025927 Ga0207687_10000101 Ga0207687_1000010141 477
100 3300025932 Ga0207690_10015967 Ga0207690_100159674 477
101 3300025934 Ga0207686_10000001 Ga0207686_10000001292 477
102 3300025935 Ga0207709_10000002 Ga0207709_10000002409 477
103 3300025938 Ga0207704_10000675 Ga0207704_1000067511 477
104 3300025945 Ga0207679_10000074 Ga0207679_100000749 477
105 3300026078 Ga0207702_10000051 Ga0207702_10000051166 477
106 3300037312 Ga0395899_0005177 Ga0395899_0005177_6124_7680 477
107 3300037418 Ga0395900_0000001 Ga0395900_0000001_498857_500413 477
108 3300037466 Ga0395898_0000002 Ga0395898_0000002_605593_607149 477
109 3300038443 Ga0395901_0000006 Ga0395901_0000006_251269_252825 477
110 3300038443 Ga0395901_0024829 Ga0395901_0024829_4438_6090 477
111 3300047320 Ga0495672_0000010 Ga0495672_0000010_455957_457669 477
112 3300053087 Ga0500643_000202 Ga0500643_000202_44609_46093 477
113 3300001979 JGI24740J21852_10002983 JGI24740J21852_100029836 478
114 3300001979 JGI24740J21852_10011974 JGI24740J21852_100119743 478
115 3300001989 JGI24739J22299_10003398 JGI24739J22299_100033984 478
116 3300001990 JGI24737J22298_10001760 JGI24737J22298_100017605 478
117 3300002067 JGI24735J21928_10000023 JGI24735J21928_1000002320 478
118 3300002075 JGI24738J21930_10000703 JGI24738J21930_100007038 478
119 3300003322 rootL2_10086720 rootL2_1008672011 478
120 3300005327 Ga0070658_10000009 Ga0070658_10000009136 478
121 3300005327 Ga0070658_10000061 Ga0070658_1000006111 478
122 3300005327 Ga0070658_10003081 Ga0070658_100030817 478
123 3300005328 Ga0070676_10012899 Ga0070676_100128994 478
124 3300005329 Ga0070683_100203310 Ga0070683_1002033102 478
125 3300005339 Ga0070660_100001371 Ga0070660_1000013713 478
126 3300005339 Ga0070660_100037896 Ga0070660_1000378962 478
127 3300005341 Ga0070691_10005270 Ga0070691_100052702 478
128 3300005344 Ga0070661_100020129 Ga0070661_1000201293 478
129 3300005356 Ga0070674_100073464 Ga0070674_1000734641 478
130 3300005364 Ga0070673_100000373 Ga0070673_10000037313 478
131 3300005366 Ga0070659_100001232 Ga0070659_1000012325 478
132 3300005366 Ga0070659_100023651 Ga0070659_1000236513 478
133 3300005456 Ga0070678_100001558 Ga0070678_1000015589 478
134 3300005457 Ga0070662_100027944 Ga0070662_1000279443 478
135 3300005466 Ga0070685_10000213 Ga0070685_1000021327 478
136 3300005548 Ga0070665_100009248 Ga0070665_1000092489 478
137 3300005563 Ga0068855_100000136 Ga0068855_1000001363 478
138 3300005577 Ga0068857_100001220 Ga0068857_10000122020 478
139 3300005577 Ga0068857_100007049 Ga0068857_1000070497 478
140 3300005614 Ga0068856_100004566 Ga0068856_1000045664 478
141 3300005614 Ga0068856_100004747 Ga0068856_10000474714 478
142 3300005616 Ga0068852_100000011 Ga0068852_100000011163 478
143 3300005985 Ga0081539_10029899 Ga0081539_100298992 478
144 3300006038 Ga0075365_10000060 Ga0075365_1000006010 478
145 3300006358 Ga0068871_100013656 Ga0068871_1000136565 478
146 3300009174 Ga0105241_10008471 Ga0105241_100084715 478
147 3300009177 Ga0105248_10095103 Ga0105248_100951033 478
148 3300009551 Ga0105238_10053065 Ga0105238_100530653 478
149 3300010375 Ga0105239_10067471 Ga0105239_100674714 478
150 3300011119 Ga0105246_10001296 Ga0105246_100012963 478
151 3300011119 Ga0105246_10023722 Ga0105246_100237222 478
152 3300013100 Ga0157373_10001993 Ga0157373_100019935 478
153 3300013100 Ga0157373_10036095 Ga0157373_100360952 478
154 3300013100 Ga0157373_10036539 Ga0157373_100365393 478
155 3300013102 Ga0157371_10008961 Ga0157371_100089615 478
