F375110

General Info

Members Datasets Scaffolds Average Seq Length
267 127 262 146

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0212660|Ga0501035_0212660_955_1485
Length 176
Sequence MATGRPVDVNQYRRARPSASCRHPPTPKEPIMFKRLLVPTDGSELSLRAANIAIEMAAALHASVLAVHVVAPFHTISYLGEMLAATELEYTQDAVESAERYLAEVRDMATRAGVPCDTMHALEDQPHEVIVRTATDHQCDLIVMGSHGWRGLNRLLLGSETQKVLLTAKVPVLVCH

Samples

Sample ID Description Type Environment
1 2643221629 Devosia sp. Root105 Isolate Unclassified
2 2643221662 Devosia sp. Root413D1 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2928963466 Dyella japonica 1073 Isolate Unclassified
5 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
126 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.37
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.97
Nodule 0
Rhizoplane 1.87
Rhizosphere 61.05
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10094568 3300001989 Bacteria 907
2 JGI24737J22298_10161982 3300001990 Bacteria 660
3 JGI24735J21928_10006224 3300002067 Bacteria 3942
4 JGI25156J39149_1005911 3300002705 Bacteria 3435
5 JGI25156J39149_1007466 3300002705 Bacteria 2864
6 JGI25162J39368_1000597 3300002737 Bacteria 26205
7 JGI25162J39368_1003640 3300002737 Bacteria 4235
8 JGI25162J39368_1004685 3300002737 Bacteria 3053
9 JGI25154J39366_1012007 3300002738 Bacteria 971
10 JGI25157J39369_1000370 3300002741 Bacteria 30908
11 JGI25157J39369_1001161 3300002741 Bacteria 11328
12 JGI25157J39369_1001724 3300002741 Bacteria 7310
13 JGI25164J39214_1000198 3300002772 Bacteria 51603
14 JGI25164J39214_1000259 3300002772 Bacteria 39804
15 JGI25164J39214_1006681 3300002772 Bacteria 1200
16 JGI25165J46597_1000354 3300003214 Bacteria 51605
17 JGI25165J46597_1000379 3300003214 Bacteria 48698
18 rootL2_10205861 3300003322 Bacteria 3445
19 rootH1_10049970 3300003323 Bacteria 1921
20 rootH1_10382948 3300003323 Archaea 1573
21 Ga0055539_1000300 3300003752 Bacteria 26848
22 Ga0055533_1000167 3300003756 Bacteria 60266
23 Ga0055533_1000290 3300003756 Bacteria 25784
24 Ga0055533_1001291 3300003756 Bacteria 6815
25 Ga0055525_1000266 3300003759 Bacteria 49472
26 Ga0055527_1000044 3300003760 Bacteria 111829
27 Ga0055527_1000047 3300003760 Bacteria 109679
28 Ga0055535_1000040 3300003761 Bacteria 157988
29 Ga0055535_1000109 3300003761 Bacteria 89299
30 Ga0055535_1000295 3300003761 Bacteria 51620
31 Ga0055535_1000991 3300003761 Bacteria 18354
32 Ga0055535_1008754 3300003761 Bacteria 1794
33 Ga0055542_1000065 3300003762 Bacteria 157988
34 Ga0055542_1000108 3300003762 Bacteria 111829
35 Ga0055542_1000292 3300003762 Bacteria 56160
36 Ga0055542_1000524 3300003762 Bacteria 34530
37 Ga0055542_1000966 3300003762 Bacteria 18722
38 Ga0055529_1000049 3300003763 Bacteria 208413
39 Ga0055529_1000094 3300003763 Bacteria 134217
40 Ga0055529_1000406 3300003763 Bacteria 45461
41 Ga0070680_100390403 3300005336 Bacteria 1186
42 Ga0070682_100004557 3300005337 Bacteria 7706
43 Ga0070682_100019519 3300005337 Bacteria 3977
44 Ga0070660_100127074 3300005339 Bacteria 2037
45 Ga0070660_100171553 3300005339 Bacteria 1752
46 Ga0070659_100043600 3300005366 Bacteria 3508
47 Ga0070659_100044900 3300005366 Bacteria 3461
48 Ga0070659_100176798 3300005366 Bacteria 1750
49 Ga0070659_100221851 3300005366 Bacteria 1560
50 Ga0070659_100845685 3300005366 Bacteria 797
51 Ga0070714_100000694 3300005435 Bacteria 23800
52 Ga0070714_100011953 3300005435 Bacteria 6905
