F375116

General Info

Members Datasets Scaffolds Average Seq Length
267 181 533 94

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_67401_c1|nmdc:mga00v17_67401_c1_1303_1626
Length 100
Sequence MLLDLETARKDRTEMKKPSAKIREEIRQAETREAERIGRIALKAGLGDIEVTEDDLQSAFQELAKRFRAGRPASNGKERGGASSDPSLSTGTAQGSAGEV

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
20 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
25 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
26 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
27 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
28 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
30 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
58 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
59 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
60 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
61 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
62 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
73 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
74 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
75 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
95 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
124 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
127 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
134 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
140 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
141 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
142 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
143 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
144 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
145 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
146 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
147 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
148 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
149 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
150 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
151 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
152 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
153 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
154 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
155 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
156 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
157 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
158 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
159 2643221610 Ensifer sp. Root74 Isolate Unclassified
160 2643221668 Ensifer sp. Root423 Isolate Unclassified
161 2643221675 Ensifer sp. Root1298 Isolate Unclassified
162 2643221680 Ensifer sp. Root1312 Isolate Unclassified
163 2643221726 Ensifer sp. Root954 Isolate Unclassified
164 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
165 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
166 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
167 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
168 2791355266 Rhizobium sp. L43 Isolate Nodule
169 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
170 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
171 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
172 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
173 2904699407
174 2922368715
175 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
176 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
177 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
178 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
179 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
180 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
181 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.66
Metatranscriptomes 0
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.1
Nodule 10.86
Rhizoplane 4.12
Rhizosphere 37.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_67401_c1 3300050491 Bacteria 2211
2 JGI25165J46597_1000490 3300003214 Bacteria 38158
3 JGI25153J46596_10039864 3300003215 Bacteria 1463
4 rootH1_10023084 3300003316 Bacteria 4116
5 rootH1_10023084 3300003323 Bacteria 1546
6 Ga0055526_1009885 3300003771 Bacteria 4522
7 Ga0055524_1000385 3300003775 Bacteria 38044
8 Ga0055531_10004361 3300003794 Bacteria 8652
9 Ga0055531_10005332 3300003794 Bacteria 7545
10 Ga0055531_10010677 3300003794 Bacteria 4532
11 Ga0058692_1047834 3300003856 Bacteria 720
12 Ga0065165_1012673 3300005262 Bacteria 3414
13 Ga0065165_1122064 3300005262 Bacteria 631
14 Ga0070691_10987628 3300005341 Bacteria 524
15 Ga0070667_101880919 3300005367 Bacteria 563
16 Ga0070663_100323877 3300005455 Bacteria 1240
17 Ga0068854_100105208 3300005578 Bacteria 2121
18 Ga0068856_100213468 3300005614 Bacteria 1945
19 Ga0068851_10412371 3300005834 Bacteria 796
20 Ga0075363_100123810 3300006048 Bacteria 1446
21 Ga0075364_10073298 3300006051 Bacteria 2257
22 Ga0105237_10000384 3300009545 Bacteria 62866
23 Ga0123341_1030464 3300009765 Bacteria 4064
24 Ga0123341_1034346 3300009765 Bacteria 3611
25 Ga0123341_1054600 3300009765 Bacteria 2137
26 Ga0123342_1009903 3300009766 Bacteria 11151
27 Ga0123342_1013666 3300009766 Bacteria 8041
28 Ga0123342_1016920 3300009766 Bacteria 6211
29 Ga0105239_10000065 3300010375 Bacteria 151224
30 Ga0105239_10000394 3300010375 Bacteria 64001
31 Ga0157370_10000054 3300013104 Bacteria 118718
32 Ga0157370_10141915 3300013104 Bacteria 2238
33 Ga0157369_10678993 3300013105 Bacteria 1061
34 Ga0157369_10776501 3300013105 Bacteria 985
35 Ga0214544_1000097 3300021320 Bacteria 116548
36 Ga0214542_1000418 3300021321 Bacteria 75807
37 Ga0214542_1012197 3300021321 Bacteria 11260
38 Ga0214543_1004493 3300021327 Bacteria 26374
39 Ga0214543_1008419 3300021327 Bacteria 16880
40 Ga0228710_1034867 3300022740 Bacteria 1993
41 Ga0209437_100326 3300025233 Bacteria 60536
42 Ga0209646_1044293 3300025246 Bacteria 549
43 Ga0209677_101449 3300025253 Bacteria 10255
44 Ga0209233_1000384 3300025261 Bacteria 38210
45 Ga0209233_1002273 3300025261 Bacteria 7160
46 Ga0209455_1025535 3300025272 Bacteria 1073
47 Ga0209676_1003658 3300025292 Bacteria 9221
48 Ga0209676_1047263 3300025292 Bacteria 1158
49 Ga0209025_1091049 3300025294 Bacteria 997
50 Ga0209564_1001053 3300025295 Bacteria 33613
51 Ga0209564_1017052 3300025295 Bacteria 2855