156 3300013102 Ga0157371_10014297 Ga0157371_100142974 478
157 3300013104 Ga0157370_10000167 Ga0157370_1000016756 478
158 3300013104 Ga0157370_10092223 Ga0157370_100922233 478
159 3300013105 Ga0157369_10000026 Ga0157369_10000026181 478
160 3300013105 Ga0157369_10000907 Ga0157369_1000090710 478
161 3300013296 Ga0157374_10000269 Ga0157374_1000026921 478
162 3300013296 Ga0157374_10071774 Ga0157374_100717742 478
163 3300014745 Ga0157377_10000804 Ga0157377_100008043 478
164 3300014969 Ga0157376_10000048 Ga0157376_1000004840 478
165 3300014969 Ga0157376_10004708 Ga0157376_100047088 478
166 3300025904 Ga0207647_10002533 Ga0207647_100025337 478
167 3300025907 Ga0207645_10014301 Ga0207645_100143012 478
168 3300025909 Ga0207705_10000010 Ga0207705_10000010390 478
169 3300025909 Ga0207705_10000264 Ga0207705_1000026411 478
170 3300025909 Ga0207705_10013553 Ga0207705_100135533 478
171 3300025911 Ga0207654_10007424 Ga0207654_100074244 478
172 3300025919 Ga0207657_10001384 Ga0207657_1000138425 478
173 3300025927 Ga0207687_10009158 Ga0207687_100091581 478
174 3300025932 Ga0207690_10000679 Ga0207690_100006799 478
175 3300025932 Ga0207690_10005998 Ga0207690_100059987 478
176 3300025933 Ga0207706_10000004 Ga0207706_10000004145 478
177 3300025949 Ga0207667_10000060 Ga0207667_1000006059 478
178 3300025960 Ga0207651_10000740 Ga0207651_100007402 478
179 3300025986 Ga0207658_10013075 Ga0207658_100130753 478
180 3300026078 Ga0207702_10000234 Ga0207702_100002344 478
181 3300026078 Ga0207702_10033256 Ga0207702_100332564 478
182 3300026116 Ga0207674_10000015 Ga0207674_100000155 478
183 3300026116 Ga0207674_10000032 Ga0207674_10000032161 478
184 3300026121 Ga0207683_10001654 Ga0207683_1000165415 478
185 3300026142 Ga0207698_10000024 Ga0207698_100000249 478
186 3300037312 Ga0395899_0016404 Ga0395899_0016404_1001_2623 478
187 3300037418 Ga0395900_0028059 Ga0395900_0028059_3711_5264 478
188 3300037466 Ga0395898_0006423 Ga0395898_0006423_2298_3851 478
189 3300037466 Ga0395898_0102291 Ga0395898_0102291_129_1751 478
190 3300037471 Ga0395905_0009026 Ga0395905_0009026_7344_8966 478
191 3300038443 Ga0395901_0038813 Ga0395901_0038813_1112_2734 478
192 3300038443 Ga0395901_0090638 Ga0395901_0090638_688_2244 478
193 3300042439 Ga0439464_0000003 Ga0439464_0000003_14646_16202 478
194 3300050491 nmdc:mga00v17_59618_c1 nmdc:mga00v17_59618_c1_360_1844 478
195 3300050492 nmdc:mga0yw44_1005_c1 nmdc:mga0yw44_1005_c1_9147_10631 478
196 3300050492 nmdc:mga0yw44_34_c1 nmdc:mga0yw44_34_c1_23577_25139 478
197 3300050496 nmdc:mga07m45_47437_c1 nmdc:mga07m45_47437_c1_772_2328 478
198 3300053088 Ga0500644_0004013 Ga0500644_0004013_944_2506 478
199 3300053104 Ga0500556_0000475 Ga0500556_0000475_12020_13630 478
200 3300053143 Ga0500579_000849 Ga0500579_000849_65_1717 478
201 3300053153 Ga0500616_0004458 Ga0500616_0004458_1174_2736 478
202 3300003316 rootH1_10003102 rootH1_1000310224 479
203 3300005539 Ga0068853_100035335 Ga0068853_1000353352 479
204 3300005843 Ga0068860_100063971 Ga0068860_1000639713 479
205 3300009993 Ga0105028_100391 Ga0105028_1003913 479
206 3300010375 Ga0105239_10038448 Ga0105239_100384485 479
207 3300010375 Ga0105239_10200892 Ga0105239_102008922 479
208 3300013105 Ga0157369_10014282 Ga0157369_100142829 479
209 3300013296 Ga0157374_10004883 Ga0157374_100048833 479
210 3300025986 Ga0207658_10000003 Ga0207658_10000003840 479
211 3300028381 Ga0268264_10009487 Ga0268264_100094872 479
212 3300031901 Ga0307406_10000192 Ga0307406_1000019228 479
