F375317

General Info

Members Datasets Scaffolds Average Seq Length
268 147 536 551

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100015262|Ga0070713_1000152625
Length 532
Sequence MSSDAMAIHQGTDVGSRPWVETLHGWVTTVDHKRLGILYILYALLFLAVAGSEAMIIRIQLMYPHNSFVSPQVFNRIFTMHGTTMVFFVGIPVLFGLANYLVPLMIGARDMAFPRLNAFSFWLTALGGFLSGLYGAGNAPDVGWWAYAPLTSRAFSPGHSSDYWTISLLVAGFGSIGTAVNIIATILCMRCPGMKLSRMPLLVWLNLVVSGMVLIAITPLSAAQIMLCVDRYLGGHFFDTQAGGSATLWMHFFWIFGHPEVYILILPAFAVLSEVIPVFSRKPMFGYPVMVGATIAIGFISMSVWAHHMFSIGMSSYGNAFFVLTTMAIAVPTGIKIFNWLGTMWGGRIIFKTPMLFCIGFLFNFLIAGLTGIMLGSAAFNWQLLFGIFAAFYYWYPKITGRMLSERLGKLHFWLFFIGFHLCFDLMHIPGLLGMARRIYTYEPGRGWDTLNLLVSIGAFIQGIATLIFVANLIISYFKGAKAGNDPWDAWTLEWSVSSPPPAYNFAVTPTVASRRPLWDLKHPEDPDSRYE

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 2.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100015262 3300005436 Bacteria 5733
2 Ga0070658_10000007 3300005327 Bacteria 349444
3 Ga0070658_10003242 3300005327 Bacteria 13434
4 Ga0070658_10008988 3300005327 Bacteria 8032
5 Ga0070658_10022108 3300005327 Bacteria 5102
6 Ga0070676_10011722 3300005328 Bacteria 4772
7 Ga0070683_100006155 3300005329 Bacteria 10062
8 Ga0070683_100058433 3300005329 Bacteria 3583
9 Ga0070677_10022470 3300005333 Bacteria 2324
10 Ga0070666_10001174 3300005335 Bacteria 15897
11 Ga0068868_100040841 3300005338 Bacteria 3612
12 Ga0070660_100005968 3300005339 Bacteria 8418
13 Ga0070660_100013373 3300005339 Bacteria 5885
14 Ga0070660_100105736 3300005339 Bacteria 2234
15 Ga0070661_100010537 3300005344 Bacteria 6427
16 Ga0070659_100005637 3300005366 Bacteria 9003
17 Ga0070659_100009261 3300005366 Bacteria 7228
18 Ga0070659_100026437 3300005366 Bacteria 4467
19 Ga0070703_10010894 3300005406 Bacteria 2566
20 Ga0070713_100037209 3300005436 Bacteria 3934
21 Ga0070711_100001028 3300005439 Bacteria 14831
22 Ga0070711_100036773 3300005439 Bacteria 3282
23 Ga0070711_100046522 3300005439 Bacteria 2957
24 Ga0070694_100011276 3300005444 Bacteria 5534
25 Ga0070708_100100601 3300005445 Bacteria 2646
26 Ga0070708_100152093 3300005445 Bacteria 2153
27 Ga0070663_100033998 3300005455 Bacteria 3527
28 Ga0070678_100015313 3300005456 Bacteria 4870
29 Ga0070662_100001162 3300005457 Bacteria 16146
30 Ga0070662_100053908 3300005457 Bacteria 2913
31 Ga0070681_10015532 3300005458 Bacteria 7583
32 Ga0070706_100091125 3300005467 Bacteria 2827
33 Ga0070707_100002383 3300005468 Bacteria 17951
34 Ga0070707_100094811 3300005468 Bacteria 2890
35 Ga0070707_100119308 3300005468 Bacteria 2560
36 Ga0070707_100159400 3300005468 Bacteria 2198
37 Ga0070707_100190861 3300005468 Bacteria 1998
38 Ga0070684_100069501 3300005535 Bacteria 3097
39 Ga0070697_100008429 3300005536 Bacteria 8043
40 Ga0070697_100014271 3300005536 Bacteria 6243
41 Ga0070697_100017557 3300005536 Bacteria 5632
42 Ga0068853_100000049 3300005539 Bacteria 90347
43 Ga0068853_100077638 3300005539 Bacteria 2901
44 Ga0070695_100071757 3300005545 Bacteria 2269
45 Ga0070695_100090511 3300005545 Bacteria 2042
46 Ga0070696_100069467 3300005546 Bacteria 2475
47 Ga0070665_100195505 3300005548 Bacteria 2023