52 Ga0209050_1016839 3300025298 Bacteria 2957
53 Ga0209256_1000228 3300025299 Bacteria 102990
54 Ga0209256_1000999 3300025299 Bacteria 33608
55 Ga0209051_1003029 3300025303 Bacteria 11374
56 Ga0209051_1004146 3300025303 Bacteria 9061
57 Ga0209257_1000741 3300025304 Bacteria 49326
58 Ga0209257_1005622 3300025304 Bacteria 8679
59 Ga0209257_1006056 3300025304 Bacteria 8052
60 Ga0207656_10248308 3300025321 Bacteria 871
61 Ga0207705_10839735 3300025909 Bacteria 712
62 Ga0207671_10000379 3300025914 Bacteria 63039
63 Ga0207709_10535384 3300025935 Bacteria 919
64 Ga0207668_11254767 3300025972 Bacteria 667
65 Ga0207702_10163461 3300026078 Bacteria 2035
66 Ga0209281_1004885 3300027111 Bacteria 3878
67 Ga0209371_1002872 3300027312 Bacteria 9064
68 Ga0209282_1008467 3300027666 Bacteria 6492
69 Ga0209282_1022798 3300027666 Bacteria 3941
70 Ga0268266_11839617 3300028379 Bacteria 580
71 Ga0268256_1002577 3300030500 Bacteria 9064
72 Ga0307405_10001082 3300031731 Bacteria 11104
73 Ga0307406_10041204 3300031901 Bacteria 2876
74 Ga0307412_10002600 3300031911 Bacteria 10031
75 Ga0315914_1024634 3300031967 Bacteria 4064
76 Ga0307416_101928903 3300032002 Bacteria 694
77 Ga0307510_10002393 3300033180 Bacteria 21270
78 Ga0315913_1046195 3300033430 Bacteria 1993
79 Ga0315915_1032554 3300033464 Bacteria 3091
80 Ga0439465_0008620 3300041413 Bacteria 3216
81 Ga0451845_0880100 3300041501 Bacteria 746
82 Ga0451849_1412712 3300041505 Bacteria 1464
83 Ga0495617_008153 3300046452 Bacteria 3619
84 Ga0495627_013481 3300046453 Bacteria 2874
85 Ga0495627_068431 3300046453 Bacteria 1040
86 Ga0495638_0000077 3300046460 Bacteria 158724
87 Ga0495638_0000218 3300046460 Bacteria 79814
88 Ga0495585_0009294 3300046492 Bacteria 5905
89 Ga0495607_0011978 3300046501 Bacteria 5740
90 Ga0495583_0025312 3300046506 Bacteria 2966
91 Ga0495606_0161641 3300046507 Bacteria 1306
92 Ga0495610_0002046 3300046512 Bacteria 17226
93 Ga0495610_0055382 3300046512 Bacteria 1911
94 Ga0495610_0079158 3300046512 Bacteria 1513
95 Ga0495616_0118600 3300046513 Bacteria 1223
96 Ga0495620_0001180 3300046515 Bacteria 15983
97 Ga0495620_0027302 3300046515 Bacteria 2672
98 Ga0495620_0365866 3300046515 Bacteria 546
99 Ga0495631_0384791 3300046518 Bacteria 597
100 Ga0495632_0109118 3300046519 Bacteria 1300
101 Ga0495632_0340630 3300046519 Bacteria 660
102 Ga0495637_0003746 3300046520 Bacteria 8027
103 Ga0495643_0003583 3300046522 Bacteria 11280
104 Ga0495643_0008447 3300046522 Bacteria 6516
105 Ga0495643_0047672 3300046522 Bacteria 2319
106 Ga0495648_0003242 3300046524 Bacteria 14429
107 Ga0495663_0061478 3300046525 Bacteria 1181
108 Ga0495654_0000859 3300046530 Bacteria 22963
109 Ga0495609_0000419 3300046538 Bacteria 35536
110 Ga0495622_0208659 3300046557 Bacteria 868
111 Ga0495668_0260639 3300046616 Bacteria 949
112 Ga0495611_0000542 3300046648 Bacteria 22178
113 Ga0495611_0217408 3300046648 Bacteria 889
114 Ga0495625_0005327 3300046660 Bacteria 11782
115 Ga0495625_0045442 3300046660 Bacteria 3174
116 Ga0495661_0035597 3300046665 Bacteria 3122
117 Ga0495661_0094066 3300046665 Bacteria 1699
118 Ga0495588_0001266 3300046674 Bacteria 10839