213 3300038443 Ga0395901_0001031 Ga0395901_0001031_2549_4198 479
214 3300049571 Ga0501034_0197844 Ga0501034_0197844_216_1739 479
215 3300001904 JGI24736J21556_1000282 JGI24736J21556_100028213 480
216 3300005327 Ga0070658_10000403 Ga0070658_1000040321 480
217 3300005336 Ga0070680_100010789 Ga0070680_1000107892 480
218 3300005466 Ga0070685_10003592 Ga0070685_100035928 480
219 3300005530 Ga0070679_100002067 Ga0070679_10000206723 480
220 3300005548 Ga0070665_100038875 Ga0070665_1000388754 480
221 3300005614 Ga0068856_100000037 Ga0068856_10000003750 480
222 3300005614 Ga0068856_100010289 Ga0068856_1000102897 480
223 3300005841 Ga0068863_100031923 Ga0068863_1000319232 480
224 3300006042 Ga0075368_10000728 Ga0075368_100007286 480
225 3300006051 Ga0075364_10006948 Ga0075364_100069487 480
226 3300006177 Ga0075362_10012955 Ga0075362_100129553 480
227 3300006178 Ga0075367_10001062 Ga0075367_100010627 480
228 3300006186 Ga0075369_10019380 Ga0075369_100193802 480
229 3300009093 Ga0105240_10001876 Ga0105240_1000187629 480
230 3300009098 Ga0105245_10000001 Ga0105245_10000001581 480
231 3300009979 Ga0105032_100822 Ga0105032_1008223 480
232 3300013100 Ga0157373_10028210 Ga0157373_100282104 480
233 3300025909 Ga0207705_10000202 Ga0207705_1000020234 480
234 3300025913 Ga0207695_10005280 Ga0207695_1000528015 480
235 3300025917 Ga0207660_10004945 Ga0207660_100049453 480
236 3300025921 Ga0207652_10007158 Ga0207652_1000715810 480
237 3300025927 Ga0207687_10000001 Ga0207687_10000001143 480
238 3300025927 Ga0207687_10000004 Ga0207687_10000004690 480
239 3300026078 Ga0207702_10000001 Ga0207702_10000001475 480
240 3300026078 Ga0207702_10002414 Ga0207702_1000241413 480
241 3300026088 Ga0207641_10025619 Ga0207641_100256192 480
242 3300027866 Ga0209813_10002433 Ga0209813_100024333 480
243 3300028379 Ga0268266_10003987 Ga0268266_100039878 480
244 3300028800 Ga0265338_10000427 Ga0265338_1000042720 480
245 3300028800 Ga0265338_10008701 Ga0265338_100087012 480
246 3300029957 Ga0265324_10002783 Ga0265324_1000278310 480
247 3300031238 Ga0265332_10023157 Ga0265332_100231572 480
248 3300031251 Ga0265327_10005620 Ga0265327_1000562011 480
249 3300037471 Ga0395905_0012827 Ga0395905_0012827_5831_7495 480
250 3300038443 Ga0395901_0046493 Ga0395901_0046493_222_1790 480
251 3300041410 Ga0439461_0000718 Ga0439461_0000718_674_2233 480
252 3300046810 Ga0495660_0000005 Ga0495660_0000005_458877_460448 480
253 3300048915 Ga0496112_0037951 Ga0496112_0037951_1612_3270 480
254 3300049571 Ga0501034_0000170 Ga0501034_0000170_14571_16136 480
255 3300049573 Ga0501037_0000011 Ga0501037_0000011_119040_120605 480
256 3300050489 nmdc:mga03683_2137_c2 nmdc:mga03683_2137_c2_1577_3136 480
257 3300050491 nmdc:mga00v17_761_c1 nmdc:mga00v17_761_c1_2385_3944 480
258 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_26868_28427 480
259 3300050495 nmdc:mga04h51_7458_c1 nmdc:mga04h51_7458_c1_762_2321 480
260 3300053090 Ga0500646_0000002 Ga0500646_0000002_116886_118451 480
261 3300053090 Ga0500646_0002145 Ga0500646_0002145_1069_2727 480
262 3300053092 Ga0500583_0000401 Ga0500583_0000401_5827_7392 480
263 3300053096 Ga0500641_0000001 Ga0500641_0000001_873242_874807 480
264 3300053098 Ga0500650_0000001 Ga0500650_0000001_128807_130465 480
265 3300053118 Ga0500594_0000001 Ga0500594_0000001_793605_795263 480
266 3300053131 Ga0500652_000001 Ga0500652_000001_616206_617771 480
267 3300053142 Ga0500577_0001159 Ga0500577_0001159_4840_6498 480
268 3300053160 Ga0500633_0002288 Ga0500633_0002288_1081_2739 480