53 Ga0070713_100000941 3300005436 Bacteria 18599
54 Ga0070662_100024492 3300005457 Bacteria 4158
55 Ga0070681_10015355 3300005458 Bacteria 7618
56 Ga0070679_100302962 3300005530 Bacteria 1549
57 Ga0070679_100439149 3300005530 Bacteria 1250
58 Ga0070684_100429934 3300005535 Bacteria 1219
59 Ga0068853_100072740 3300005539 Bacteria 2996
60 Ga0068853_100152821 3300005539 Bacteria 2078
61 Ga0070696_100002388 3300005546 Bacteria 12422
62 Ga0070693_100052893 3300005547 Bacteria 2330
63 Ga0068855_100012611 3300005563 Bacteria 10200
64 Ga0068857_100471619 3300005577 Bacteria 1175
65 Ga0068856_100645133 3300005614 Bacteria 1079
66 Ga0070712_100194605 3300006175 Bacteria 1589
67 Ga0075366_10627134 3300006195 Bacteria 667
68 Ga0105240_10799393 3300009093 Bacteria 1022
69 Ga0105241_10144309 3300009174 Bacteria 1942
70 Ga0105241_10488549 3300009174 Bacteria 1096
71 Ga0105238_10022760 3300009551 Bacteria 6386
72 Ga0105239_10086792 3300010375 Bacteria 3449
73 Ga0105239_10605829 3300010375 Bacteria 1249
74 Ga0157373_10004598 3300013100 Bacteria 10377
75 Ga0157371_10046447 3300013102 Bacteria 3089
76 Ga0157371_10456801 3300013102 Bacteria 939
77 Ga0157370_10037206 3300013104 Bacteria 4718
78 Ga0157370_10826574 3300013104 Bacteria 842
79 Ga0157369_10064267 3300013105 Bacteria 3952
80 Ga0157369_10235665 3300013105 Bacteria 1912
81 Ga0157372_10086350 3300013307 Bacteria 3559
82 Ga0182008_10004435 3300014497 Bacteria 8203
83 Ga0182008_10045120 3300014497 Bacteria 2191
84 Ga0182008_10050174 3300014497 Bacteria 2071
85 Ga0182008_10120889 3300014497 Bacteria 1302
86 Ga0182006_1006979 3300015261 Bacteria 5197
87 Ga0182006_1012629 3300015261 Bacteria 3692
88 Ga0182007_10015730 3300015262 Bacteria 2811
89 Ga0182007_10022104 3300015262 Bacteria 2250
90 Ga0182007_10042591 3300015262 Bacteria 1511
91 Ga0183368_1004 3300015687 Bacteria 1211761
92 Ga0206353_11434229 3300020082 Bacteria 1050
93 Ga0213872_10009739 3300021361 Bacteria 4595
94 Ga0209435_108694 3300025206 Bacteria 1115
95 Ga0209674_100016 3300025226 Bacteria 696756
96 Ga0209674_100026 3300025226 Bacteria 490631
97 Ga0209674_100063 3300025226 Bacteria 275507
98 Ga0209674_100587 3300025226 Bacteria 14006
99 Ga0209672_100017 3300025228 Bacteria 514236
100 Ga0209672_100024 3300025228 Bacteria 367869
101 Ga0209672_100173 3300025228 Bacteria 54084
102 Ga0209672_102819 3300025228 Bacteria 3953
103 Ga0209563_100067 3300025230 Bacteria 256096
104 Ga0207427_100101 3300025231 Bacteria 120866
105 Ga0207427_100213 3300025231 Bacteria 51669
106 Ga0207427_101914 3300025231 Bacteria 6455
107 Ga0207427_107113 3300025231 Bacteria 1338
108 Ga0207427_113410 3300025231 Bacteria 803
109 Ga0209437_100045 3300025233 Bacteria 429809
110 Ga0209437_100090 3300025233 Bacteria 247138
111 Ga0209437_100138 3300025233 Bacteria 172839
112 Ga0209437_101146 3300025233 Bacteria 7944
113 Ga0209258_100038 3300025242 Bacteria 398959
114 Ga0209258_100047 3300025242 Bacteria 367869
115 Ga0209258_100118 3300025242 Bacteria 183558
116 Ga0209258_100529 3300025242 Bacteria 36394
117 Ga0209258_100571 3300025242 Bacteria 31414
118 Ga0209258_101185 3300025242 Bacteria 10492
119 Ga0209258_102294 3300025242 Bacteria 5099
120 Ga0209646_1000824 3300025246 Bacteria 10466
121 Ga0209026_1000114 3300025250 Bacteria 136985
122 Ga0209026_1000261 3300025250 Bacteria 65449
123 Ga0209026_1000431 3300025250 Bacteria 34966
124 Ga0209026_1001167 3300025250 Bacteria 12199