119 Ga0495588_0087096 3300046674 Bacteria 1633
120 Ga0495588_0243917 3300046674 Bacteria 947
121 Ga0495658_0127929 3300046683 Bacteria 1543
122 Ga0495613_0005876 3300046689 Bacteria 9184
123 Ga0495670_0000087 3300046691 Bacteria 41042
124 Ga0495671_0001657 3300046692 Bacteria 14582
125 Ga0495671_0443286 3300046692 Bacteria 621
126 Ga0495649_0000237 3300046694 Bacteria 48559
127 Ga0495660_0055246 3300046810 Bacteria 2150
128 Ga0495660_0246968 3300046810 Bacteria 829
129 Ga0495683_0059515 3300047323 Bacteria 1895
130 Ga0495687_000090 3300047443 Bacteria 141153
131 Ga0495687_004727 3300047443 Bacteria 9024
132 Ga0495679_092597 3300047446 Bacteria 846
133 Ga0495673_0037029 3300047469 Bacteria 2232
134 Ga0495681_0001033 3300047470 Bacteria 21264
135 Ga0495681_0035392 3300047470 Bacteria 2479
136 Ga0495686_0000157 3300047472 Bacteria 130757
137 Ga0495686_0001523 3300047472 Bacteria 24935
138 Ga0496100_0000431 3300048903 Bacteria 20358
139 Ga0496101_0644784 3300048904 Bacteria 837
140 Ga0496102_0000625 3300048905 Bacteria 36336
141 Ga0496103_0001783 3300048906 Bacteria 14051
142 Ga0496104_0102370 3300048907 Bacteria 2743
143 Ga0496106_0499765 3300048909 Bacteria 977
144 Ga0496107_0211360 3300048910 Bacteria 1443
145 Ga0496113_0002058 3300048916 Bacteria 11558
146 Ga0496113_0028656 3300048916 Bacteria 4008
147 Ga0496116_0000601 3300048919 Bacteria 47643
148 Ga0496116_0000868 3300048919 Bacteria 37701
149 Ga0496116_0007814 3300048919 Bacteria 9399
150 Ga0496116_0148450 3300048919 Bacteria 1306
151 Ga0496117_0001345 3300048920 Bacteria 36055
152 Ga0496118_0000524 3300048921 Bacteria 63074
153 Ga0496118_0182825 3300048921 Bacteria 1264
154 Ga0496119_0000443 3300048922 Bacteria 56795
155 Ga0496119_0002395 3300048922 Bacteria 20596
156 Ga0496119_0005797 3300048922 Bacteria 11686
157 Ga0496119_0040693 3300048922 Bacteria 2969
158 Ga0496119_0393359 3300048922 Bacteria 662
159 Ga0496120_0000974 3300048923 Bacteria 39045
160 Ga0496120_0001015 3300048923 Bacteria 37573
161 Ga0496120_0001548 3300048923 Bacteria 26898
162 Ga0496120_0002028 3300048923 Bacteria 22016
163 Ga0496121_0001402 3300048924 Bacteria 40798
164 Ga0496121_0021471 3300048924 Bacteria 6321
165 Ga0496121_0043598 3300048924 Bacteria 3882
166 Ga0496121_0191997 3300048924 Bacteria 1463
167 Ga0496122_0000426 3300048925 Bacteria 89190
168 Ga0496122_0000605 3300048925 Bacteria 73607
169 Ga0496122_0000689 3300048925 Bacteria 67297
170 Ga0496122_0002943 3300048925 Bacteria 23224
171 Ga0496122_0008327 3300048925 Bacteria 11220
172 Ga0496122_0025563 3300048925 Bacteria 5123
173 Ga0496123_0000046 3300048926 Bacteria 244844
174 Ga0496123_0000380 3300048926 Bacteria 83326
175 Ga0496123_0000491 3300048926 Bacteria 68777
176 Ga0496123_0009250 3300048926 Bacteria 8902
177 Ga0496123_0024855 3300048926 Bacteria 4535
178 Ga0496124_0000227 3300048927 Bacteria 110314
179 Ga0496124_0002118 3300048927 Bacteria 26720
180 Ga0496124_0012941 3300048927 Bacteria 8184
181 Ga0496124_0035929 3300048927 Bacteria 4329
182 Ga0496124_0042835 3300048927 Bacteria 3894
183 Ga0496124_0063615 3300048927 Bacteria 3081
184 Ga0496124_0632183 3300048927 Bacteria 690