48 Ga0070704_100020891 3300005549 Bacteria 4233
49 Ga0068855_100005395 3300005563 Bacteria 15596
50 Ga0068855_100005881 3300005563 Bacteria 14962
51 Ga0068855_100019946 3300005563 Bacteria 8051
52 Ga0068855_100024184 3300005563 Bacteria 7272
53 Ga0068855_100027186 3300005563 Bacteria 6846
54 Ga0068855_100097590 3300005563 Bacteria 3385
55 Ga0068857_100151012 3300005577 Bacteria 2104
56 Ga0068854_100000129 3300005578 Bacteria 52076
57 Ga0068854_100008428 3300005578 Bacteria 6628
58 Ga0068859_100000002 3300005617 Bacteria 541370
59 Ga0068863_100002174 3300005841 Bacteria 19429
60 Ga0068863_100019961 3300005841 Bacteria 6408
61 Ga0068858_100085281 3300005842 Bacteria 2938
62 Ga0068860_100018079 3300005843 Bacteria 6865
63 Ga0068862_100146513 3300005844 Bacteria 2099
64 Ga0070717_10047953 3300006028 Bacteria 3502
65 Ga0070716_100002025 3300006173 Bacteria 9258
66 Ga0070712_100007992 3300006175 Bacteria 6633
67 Ga0097621_100034024 3300006237 Bacteria 4062
68 Ga0075428_100060737 3300006844 Bacteria 4139
69 Ga0075428_100144864 3300006844 Bacteria 2582
70 Ga0075433_10012715 3300006852 Bacteria 6811
71 Ga0075433_10049144 3300006852 Bacteria 3670
72 Ga0075434_100040838 3300006871 Bacteria 4595
73 Ga0075434_100046770 3300006871 Bacteria 4294
74 Ga0075434_100068963 3300006871 Bacteria 3524
75 Ga0075434_100075530 3300006871 Bacteria 3364
76 Ga0075434_100109544 3300006871 Bacteria 2772
77 Ga0075434_100167602 3300006871 Bacteria 2216
78 Ga0075436_100077856 3300006914 Bacteria 2297
79 Ga0097620_100000002 3300006931 Bacteria 541370
80 Ga0075435_100029165 3300007076 Bacteria 4329
81 Ga0099794_10001510 3300007265 Bacteria 8162
82 Ga0099794_10019550 3300007265 Bacteria 3054
83 Ga0099795_10001541 3300007788 Bacteria 5057
84 Ga0099795_10004406 3300007788 Bacteria 3629
85 Ga0105240_10001419 3300009093 Bacteria 41092
86 Ga0105240_10034276 3300009093 Bacteria 6550
87 Ga0105240_10050237 3300009093 Bacteria 5259
88 Ga0105240_10050413 3300009093 Bacteria 5249
89 Ga0105240_10051629 3300009093 Bacteria 5172
90 Ga0105240_10074566 3300009093 Bacteria 4188
91 Ga0105240_10100516 3300009093 Bacteria 3519
92 Ga0105245_10023545 3300009098 Bacteria 5406
93 Ga0105245_10057453 3300009098 Bacteria 3500
94 Ga0105247_10014208 3300009101 Bacteria 4777
95 Ga0114129_10000975 3300009147 Bacteria 37455
96 Ga0114129_10033895 3300009147 Bacteria 7213
97 Ga0114129_10213929 3300009147 Bacteria 2604
98 Ga0114129_10256804 3300009147 Bacteria 2344
99 Ga0114129_10307271 3300009147 Bacteria 2112
100 Ga0105241_10013634 3300009174 Bacteria 5956
101 Ga0105241_10019333 3300009174 Bacteria 5022
102 Ga0105248_10004373 3300009177 Bacteria 15637
103 Ga0105248_10100129 3300009177 Bacteria 3265
104 Ga0105237_10004050 3300009545 Bacteria 17101
105 Ga0105237_10098159 3300009545 Bacteria 2920
106 Ga0105238_10021368 3300009551 Bacteria 6593
107 Ga0105249_10194783 3300009553 Bacteria 1980
108 Ga0157373_10082103 3300013100 Bacteria 2272
109 Ga0157370_10005124 3300013104 Bacteria 14780
110 Ga0157370_10014347 3300013104 Bacteria 8104
111 Ga0157370_10015568 3300013104 Bacteria 7731
112 Ga0157370_10028580 3300013104 Bacteria 5483