125 Ga0209026_1002583 3300025250 Bacteria 6652
126 Ga0209677_100109 3300025253 Bacteria 88712
127 Ga0209148_1000002 3300025254 Bacteria 2399500
128 Ga0209148_1000009 3300025254 Bacteria 1395625
129 Ga0209148_1000024 3300025254 Bacteria 669890
130 Ga0209148_1000054 3300025254 Bacteria 367869
131 Ga0209148_1000541 3300025254 Bacteria 36394
132 Ga0209759_1000204 3300025256 Bacteria 93642
133 Ga0209759_1000301 3300025256 Bacteria 67978
134 Ga0209759_1022877 3300025256 Bacteria 1389
135 Ga0209233_1000077 3300025261 Bacteria 349570
136 Ga0209233_1000323 3300025261 Bacteria 51669
137 Ga0209233_1006987 3300025261 Bacteria 3605
138 Ga0209455_1000025 3300025272 Bacteria 670673
139 Ga0209455_1000032 3300025272 Bacteria 514243
140 Ga0209455_1000052 3300025272 Bacteria 367804
141 Ga0209455_1003384 3300025272 Bacteria 5668
142 Ga0207647_10008312 3300025904 Bacteria 7444
143 Ga0207647_10015810 3300025904 Bacteria 5165
144 Ga0207647_10189660 3300025904 Bacteria 1191
145 Ga0207705_10057696 3300025909 Bacteria 2800
146 Ga0207654_10214198 3300025911 Bacteria 1274
147 Ga0207707_10012197 3300025912 Bacteria 7472
148 Ga0207671_10140861 3300025914 Bacteria 1858
149 Ga0207693_10321519 3300025915 Bacteria 1211
150 Ga0207660_10196905 3300025917 Bacteria 1572
151 Ga0207657_10030565 3300025919 Bacteria 4888
152 Ga0207657_10041098 3300025919 Bacteria 4091
153 Ga0207657_10083321 3300025919 Bacteria 2683
154 Ga0207657_10120903 3300025919 Bacteria 2154
155 Ga0207652_10239437 3300025921 Bacteria 1636
156 Ga0207694_10143746 3300025924 Bacteria 1919
157 Ga0207694_10262437 3300025924 Bacteria 1415
158 Ga0207700_10013581 3300025928 Bacteria 5306
159 Ga0207664_10000666 3300025929 Bacteria 23590
160 Ga0207664_10397642 3300025929 Bacteria 1225
161 Ga0207690_10000124 3300025932 Bacteria 63516
162 Ga0207690_10004321 3300025932 Bacteria 8391
163 Ga0207690_10127856 3300025932 Bacteria 1855
164 Ga0207690_10319398 3300025932 Bacteria 1220
165 Ga0207690_10335750 3300025932 Bacteria 1191
166 Ga0207690_10821160 3300025932 Bacteria 769
167 Ga0207690_11601577 3300025932 Bacteria 544
168 Ga0207706_10046998 3300025933 Bacteria 3820
169 Ga0207667_10045352 3300025949 Bacteria 4656
170 Ga0207667_10139918 3300025949 Bacteria 2492
171 Ga0207639_10153025 3300026041 Bacteria 1934
172 Ga0207639_10848150 3300026041 Bacteria 853
173 Ga0207674_10027147 3300026116 Bacteria 6063
174 Ga0307408_100856070 3300031548 Bacteria 829
175 Ga0373924_0078864 3300035410 Bacteria 1398
176 Ga0373935_0224968 3300035692 Unclassified 1305
177 Ga0395899_0005919 3300037312 Bacteria 9496
178 Ga0395899_0030653 3300037312 Bacteria 4044
179 Ga0395899_0254889 3300037312 Bacteria 1202
180 Ga0395899_0550804 3300037312 Unclassified 741
181 Ga0395900_0000369 3300037418 Bacteria 64866
182 Ga0395900_0073095 3300037418 Bacteria 3525
183 Ga0395900_0127152 3300037418 Bacteria 2613
184 Ga0395900_0208798 3300037418 Bacteria 1972
185 Ga0395898_0000249 3300037466 Bacteria 134019
186 Ga0395898_0104085 3300037466 Bacteria 2722
187 Ga0395898_1584328 3300037466 Unclassified 579
188 Ga0395905_1266684 3300037471 Unclassified 641
189 Ga0395901_0000728 3300038443 Bacteria 37416
190 Ga0395901_0001304 3300038443 Bacteria 26281
191 Ga0395901_0005382 3300038443 Bacteria 12949
192 Ga0395901_0009370 3300038443 Bacteria 9933
193 Ga0395901_0096206 3300038443 Bacteria 3103
194 Ga0395901_0111701 3300038443 Bacteria 2870
195 Ga0395901_0257489 3300038443 Bacteria 1817