185 Ga0496125_0000134 3300048928 Bacteria 161449
186 Ga0496125_0000411 3300048928 Bacteria 80323
187 Ga0496125_0074604 3300048928 Bacteria 2629
188 Ga0496125_0248111 3300048928 Bacteria 1125
189 Ga0496126_0000471 3300048929 Bacteria 80080
190 Ga0496126_0000485 3300048929 Bacteria 78597
191 Ga0496126_0002170 3300048929 Bacteria 27261
192 Ga0496126_0009871 3300048929 Bacteria 10099
193 Ga0496126_0572198 3300048929 Bacteria 893
194 Ga0495678_000059 3300049459 Bacteria 143694
195 Ga0495678_071809 3300049459 Bacteria 1267
196 Ga0495682_0002038 3300049460 Bacteria 9920
197 Ga0501280_007913 3300049776 Bacteria 1484
198 nmdc:mga03n38_191042_c1 3300050490 Bacteria 1055
199 nmdc:mga0sz30_513748_c1 3300050516 Bacteria 539
200 Ga0495612_0186826 3300053078 Bacteria 911
201 Ga0500578_0000148 3300053086 Bacteria 83724
202 Ga0500583_0000693 3300053092 Bacteria 9842
203 Ga0500651_0430426 3300053093 Bacteria 737
204 Ga0500660_177817 3300053100 Bacteria 774
205 Ga0500555_004018 3300053103 Bacteria 4180
206 Ga0500556_0000105 3300053104 Bacteria 74717
207 Ga0500572_002215 3300053111 Bacteria 4753
208 Ga0500608_000879 3300053122 Bacteria 10847
209 Ga0500618_000118 3300053125 Bacteria 64472
210 Ga0500618_006884 3300053125 Bacteria 3293
211 Ga0500618_010245 3300053125 Bacteria 2520
212 Ga0500559_0024389 3300053136 Bacteria 2573
213 Ga0500561_0000899 3300053137 Bacteria 4754
214 Ga0500564_000275 3300053138 Bacteria 14299
215 Ga0500568_0043370 3300053139 Bacteria 1798
216 Ga0500573_0003898 3300053140 Bacteria 7790
217 Ga0500574_000020 3300053141 Bacteria 31411
218 Ga0500616_0266585 3300053153 Bacteria 725
219 Ga0500624_000030 3300053157 Bacteria 105085
220 Ga0500627_0054126 3300053158 Bacteria 1755
221 Ga0500638_001136 3300053162 Bacteria 7956
222 Ga0500636_0035082 3300053177 Bacteria 2969
223 Ga0500636_0047739 3300053177 Bacteria 2521
224 Ga0500636_0048994 3300053177 Bacteria 2485
225 Ga0500567_088161 3300053723 Bacteria 1321
226 Ga0500570_232629 3300053724 Bacteria 511
227 Ga0500596_002715 3300053735 Bacteria 3470
228 2528855954 2528768022 Bacteria 10457665
229 2558864317 2558860100 Bacteria 8458965
230 2558867733 2558860100 Bacteria 8458965
231 2561469534 2558860983 Bacteria 4133860
232 2585258050 2582581304 Bacteria 5831370
233 2585275967 2582581307 Bacteria 6597605
234 2585282191 2582581308 Bacteria 7413247
235 2585334690 2582581316 Bacteria 7774528
236 2585336541 2582581316 Bacteria 7774528
237 2585534264 2585427527 Bacteria 7273426
238 2585557769 2585427530 Bacteria 7383882
239 2585563533 2585427531 Bacteria 6992870
240 2585846007 2585427594 Bacteria 6180594
241 2585908853 2585427609 Bacteria 6667127
242 2587984376 2585428125 Bacteria 6662905
243 2644066796 2643221610 Bacteria 7480339
244 2644381241 2643221668 Bacteria 7306521
245 2644417742 2643221675 Bacteria 7473456
246 2644451018 2643221680 Bacteria 7473610
247 2644691763 2643221726 Bacteria 7455827
248 2671116923 2667528174 Bacteria 6435400
249 2739037574 2738541333 Bacteria 7106503
250 2792641111 2791355094 Bacteria 7011481
251 2792642025 2791355094 Bacteria 7011481
252 2793283246 2791355253 Bacteria 5171699
253 2793363430 2791355266 Bacteria 7116587