113 Ga0157370_10057383 3300013104 Bacteria 3702
114 Ga0157369_10011621 3300013105 Bacteria 9998
115 Ga0157369_10011737 3300013105 Bacteria 9946
116 Ga0157369_10012470 3300013105 Bacteria 9645
117 Ga0157369_10018923 3300013105 Bacteria 7716
118 Ga0157369_10021042 3300013105 Bacteria 7292
119 Ga0157369_10023295 3300013105 Bacteria 6897
120 Ga0157369_10024372 3300013105 Bacteria 6732
121 Ga0157374_10076945 3300013296 Bacteria 3156
122 Ga0157374_10161911 3300013296 Bacteria 2179
123 Ga0157374_10168589 3300013296 Bacteria 2135
124 Ga0157378_10008854 3300013297 Bacteria 8759
125 Ga0157378_10013122 3300013297 Bacteria 7250
126 Ga0163162_10104215 3300013306 Bacteria 2931
127 Ga0157372_10009013 3300013307 Bacteria 10604
128 Ga0157372_10013260 3300013307 Bacteria 8797
129 Ga0157372_10016474 3300013307 Bacteria 7931
130 Ga0157372_10145918 3300013307 Bacteria 2729
131 Ga0157372_10247429 3300013307 Bacteria 2069
132 Ga0157375_10031983 3300013308 Bacteria 4985
133 Ga0157375_10040523 3300013308 Bacteria 4490
134 Ga0163163_10056623 3300014325 Bacteria 3875
135 Ga0157376_10003266 3300014969 Bacteria 11154
136 Ga0206356_10838569 3300020070 Bacteria 2948
137 Ga0206349_1350630 3300020075 Bacteria 5924
138 Ga0206352_10936834 3300020078 Bacteria 4057
139 Ga0213875_10006657 3300021388 Bacteria 6036
140 Ga0224712_10001614 3300022467 Bacteria 5288
141 Ga0228598_1000759 3300024227 Bacteria 6917
142 Ga0207680_10020492 3300025903 Bacteria 3560
143 Ga0207647_10006296 3300025904 Bacteria 8641
144 Ga0207685_10004910 3300025905 Bacteria 3463
145 Ga0207685_10013328 3300025905 Bacteria 2539
146 Ga0207699_10016046 3300025906 Bacteria 3908
147 Ga0207645_10001760 3300025907 Bacteria 17569
148 Ga0207705_10000013 3300025909 Bacteria 451680
149 Ga0207705_10000645 3300025909 Bacteria 29020
150 Ga0207705_10019002 3300025909 Bacteria 4915
151 Ga0207705_10020337 3300025909 Bacteria 4746
152 Ga0207705_10021982 3300025909 Bacteria 4552
153 Ga0207705_10022701 3300025909 Bacteria 4475
154 Ga0207705_10023293 3300025909 Bacteria 4418
155 Ga0207654_10037946 3300025911 Bacteria 2700
156 Ga0207654_10045984 3300025911 Bacteria 2487
157 Ga0207707_10031490 3300025912 Bacteria 4641
158 Ga0207695_10000317 3300025913 Bacteria 116195
159 Ga0207695_10009776 3300025913 Bacteria 11795
160 Ga0207695_10052289 3300025913 Bacteria 4281
161 Ga0207695_10052529 3300025913 Bacteria 4269
162 Ga0207695_10079226 3300025913 Bacteria 3330
163 Ga0207695_10156821 3300025913 Bacteria 2211
164 Ga0207693_10002995 3300025915 Bacteria 14613
165 Ga0207693_10009201 3300025915 Bacteria 8065
166 Ga0207693_10011660 3300025915 Bacteria 7111
167 Ga0207693_10025829 3300025915 Bacteria 4653
168 Ga0207663_10001549 3300025916 Bacteria 10764
169 Ga0207663_10033959 3300025916 Bacteria 3045
170 Ga0207657_10001675 3300025919 Bacteria 23908
171 Ga0207657_10002014 3300025919 Bacteria 21966
172 Ga0207657_10015946 3300025919 Bacteria 7259
173 Ga0207657_10048840 3300025919 Bacteria 3692
174 Ga0207652_10031090 3300025921 Bacteria 4480
175 Ga0207646_10007281 3300025922 Bacteria 11277