196 Ga0395901_0777439 3300038443 Bacteria 948
197 Ga0436361_0097922 3300039447 Unclassified 1034
198 Ga0436361_0174615 3300039447 Bacteria 4446
199 Ga0436361_0985945 3300039447 Bacteria 4761
200 Ga0439465_0244446 3300041413 Bacteria 662
201 Ga0451797_0607481 3300041453 Bacteria 853
202 Ga0451843_0015220 3300041509 Bacteria 787
203 Ga0451855_0867152 3300041511 Bacteria 805
204 Ga0466965_0524872 3300044683 Unclassified 666
205 Ga0495642_0025945 3300046528 Bacteria 2325
206 Ga0495642_0118913 3300046528 Bacteria 1133
207 Ga0495642_0318727 3300046528 Bacteria 682
208 Ga0495687_004243 3300047443 Bacteria 9825
209 Ga0495686_0000190 3300047472 Bacteria 115114
210 Ga0496104_0423580 3300048907 Bacteria 1243
211 Ga0496113_0112781 3300048916 Bacteria 2118
212 Ga0496113_0579291 3300048916 Bacteria 899
213 Ga0496115_0000079 3300048918 Bacteria 89431
214 Ga0496117_0325789 3300048920 Bacteria 803
215 Ga0496124_0222978 3300048927 Bacteria 1416
216 Ga0501031_0379525 3300049568 Bacteria 914
217 Ga0501031_0730210 3300049568 Bacteria 635
218 Ga0501033_0041022 3300049570 Bacteria 3454
219 Ga0501033_0074563 3300049570 Bacteria 2491
220 Ga0501033_0653803 3300049570 Bacteria 718
221 Ga0501034_0010411 3300049571 Bacteria 9692
222 Ga0501034_0084158 3300049571 Bacteria 3183
223 Ga0501034_0141722 3300049571 Bacteria 2383
224 Ga0501034_1268792 3300049571 Bacteria 614
225 Ga0501036_0018668 3300049572 Bacteria 5815
226 Ga0501036_0089789 3300049572 Bacteria 2596
227 Ga0501036_0118959 3300049572 Bacteria 2231
228 Ga0501037_0011730 3300049573 Bacteria 6452
229 Ga0501037_0046071 3300049573 Bacteria 3199
230 Ga0501037_0692301 3300049573 Bacteria 679
231 Ga0501039_0180973 3300049575 Bacteria 1658
232 Ga0501039_0281596 3300049575 Bacteria 1307
233 Ga0501043_0032474 3300049579 Bacteria 4104
234 Ga0501043_0053255 3300049579 Bacteria 3178
235 Ga0501047_0013994 3300049581 Bacteria 7625
236 Ga0501047_0015840 3300049581 Bacteria 7183
237 Ga0501047_0024123 3300049581 Bacteria 5842
238 Ga0501047_0957914 3300049581 Bacteria 669
239 Ga0501048_0009973 3300049582 Bacteria 7112
240 Ga0501048_0238355 3300049582 Bacteria 1291
241 Ga0501070_0027585 3300049586 Bacteria 4763
242 Ga0501070_0156576 3300049586 Bacteria 1879
243 Ga0501080_0683472 3300049742 Bacteria 906
244 Ga0501080_1022319 3300049742 Bacteria 716
245 Ga0501035_0044998 3300049822 Bacteria 3972
246 Ga0501035_0072317 3300049822 Bacteria 3052
247 Ga0501035_0182377 3300049822 Bacteria 1808
248 Ga0501035_0212660 3300049822 Bacteria 1654
249 Ga0501035_0388636 3300049822 Bacteria 1163
250 Ga0501035_0483375 3300049822 Bacteria 1021
251 Ga0501044_0048774 3300049823 Bacteria 4373
252 Ga0501044_0345153 3300049823 Bacteria 1409
253 Ga0501044_0352993 3300049823 Bacteria 1390
254 Ga0501044_0382129 3300049823 Bacteria 1323
255 Ga0501044_0461500 3300049823 Bacteria 1175
256 Ga0501044_0465895 3300049823 Bacteria 1168
257 Ga0501044_0598002 3300049823 Bacteria 996
258 nmdc:mga03683_498087_c1 3300050489 Bacteria 590
259 nmdc:mga07m45_316066_c1 3300050496 Bacteria 908
260 Ga0500562_052636 3300053108 Bacteria 1090
261 Ga0500593_178090 3300053117 Bacteria 793
262 Ga0500616_0008116 3300053153 Bacteria 6566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0318727 Ga0495642_0318727_147_563 118
2 3300041453 Ga0451797_0607481 Ga0451797_0607481_17_412 127
3 3300041509 Ga0451843_0015220 Ga0451843_0015220_370_765 127
4 3300046528 Ga0495642_0025945 Ga0495642_0025945_1734_2147 133