254 2850083012 2850079185 Bacteria 6848280
255 2857524550 2857516855 Bacteria 7787325
256 2885391615 2885383462 Bacteria 9473874
257 2903777329 2903768456 Bacteria 9749579
258 2904699570
259 2922378961
260 2970540305 2970540015 Bacteria 6977556
261 2989780916 2989776772 Bacteria 4843317
262 639651329 639633055 Bacteria 7751309
263 8005465932 8005460587 Bacteria 7157962
264 8006983977 8006973647 Bacteria 10679141
265 8006984189 8006973647 Bacteria 10679141
266 8018153792 8018150411 Bacteria 5549903
267 8018169633 8018163183 Bacteria 7277977
268 nmdc:mga00v17_67401_c1
269 JGI25165J46597_1000490
270 JGI25153J46596_10039864
271 rootH1_10023084
272 Ga0055526_1009885
273 Ga0055524_1000385
274 Ga0055531_10004361
275 Ga0055531_10005332
276 Ga0055531_10010677
277 Ga0058692_1047834
278 Ga0065165_1012673
279 Ga0065165_1122064
280 Ga0070691_10987628
281 Ga0070667_101880919
282 Ga0070663_100323877
283 Ga0068854_100105208
284 Ga0068856_100213468
285 Ga0068851_10412371
286 Ga0075363_100123810
287 Ga0075364_10073298
288 Ga0105237_10000384
289 Ga0123341_1030464
290 Ga0123341_1034346
291 Ga0123341_1054600
292 Ga0123342_1009903
293 Ga0123342_1013666
294 Ga0123342_1016920
295 Ga0105239_10000065
296 Ga0105239_10000394
297 Ga0157370_10000054
298 Ga0157370_10141915
299 Ga0157369_10678993
300 Ga0157369_10776501
301 Ga0214544_1000097
302 Ga0214542_1000418
303 Ga0214542_1012197
304 Ga0214543_1004493
305 Ga0214543_1008419
306 Ga0228710_1034867
307 Ga0209437_100326
308 Ga0209646_1044293
309 Ga0209677_101449
310 Ga0209233_1000384
311 Ga0209233_1002273
312 Ga0209455_1025535
313 Ga0209676_1003658
314 Ga0209676_1047263
315 Ga0209025_1091049
316 Ga0209564_1001053
317 Ga0209564_1017052
318 Ga0209050_1016839
319 Ga0209256_1000228
320 Ga0209256_1000999
321 Ga0209051_1003029
322 Ga0209051_1004146
323 Ga0209257_1000741
324 Ga0209257_1005622
325 Ga0209257_1006056
326 Ga0207656_10248308
327 Ga0207705_10839735
328 Ga0207671_10000379
329 Ga0207709_10535384
330 Ga0207668_11254767
331 Ga0207702_10163461
332 Ga0209281_1004885
333 Ga0209371_1002872
334 Ga0209282_1008467
335 Ga0209282_1022798
336 Ga0268266_11839617
337 Ga0268256_1002577
338 Ga0307405_10001082
339 Ga0307406_10041204
340 Ga0307412_10002600
341 Ga0315914_1024634
342 Ga0307416_101928903
343 Ga0307510_10002393
344 Ga0315913_1046195
345 Ga0315915_1032554
346 Ga0439465_0008620
347 Ga0451845_0880100
348 Ga0451849_1412712
349 Ga0495617_008153
350 Ga0495627_013481
351 Ga0495627_068431
352 Ga0495638_0000077
353 Ga0495638_0000218
354 Ga0495585_0009294
355 Ga0495607_0011978
356 Ga0495583_0025312
357 Ga0495606_0161641
358 Ga0495610_0002046
359 Ga0495610_0055382
360 Ga0495610_0079158
361 Ga0495616_0118600
362 Ga0495620_0001180
363 Ga0495620_0027302
364 Ga0495620_0365866
365 Ga0495631_0384791
366 Ga0495632_0109118
367 Ga0495632_0340630
368 Ga0495637_0003746
369 Ga0495643_0003583
370 Ga0495643_0008447
371 Ga0495643_0047672
372 Ga0495648_0003242
373 Ga0495663_0061478
374 Ga0495654_0000859
375 Ga0495609_0000419
376 Ga0495622_0208659
377 Ga0495668_0260639
378 Ga0495611_0000542
379 Ga0495611_0217408
380 Ga0495625_0005327
381 Ga0495625_0045442
382 Ga0495661_0035597