176 Ga0207646_10050103 3300025922 Bacteria 3737
177 Ga0207646_10087005 3300025922 Bacteria 2796
178 Ga0207694_10054049 3300025924 Bacteria 3115
179 Ga0207659_10052490 3300025926 Bacteria 2904
180 Ga0207700_10011065 3300025928 Bacteria 5735
181 Ga0207700_10014755 3300025928 Bacteria 5130
182 Ga0207690_10007680 3300025932 Bacteria 6398
183 Ga0207690_10042879 3300025932 Bacteria 2975
184 Ga0207706_10002020 3300025933 Bacteria 19875
185 Ga0207706_10126843 3300025933 Bacteria 2244
186 Ga0207665_10003966 3300025939 Bacteria 9898
187 Ga0207665_10026320 3300025939 Bacteria 3840
188 Ga0207711_10092381 3300025941 Bacteria 2663
189 Ga0207689_10075809 3300025942 Bacteria 2765
190 Ga0207661_10019821 3300025944 Bacteria 5019
191 Ga0207661_10023547 3300025944 Bacteria 4654
192 Ga0207667_10003408 3300025949 Bacteria 19625
193 Ga0207667_10020491 3300025949 Bacteria 7353
194 Ga0207667_10021512 3300025949 Bacteria 7145
195 Ga0207667_10025265 3300025949 Bacteria 6504
196 Ga0207667_10035438 3300025949 Bacteria 5353
197 Ga0207667_10115938 3300025949 Bacteria 2761
198 Ga0207667_10118255 3300025949 Bacteria 2731
199 Ga0207668_10109256 3300025972 Bacteria 2071
200 Ga0207640_10000011 3300025981 Bacteria 252283
201 Ga0207658_10032241 3300025986 Bacteria 3727
202 Ga0207677_10013829 3300026023 Bacteria 4689
203 Ga0207639_10000085 3300026041 Bacteria 79561
204 Ga0207639_10017856 3300026041 Bacteria 5032
205 Ga0207678_10001045 3300026067 Bacteria 25304
206 Ga0207678_10006884 3300026067 Bacteria 10085
207 Ga0207678_10061414 3300026067 Bacteria 3232
208 Ga0207678_10131678 3300026067 Bacteria 2134
209 Ga0207702_10022529 3300026078 Bacteria 5222
210 Ga0207641_10001341 3300026088 Bacteria 24380
211 Ga0207641_10009680 3300026088 Bacteria 7940
212 Ga0207641_10096959 3300026088 Bacteria 2591
213 Ga0207648_10009525 3300026089 Bacteria 9295
214 Ga0207674_10001390 3300026116 Bacteria 31168
215 Ga0207683_10001646 3300026121 Bacteria 20009
216 Ga0207698_10050062 3300026142 Bacteria 3184
217 Ga0268266_10024491 3300028379 Bacteria 5132
218 Ga0268266_10081181 3300028379 Bacteria 2826
219 Ga0268265_10028026 3300028380 Bacteria 4029
220 Ga0268264_10013585 3300028381 Bacteria 6703
221 Ga0265338_10037920 3300028800 Bacteria 4576
222 Ga0265760_10001064 3300031090 Bacteria 7969
223 Ga0265760_10007274 3300031090 Bacteria 3170
224 Ga0265339_10003605 3300031249 Bacteria 10807
225 Ga0265331_10035841 3300031250 Bacteria 2439
226 Ga0265314_10040369 3300031711 Bacteria 3350
227 Ga0373934_0000610 3300035086 Bacteria 12603
228 Ga0373954_0000189 3300035118 Bacteria 22316
229 Ga0373956_0002639 3300035119 Bacteria 7266
230 Ga0373955_0000259 3300035172 Bacteria 22026
231 Ga0373933_0001363 3300035724 Bacteria 14392
232 Ga0373937_0000123 3300036401 Bacteria 74156
233 Ga0395905_0212743 3300037471 Bacteria 1811
234 Ga0436364_0737333 3300037853 Bacteria 47273
235 Ga0436364_0803946 3300037853 Bacteria 6028
236 Ga0439448_0004681 3300042005 Bacteria 3873
237 Ga0466967_0005608 3300045976 Bacteria 8728
238 Ga0495608_0057400 3300046511 Bacteria 2569
239 Ga0495628_0098151 3300046516 Bacteria 2263