5 3300014497 Ga0182008_10004435 Ga0182008_100044359 138
6 3300015261 Ga0182006_1012629 Ga0182006_10126292 138
7 3300025233 Ga0209437_100045 Ga0209437_10004544 138
8 3300031548 Ga0307408_100856070 Ga0307408_1008560702 139
9 3300046528 Ga0495642_0118913 Ga0495642_0118913_486_920 139
10 3300047443 Ga0495687_004243 Ga0495687_004243_350_781 139
11 3300049571 Ga0501034_0141722 Ga0501034_0141722_144_581 140
12 3300041511 Ga0451855_0867152 Ga0451855_0867152_136_570 141
13 iso_pu_bacteria 2643221629 2644167656 141
14 iso_pu_bacteria 2643221662 2644349116 141
15 iso_pu_bacteria 2687453130 2687583293 141
16 iso_pu_bacteria 2928963466 2928966714 141
17 iso_pu_bacteria 2939611941 2939615424 141
18 3300047472 Ga0495686_0000190 Ga0495686_0000190_71543_71980 142
19 3300048927 Ga0496124_0222978 Ga0496124_0222978_621_1109 142
20 3300035410 Ga0373924_0078864 Ga0373924_0078864_297_740 144
21 3300001989 JGI24739J22299_10094568 JGI24739J22299_100945682 145
22 3300001990 JGI24737J22298_10161982 JGI24737J22298_101619821 145
23 3300002067 JGI24735J21928_10006224 JGI24735J21928_100062242 145
24 3300002705 JGI25156J39149_1005911 JGI25156J39149_10059115 145
25 3300002705 JGI25156J39149_1007466 JGI25156J39149_10074663 145
26 3300002737 JGI25162J39368_1000597 JGI25162J39368_100059718 145
27 3300002737 JGI25162J39368_1003640 JGI25162J39368_10036404 145
28 3300002737 JGI25162J39368_1004685 JGI25162J39368_10046852 145
29 3300002738 JGI25154J39366_1012007 JGI25154J39366_10120072 145
30 3300002741 JGI25157J39369_1000370 JGI25157J39369_10003708 145
31 3300002741 JGI25157J39369_1001161 JGI25157J39369_10011617 145
32 3300002741 JGI25157J39369_1001724 JGI25157J39369_10017241 145
33 3300002772 JGI25164J39214_1000198 JGI25164J39214_100019842 145
34 3300002772 JGI25164J39214_1000259 JGI25164J39214_100025918 145
35 3300002772 JGI25164J39214_1006681 JGI25164J39214_10066812 145
36 3300003214 JGI25165J46597_1000354 JGI25165J46597_100035442 145
37 3300003214 JGI25165J46597_1000379 JGI25165J46597_100037932 145
38 3300003322 rootL2_10205861 rootL2_102058614 145
39 3300003323 rootH1_10049970 rootH1_100499701 145
40 3300003323 rootH1_10382948 rootH1_103829482 145
41 3300003752 Ga0055539_1000300 Ga0055539_100030010 145
42 3300003756 Ga0055533_1000167 Ga0055533_100016710 145
43 3300003756 Ga0055533_1000290 Ga0055533_10002903 145
44 3300003756 Ga0055533_1001291 Ga0055533_10012916 145
45 3300003759 Ga0055525_1000266 Ga0055525_100026613 145
46 3300003760 Ga0055527_1000044 Ga0055527_100004466 145
47 3300003760 Ga0055527_1000047 Ga0055527_100004718 145
48 3300003761 Ga0055535_1000040 Ga0055535_100004061 145
49 3300003761 Ga0055535_1000109 Ga0055535_100010933 145
50 3300003761 Ga0055535_1000295 Ga0055535_100029539 145
51 3300003761 Ga0055535_1000991 Ga0055535_10009919 145
52 3300003761 Ga0055535_1008754 Ga0055535_10087542 145
53 3300003762 Ga0055542_1000065 Ga0055542_100006556 145
54 3300003762 Ga0055542_1000108 Ga0055542_100010865 145
55 3300003762 Ga0055542_1000292 Ga0055542_100029236 145
56 3300003762 Ga0055542_1000524 Ga0055542_10005249 145
57 3300003762 Ga0055542_1000966 Ga0055542_10009666 145
58 3300003763 Ga0055529_1000049 Ga0055529_100004968 145
59 3300003763 Ga0055529_1000094 Ga0055529_100009442 145
60 3300003763 Ga0055529_1000406 Ga0055529_100040635 145
61 3300005336 Ga0070680_100390403 Ga0070680_1003904031 145
62 3300005337 Ga0070682_100004557 Ga0070682_1000045579 145