383 Ga0495661_0094066
384 Ga0495588_0001266
385 Ga0495588_0087096
386 Ga0495588_0243917
387 Ga0495658_0127929
388 Ga0495613_0005876
389 Ga0495670_0000087
390 Ga0495671_0001657
391 Ga0495671_0443286
392 Ga0495649_0000237
393 Ga0495660_0055246
394 Ga0495660_0246968
395 Ga0495683_0059515
396 Ga0495687_000090
397 Ga0495687_004727
398 Ga0495679_092597
399 Ga0495673_0037029
400 Ga0495681_0001033
401 Ga0495681_0035392
402 Ga0495686_0000157
403 Ga0495686_0001523
404 Ga0496100_0000431
405 Ga0496101_0644784
406 Ga0496102_0000625
407 Ga0496103_0001783
408 Ga0496104_0102370
409 Ga0496106_0499765
410 Ga0496107_0211360
411 Ga0496113_0002058
412 Ga0496113_0028656
413 Ga0496116_0000601
414 Ga0496116_0000868
415 Ga0496116_0007814
416 Ga0496116_0148450
417 Ga0496117_0001345
418 Ga0496118_0000524
419 Ga0496118_0182825
420 Ga0496119_0000443
421 Ga0496119_0002395
422 Ga0496119_0005797
423 Ga0496119_0040693
424 Ga0496119_0393359
425 Ga0496120_0000974
426 Ga0496120_0001015
427 Ga0496120_0001548
428 Ga0496120_0002028
429 Ga0496121_0001402
430 Ga0496121_0021471
431 Ga0496121_0043598
432 Ga0496121_0191997
433 Ga0496122_0000426
434 Ga0496122_0000605
435 Ga0496122_0000689
436 Ga0496122_0002943
437 Ga0496122_0008327
438 Ga0496122_0025563
439 Ga0496123_0000046
440 Ga0496123_0000380
441 Ga0496123_0000491
442 Ga0496123_0009250
443 Ga0496123_0024855
444 Ga0496124_0000227
445 Ga0496124_0002118
446 Ga0496124_0012941
447 Ga0496124_0035929
448 Ga0496124_0042835
449 Ga0496124_0063615
450 Ga0496124_0632183
451 Ga0496125_0000134
452 Ga0496125_0000411
453 Ga0496125_0074604
454 Ga0496125_0248111
455 Ga0496126_0000471
456 Ga0496126_0000485
457 Ga0496126_0002170
458 Ga0496126_0009871
459 Ga0496126_0572198
460 Ga0495678_000059
461 Ga0495678_071809
462 Ga0495682_0002038
463 Ga0501280_007913
464 nmdc:mga03n38_191042_c1
465 nmdc:mga0sz30_513748_c1
466 Ga0495612_0186826
467 Ga0500578_0000148
468 Ga0500583_0000693
469 Ga0500651_0430426
470 Ga0500660_177817
471 Ga0500555_004018
472 Ga0500556_0000105
473 Ga0500572_002215
474 Ga0500608_000879
475 Ga0500618_000118
476 Ga0500618_006884
477 Ga0500618_010245
478 Ga0500559_0024389
479 Ga0500561_0000899
480 Ga0500564_000275
481 Ga0500568_0043370
482 Ga0500573_0003898
483 Ga0500574_000020
484 Ga0500616_0266585
485 Ga0500624_000030
486 Ga0500627_0054126
487 Ga0500638_001136
488 Ga0500636_0035082
489 Ga0500636_0047739
490 Ga0500636_0048994
491 Ga0500567_088161
492 Ga0500570_232629
493 Ga0500596_002715
494 2528855954
495 2558864317
496 2558867733
497 2561469534
498 2585258050
499 2585275967
500 2585282191
501 2585334690
502 2585336541
503 2585534264
504 2585557769
505 2585563533
506 2585846007
507 2585908853
508 2587984376
509 2644066796
510 2644381241
511 2644417742
512 2644451018
513 2644691763
514 2671116923
515 2739037574
516 2792641111
517 2792642025
518 2793283246
519 2793363430
520 2850083012
521 2857524550
522 2885391615
523 2903777329
524 2904699570
525 2922378961
526 2970540305
527 2989780916
528 639651329
529 8005465932
530 8006983977
531 8006984189
532 8018153792
533 8018169633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07820

TraC

TraC-like protein

9

100

0.79

Map