240 Ga0495587_0000303 3300046536 Bacteria 35065
241 Ga0495587_0118240 3300046536 Bacteria 1519
242 Ga0495625_0000033 3300046660 Bacteria 228108
243 Ga0495623_0009091 3300046679 Bacteria 6444
244 Ga0495604_0000176 3300047317 Bacteria 56911
245 Ga0495684_0043127 3300047471 Bacteria 3453
246 Ga0495602_0000362 3300048088 Bacteria 42468
247 Ga0496102_0007099 3300048905 Bacteria 9563
248 Ga0496103_0009258 3300048906 Bacteria 5836
249 Ga0496106_0013201 3300048909 Bacteria 6095
250 Ga0496107_0015250 3300048910 Bacteria 5386
251 Ga0496112_0094524 3300048915 Bacteria 2960
252 Ga0496126_0000014 3300048929 Bacteria 686881
253 nmdc:mga05p37_57774_c1 3300050507 Bacteria 4778
254 nmdc:mga06r32_121925_c1 3300050510 Bacteria 2572
255 nmdc:mga06r32_64532_c1 3300050510 Bacteria 3531
256 nmdc:mga08y16_179721_c1 3300050511 Bacteria 2197
257 nmdc:mga0n895_17710_c1 3300050512 Bacteria 6572
258 nmdc:mga0n895_56267_c1 3300050512 Bacteria 3874
259 nmdc:mga0n895_63425_c1 3300050512 Bacteria 3654
260 nmdc:mga0n895_78895_c1 3300050512 Bacteria 3278
261 nmdc:mga0n895_79088_c1 3300050512 Bacteria 3274
262 nmdc:mga0n895_91282_c1 3300050512 Bacteria 3048
263 nmdc:mga0rr50_10532_c1 3300050513 Bacteria 5873
264 nmdc:mga0rr50_25029_c1 3300050513 Bacteria 4144
265 nmdc:mga0a205_11800_c1 3300050515 Bacteria 8063
266 nmdc:mga0a205_58495_c1 3300050515 Bacteria 3723
267 nmdc:mga0a205_75791_c1 3300050515 Bacteria 3250
268 Ga0495601_0085391 3300053077 Bacteria 2028
269 Ga0070713_100015262
270 Ga0070658_10000007
271 Ga0070658_10003242
272 Ga0070658_10008988
273 Ga0070658_10022108
274 Ga0070676_10011722
275 Ga0070683_100006155
276 Ga0070683_100058433
277 Ga0070677_10022470
278 Ga0070666_10001174
279 Ga0068868_100040841
280 Ga0070660_100005968
281 Ga0070660_100013373
282 Ga0070660_100105736
283 Ga0070661_100010537
284 Ga0070659_100005637
285 Ga0070659_100009261
286 Ga0070659_100026437
287 Ga0070703_10010894
288 Ga0070713_100037209
289 Ga0070711_100001028
290 Ga0070711_100036773
291 Ga0070711_100046522
292 Ga0070694_100011276
293 Ga0070708_100100601
294 Ga0070708_100152093
295 Ga0070663_100033998
296 Ga0070678_100015313
297 Ga0070662_100001162
298 Ga0070662_100053908
299 Ga0070681_10015532
300 Ga0070706_100091125
301 Ga0070707_100002383
302 Ga0070707_100094811
303 Ga0070707_100119308
304 Ga0070707_100159400
305 Ga0070707_100190861
306 Ga0070684_100069501
307 Ga0070697_100008429
308 Ga0070697_100014271
309 Ga0070697_100017557
310 Ga0068853_100000049
311 Ga0068853_100077638
312 Ga0070695_100071757
313 Ga0070695_100090511
314 Ga0070696_100069467
315 Ga0070665_100195505
316 Ga0070704_100020891
317 Ga0068855_100005395
318 Ga0068855_100005881
319 Ga0068855_100019946
320 Ga0068855_100024184
321 Ga0068855_100027186
322 Ga0068855_100097590
323 Ga0068857_100151012
324 Ga0068854_100000129
325 Ga0068854_100008428
326 Ga0068859_100000002
327 Ga0068863_100002174
328 Ga0068863_100019961
329 Ga0068858_100085281
330 Ga0068860_100018079
331 Ga0068862_100146513
332 Ga0070717_10047953
333 Ga0070716_100002025
334 Ga0070712_100007992
335 Ga0097621_100034024
336 Ga0075428_100060737
337 Ga0075428_100144864