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00006

ATP-synt_ab

ATP synthase alpha/beta family, nucleotide-binding domain

136

350

0.97

PF00306

ATP-synt_ab_C

ATP synthase alpha/beta chain, C terminal domain

357

475

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q45-assembly1.cif.gz_B f1-atpase from fusobacterium nucleatum 0.9441 17 467
7xko-assembly1.cif.gz_C f1 domain of epsilon c-terminal domain deleted fof1 from bacillus ps3,state1,nucleotide depeleted 0.9416 15 467
6tt7-assembly1.cif.gz_B ovine atp synthase 1a state 0.938 15 467
8h9p-assembly1.cif.gz_A human atp synthase f1 domain, state 3b 0.9366 15 467
8f2k-assembly1.cif.gz_A structure of yeast f1-atpase determined with 100 micromolar cruentaren a 0.936 16 467
ID Description Score Start End Superfamily
af_A0A2P2CLF9_96_382_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.973 84 357 3.40.50.300
af_Q9XPJ9_41_108_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9539 16 80 2.40.30.20
af_A0A0R0JZ78_6_157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 210 353 3.40.50.300
af_A0A0G2K099_232_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9491 175 242 3.40.50.300
af_A4HSH2_53_455_3.40.50.12240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.941 34 409 3.40.50.12240
ID Description Score Start End GO Terms
AF-A0A251TKM2-F1-model_v4 ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain-containing protein (Putative ATPase, F1 complex, alpha subunit, P-loop containing nucleoside triphosphate hydrolase) 1 179 267 GO:0005524
GO:0005743
GO:0016787
GO:0045261
GO:0046933
AF-T1ACA0-F1-model_v4 ATP synthase F1 alpha subunit 0.9983 168 263 GO:0005524
GO:0043531
GO:0045261
GO:0046933
AF-A0A349PS19-F1-model_v4 F0F1 ATP synthase subunit alpha 0.9974 158 256 GO:0005524
GO:0043531
GO:0045261
GO:0046933
AF-U3RDH2-F1-model_v4 AtpA 0.9934 127 232 GO:0005524
GO:0043531
GO:0045261
GO:0046933
AF-A0A090R0L5-F1-model_v4 ATP synthase alpha chain (EC 3.6.3.14) 0.9881 119 243 GO:0005524
GO:0016787
GO:0043531
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
91.58 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map