63 3300005337 Ga0070682_100019519 Ga0070682_1000195194 145
64 3300005339 Ga0070660_100127074 Ga0070660_1001270741 145
65 3300005339 Ga0070660_100171553 Ga0070660_1001715532 145
66 3300005366 Ga0070659_100043600 Ga0070659_1000436003 145
67 3300005366 Ga0070659_100044900 Ga0070659_1000449005 145
68 3300005366 Ga0070659_100176798 Ga0070659_1001767982 145
69 3300005366 Ga0070659_100221851 Ga0070659_1002218512 145
70 3300005366 Ga0070659_100845685 Ga0070659_1008456851 145
71 3300005435 Ga0070714_100000694 Ga0070714_10000069419 145
72 3300005435 Ga0070714_100011953 Ga0070714_1000119537 145
73 3300005436 Ga0070713_100000941 Ga0070713_1000009417 145
74 3300005457 Ga0070662_100024492 Ga0070662_1000244922 145
75 3300005458 Ga0070681_10015355 Ga0070681_100153558 145
76 3300005530 Ga0070679_100302962 Ga0070679_1003029622 145
77 3300005530 Ga0070679_100439149 Ga0070679_1004391492 145
78 3300005535 Ga0070684_100429934 Ga0070684_1004299342 145
79 3300005539 Ga0068853_100072740 Ga0068853_1000727402 145
80 3300005539 Ga0068853_100152821 Ga0068853_1001528212 145
81 3300005546 Ga0070696_100002388 Ga0070696_1000023882 145
82 3300005547 Ga0070693_100052893 Ga0070693_1000528932 145
83 3300005563 Ga0068855_100012611 Ga0068855_10001261110 145
84 3300005577 Ga0068857_100471619 Ga0068857_1004716192 145
85 3300005614 Ga0068856_100645133 Ga0068856_1006451331 145
86 3300006175 Ga0070712_100194605 Ga0070712_1001946052 145
87 3300006195 Ga0075366_10627134 Ga0075366_106271342 145
88 3300009093 Ga0105240_10799393 Ga0105240_107993932 145
89 3300009174 Ga0105241_10144309 Ga0105241_101443092 145
90 3300009174 Ga0105241_10488549 Ga0105241_104885492 145
91 3300009551 Ga0105238_10022760 Ga0105238_100227609 145
92 3300010375 Ga0105239_10086792 Ga0105239_100867923 145
93 3300010375 Ga0105239_10605829 Ga0105239_106058292 145
94 3300013100 Ga0157373_10004598 Ga0157373_100045982 145
95 3300013102 Ga0157371_10046447 Ga0157371_100464472 145
96 3300013102 Ga0157371_10456801 Ga0157371_104568012 145
97 3300013104 Ga0157370_10037206 Ga0157370_100372062 145
98 3300013104 Ga0157370_10826574 Ga0157370_108265741 145
99 3300013105 Ga0157369_10064267 Ga0157369_100642674 145
100 3300013105 Ga0157369_10235665 Ga0157369_102356652 145
101 3300013307 Ga0157372_10086350 Ga0157372_100863503 145
102 3300014497 Ga0182008_10045120 Ga0182008_100451202 145
103 3300014497 Ga0182008_10050174 Ga0182008_100501742 145
104 3300014497 Ga0182008_10120889 Ga0182008_101208891 145
105 3300015261 Ga0182006_1006979 Ga0182006_10069793 145
106 3300015262 Ga0182007_10015730 Ga0182007_100157303 145
107 3300015262 Ga0182007_10022104 Ga0182007_100221042 145
108 3300015262 Ga0182007_10042591 Ga0182007_100425912 145
109 3300015687 Ga0183368_1004 Ga0183368_1004589 145
110 3300020082 Ga0206353_11434229 Ga0206353_114342291 145
111 3300021361 Ga0213872_10009739 Ga0213872_100097393 145
112 3300025206 Ga0209435_108694 Ga0209435_1086942 145
113 3300025226 Ga0209674_100016 Ga0209674_10001684 145
114 3300025226 Ga0209674_100026 Ga0209674_100026394 145
115 3300025226 Ga0209674_100063 Ga0209674_100063187 145
116 3300025226 Ga0209674_100587 Ga0209674_10058716 145
117 3300025228 Ga0209672_100017 Ga0209672_10001754 145
118 3300025228 Ga0209672_100024 Ga0209672_10002463 145
119 3300025228 Ga0209672_100173 Ga0209672_10017314 145
120 3300025228 Ga0209672_102819 Ga0209672_1028193 145
121 3300025230 Ga0209563_100067 Ga0209563_10006762 145