338 Ga0075433_10012715
339 Ga0075433_10049144
340 Ga0075434_100040838
341 Ga0075434_100046770
342 Ga0075434_100068963
343 Ga0075434_100075530
344 Ga0075434_100109544
345 Ga0075434_100167602
346 Ga0075436_100077856
347 Ga0097620_100000002
348 Ga0075435_100029165
349 Ga0099794_10001510
350 Ga0099794_10019550
351 Ga0099795_10001541
352 Ga0099795_10004406
353 Ga0105240_10001419
354 Ga0105240_10034276
355 Ga0105240_10050237
356 Ga0105240_10050413
357 Ga0105240_10051629
358 Ga0105240_10074566
359 Ga0105240_10100516
360 Ga0105245_10023545
361 Ga0105245_10057453
362 Ga0105247_10014208
363 Ga0114129_10000975
364 Ga0114129_10033895
365 Ga0114129_10213929
366 Ga0114129_10256804
367 Ga0114129_10307271
368 Ga0105241_10013634
369 Ga0105241_10019333
370 Ga0105248_10004373
371 Ga0105248_10100129
372 Ga0105237_10004050
373 Ga0105237_10098159
374 Ga0105238_10021368
375 Ga0105249_10194783
376 Ga0157373_10082103
377 Ga0157370_10005124
378 Ga0157370_10014347
379 Ga0157370_10015568
380 Ga0157370_10028580
381 Ga0157370_10057383
382 Ga0157369_10011621
383 Ga0157369_10011737
384 Ga0157369_10012470
385 Ga0157369_10018923
386 Ga0157369_10021042
387 Ga0157369_10023295
388 Ga0157369_10024372
389 Ga0157374_10076945
390 Ga0157374_10161911
391 Ga0157374_10168589
392 Ga0157378_10008854
393 Ga0157378_10013122
394 Ga0163162_10104215
395 Ga0157372_10009013
396 Ga0157372_10013260
397 Ga0157372_10016474
398 Ga0157372_10145918
399 Ga0157372_10247429
400 Ga0157375_10031983
401 Ga0157375_10040523
402 Ga0163163_10056623
403 Ga0157376_10003266
404 Ga0206356_10838569
405 Ga0206349_1350630
406 Ga0206352_10936834
407 Ga0213875_10006657
408 Ga0224712_10001614
409 Ga0228598_1000759
410 Ga0207680_10020492
411 Ga0207647_10006296
412 Ga0207685_10004910
413 Ga0207685_10013328
414 Ga0207699_10016046
415 Ga0207645_10001760
416 Ga0207705_10000013
417 Ga0207705_10000645
418 Ga0207705_10019002
419 Ga0207705_10020337
420 Ga0207705_10021982
421 Ga0207705_10022701
422 Ga0207705_10023293
423 Ga0207654_10037946
424 Ga0207654_10045984
425 Ga0207707_10031490
426 Ga0207695_10000317
427 Ga0207695_10009776
428 Ga0207695_10052289
429 Ga0207695_10052529
430 Ga0207695_10079226
431 Ga0207695_10156821
432 Ga0207693_10002995
433 Ga0207693_10009201
434 Ga0207693_10011660
435 Ga0207693_10025829
436 Ga0207663_10001549
437 Ga0207663_10033959
438 Ga0207657_10001675
439 Ga0207657_10002014
440 Ga0207657_10015946
441 Ga0207657_10048840
442 Ga0207652_10031090
443 Ga0207646_10007281
444 Ga0207646_10050103
445 Ga0207646_10087005
446 Ga0207694_10054049
447 Ga0207659_10052490
448 Ga0207700_10011065
449 Ga0207700_10014755
450 Ga0207690_10007680
451 Ga0207690_10042879
452 Ga0207706_10002020
453 Ga0207706_10126843
454 Ga0207665_10003966
455 Ga0207665_10026320
456 Ga0207711_10092381
457 Ga0207689_10075809
458 Ga0207661_10019821
459 Ga0207661_10023547
460 Ga0207667_10003408
461 Ga0207667_10020491
462 Ga0207667_10021512
463 Ga0207667_10025265
464 Ga0207667_10035438
465 Ga0207667_10115938
466 Ga0207667_10118255
467 Ga0207668_10109256
468 Ga0207640_10000011
469 Ga0207658_10032241
470 Ga0207677_10013829
471 Ga0207639_10000085