122 3300025231 Ga0207427_100101 Ga0207427_10010135 145
123 3300025231 Ga0207427_100213 Ga0207427_1002137 145
124 3300025231 Ga0207427_101914 Ga0207427_1019146 145
125 3300025231 Ga0207427_107113 Ga0207427_1071131 145
126 3300025231 Ga0207427_113410 Ga0207427_1134101 145
127 3300025233 Ga0209437_100090 Ga0209437_100090140 145
128 3300025233 Ga0209437_100138 Ga0209437_10013863 145
129 3300025233 Ga0209437_101146 Ga0209437_1011467 145
130 3300025242 Ga0209258_100038 Ga0209258_100038258 145
131 3300025242 Ga0209258_100047 Ga0209258_10004763 145
132 3300025242 Ga0209258_100118 Ga0209258_10011849 145
133 3300025242 Ga0209258_100529 Ga0209258_10052911 145
134 3300025242 Ga0209258_100571 Ga0209258_10057123 145
135 3300025242 Ga0209258_101185 Ga0209258_1011853 145
136 3300025242 Ga0209258_102294 Ga0209258_1022944 145
137 3300025246 Ga0209646_1000824 Ga0209646_10008243 145
138 3300025250 Ga0209026_1000114 Ga0209026_100011497 145
139 3300025250 Ga0209026_1000261 Ga0209026_100026128 145
140 3300025250 Ga0209026_1000431 Ga0209026_100043125 145
141 3300025250 Ga0209026_1001167 Ga0209026_10011675 145
142 3300025250 Ga0209026_1002583 Ga0209026_10025835 145
143 3300025253 Ga0209677_100109 Ga0209677_10010932 145
144 3300025254 Ga0209148_1000002 Ga0209148_1000002491 145
145 3300025254 Ga0209148_1000009 Ga0209148_10000091158 145
146 3300025254 Ga0209148_1000024 Ga0209148_1000024334 145
147 3300025254 Ga0209148_1000054 Ga0209148_100005463 145
148 3300025254 Ga0209148_1000541 Ga0209148_100054111 145
149 3300025256 Ga0209759_1000204 Ga0209759_10002043 145
150 3300025256 Ga0209759_1000301 Ga0209759_100030132 145
151 3300025256 Ga0209759_1022877 Ga0209759_10228772 145
152 3300025261 Ga0209233_1000077 Ga0209233_1000077237 145
153 3300025261 Ga0209233_1000323 Ga0209233_10003237 145
154 3300025261 Ga0209233_1006987 Ga0209233_10069871 145
155 3300025272 Ga0209455_1000025 Ga0209455_1000025334 145
156 3300025272 Ga0209455_1000032 Ga0209455_100003254 145
157 3300025272 Ga0209455_1000052 Ga0209455_100005263 145
158 3300025272 Ga0209455_1003384 Ga0209455_10033844 145
159 3300025904 Ga0207647_10008312 Ga0207647_100083125 145
160 3300025904 Ga0207647_10015810 Ga0207647_100158103 145
161 3300025904 Ga0207647_10189660 Ga0207647_101896602 145
162 3300025909 Ga0207705_10057696 Ga0207705_100576963 145
163 3300025911 Ga0207654_10214198 Ga0207654_102141982 145
164 3300025912 Ga0207707_10012197 Ga0207707_100121978 145
165 3300025914 Ga0207671_10140861 Ga0207671_101408611 145
166 3300025915 Ga0207693_10321519 Ga0207693_103215192 145
167 3300025917 Ga0207660_10196905 Ga0207660_101969052 145
168 3300025919 Ga0207657_10030565 Ga0207657_100305652 145
169 3300025919 Ga0207657_10041098 Ga0207657_100410982 145
170 3300025919 Ga0207657_10083321 Ga0207657_100833212 145
171 3300025919 Ga0207657_10120903 Ga0207657_101209032 145
172 3300025921 Ga0207652_10239437 Ga0207652_102394372 145
173 3300025924 Ga0207694_10143746 Ga0207694_101437463 145
174 3300025924 Ga0207694_10262437 Ga0207694_102624372 145
175 3300025928 Ga0207700_10013581 Ga0207700_100135817 145
176 3300025929 Ga0207664_10000666 Ga0207664_1000066619 145
177 3300025929 Ga0207664_10397642 Ga0207664_103976423 145
178 3300025932 Ga0207690_10000124 Ga0207690_1000012461 145
179 3300025932 Ga0207690_10004321 Ga0207690_100043213 145
180 3300025932 Ga0207690_10127856 Ga0207690_101278562 145
181 3300025932 Ga0207690_10319398 Ga0207690_103193982 145