472 Ga0207639_10017856
473 Ga0207678_10001045
474 Ga0207678_10006884
475 Ga0207678_10061414
476 Ga0207678_10131678
477 Ga0207702_10022529
478 Ga0207641_10001341
479 Ga0207641_10009680
480 Ga0207641_10096959
481 Ga0207648_10009525
482 Ga0207674_10001390
483 Ga0207683_10001646
484 Ga0207698_10050062
485 Ga0268266_10024491
486 Ga0268266_10081181
487 Ga0268265_10028026
488 Ga0268264_10013585
489 Ga0265338_10037920
490 Ga0265760_10001064
491 Ga0265760_10007274
492 Ga0265339_10003605
493 Ga0265331_10035841
494 Ga0265314_10040369
495 Ga0373934_0000610
496 Ga0373954_0000189
497 Ga0373956_0002639
498 Ga0373955_0000259
499 Ga0373933_0001363
500 Ga0373937_0000123
501 Ga0395905_0212743
502 Ga0436364_0737333
503 Ga0436364_0803946
504 Ga0439448_0004681
505 Ga0466967_0005608
506 Ga0495608_0057400
507 Ga0495628_0098151
508 Ga0495587_0000303
509 Ga0495587_0118240
510 Ga0495625_0000033
511 Ga0495623_0009091
512 Ga0495604_0000176
513 Ga0495684_0043127
514 Ga0495602_0000362
515 Ga0496102_0007099
516 Ga0496103_0009258
517 Ga0496106_0013201
518 Ga0496107_0015250
519 Ga0496112_0094524
520 Ga0496126_0000014
521 nmdc:mga05p37_57774_c1
522 nmdc:mga06r32_121925_c1
523 nmdc:mga06r32_64532_c1
524 nmdc:mga08y16_179721_c1
525 nmdc:mga0n895_17710_c1
526 nmdc:mga0n895_56267_c1
527 nmdc:mga0n895_63425_c1
528 nmdc:mga0n895_78895_c1
529 nmdc:mga0n895_79088_c1
530 nmdc:mga0n895_91282_c1
531 nmdc:mga0rr50_10532_c1
532 nmdc:mga0rr50_25029_c1
533 nmdc:mga0a205_11800_c1
534 nmdc:mga0a205_58495_c1
535 nmdc:mga0a205_75791_c1
536 Ga0495601_0085391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

34

385

0.98

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

384

461

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dh6-assembly1.cif.gz_a cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.9054 30 501
3abk-assembly1.cif.gz_A bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) 0.9044 29 503
7vuw-assembly2.cif.gz_N bovine heart cytochrome c oxidase in the cyanide-bound fully oxidized state at 50 k 0.8997 29 501
8c8q-assembly1.cif.gz_A cytochrome c oxidase from schizosaccharomyces pombe 0.899 26 509
6pw1-assembly2.cif.gz_C cytochrome c oxidase delta 16 0.8929 32 523
ID Description Score Start End Superfamily
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9018 30 361 1.20.210.10
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8964 26 531 1.20.210.10
af_P03878_1_258_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8939 30 282 1.20.210.10
af_P9WP71_20_544_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8919 24 540 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8895 31 490 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A1H0M2Z6-F1-model_v4 Cytochrome C and Quinol oxidase polypeptide I 0.9815 30 143 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A4U3ANU3-F1-model_v4 deleted 0.9634 19 135
AF-A0A4U3ANU3-F1-model_v4 deleted 0.9324 19 135
AF-A0A2D8TK41-F1-model_v4 deleted 0.9288 31 310
AF-W4RQL2-F1-model_v4 Cytochrome c oxidase polypeptide I 0.9249 17 196 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904

Map