182 3300025932 Ga0207690_10335750 Ga0207690_103357501 145
183 3300025932 Ga0207690_10821160 Ga0207690_108211601 145
184 3300025932 Ga0207690_11601577 Ga0207690_116015771 145
185 3300025933 Ga0207706_10046998 Ga0207706_100469983 145
186 3300025949 Ga0207667_10045352 Ga0207667_100453522 145
187 3300025949 Ga0207667_10139918 Ga0207667_101399182 145
188 3300026041 Ga0207639_10153025 Ga0207639_101530251 145
189 3300026041 Ga0207639_10848150 Ga0207639_108481502 145
190 3300026116 Ga0207674_10027147 Ga0207674_100271477 145
191 3300035692 Ga0373935_0224968 Ga0373935_0224968_417_878 145
192 3300037312 Ga0395899_0005919 Ga0395899_0005919_7380_7817 145
193 3300037312 Ga0395899_0030653 Ga0395899_0030653_2787_3224 145
194 3300037312 Ga0395899_0254889 Ga0395899_0254889_536_973 145
195 3300037312 Ga0395899_0550804 Ga0395899_0550804_48_485 145
196 3300037418 Ga0395900_0000369 Ga0395900_0000369_17249_17686 145
197 3300037418 Ga0395900_0073095 Ga0395900_0073095_1519_1965 145
198 3300037418 Ga0395900_0127152 Ga0395900_0127152_1713_2150 145
199 3300037418 Ga0395900_0208798 Ga0395900_0208798_1522_1959 145
200 3300037466 Ga0395898_0000249 Ga0395898_0000249_65884_66321 145
201 3300037466 Ga0395898_0104085 Ga0395898_0104085_2023_2460 145
202 3300037466 Ga0395898_1584328 Ga0395898_1584328_71_508 145
203 3300037471 Ga0395905_1266684 Ga0395905_1266684_28_507 145
204 3300038443 Ga0395901_0000728 Ga0395901_0000728_16800_17237 145
205 3300038443 Ga0395901_0001304 Ga0395901_0001304_18995_19480 145
206 3300038443 Ga0395901_0005382 Ga0395901_0005382_3074_3520 145
207 3300038443 Ga0395901_0009370 Ga0395901_0009370_5942_6379 145
208 3300038443 Ga0395901_0096206 Ga0395901_0096206_842_1279 145
209 3300038443 Ga0395901_0111701 Ga0395901_0111701_1227_1664 145
210 3300038443 Ga0395901_0257489 Ga0395901_0257489_224_661 145
211 3300038443 Ga0395901_0777439 Ga0395901_0777439_338_775 145
212 3300039447 Ga0436361_0097922 Ga0436361_0097922_61_522 145
213 3300039447 Ga0436361_0174615 Ga0436361_0174615_1878_2342 145
214 3300039447 Ga0436361_0985945 Ga0436361_0985945_3688_4149 145
215 3300041413 Ga0439465_0244446 Ga0439465_0244446_138_587 145
216 3300044683 Ga0466965_0524872 Ga0466965_0524872_45_494 145
217 3300048907 Ga0496104_0423580 Ga0496104_0423580_316_753 145
218 3300048916 Ga0496113_0112781 Ga0496113_0112781_46_483 145
219 3300048916 Ga0496113_0579291 Ga0496113_0579291_385_822 145
220 3300048918 Ga0496115_0000079 Ga0496115_0000079_6628_7065 145
221 3300048920 Ga0496117_0325789 Ga0496117_0325789_116_565 145
222 3300049568 Ga0501031_0379525 Ga0501031_0379525_238_687 145
223 3300049568 Ga0501031_0730210 Ga0501031_0730210_71_508 145
224 3300049570 Ga0501033_0041022 Ga0501033_0041022_710_1147 145
225 3300049570 Ga0501033_0074563 Ga0501033_0074563_1033_1545 145
226 3300049570 Ga0501033_0653803 Ga0501033_0653803_114_581 145
227 3300049571 Ga0501034_0010411 Ga0501034_0010411_1356_1793 145
228 3300049571 Ga0501034_0084158 Ga0501034_0084158_2044_2481 145
229 3300049571 Ga0501034_1268792 Ga0501034_1268792_88_537 145
230 3300049572 Ga0501036_0018668 Ga0501036_0018668_3298_3735 145
231 3300049572 Ga0501036_0089789 Ga0501036_0089789_1427_1864 145
232 3300049572 Ga0501036_0118959 Ga0501036_0118959_780_1217 145
233 3300049573 Ga0501037_0011730 Ga0501037_0011730_2392_2829 145
234 3300049573 Ga0501037_0046071 Ga0501037_0046071_1506_1955 145
235 3300049573 Ga0501037_0692301 Ga0501037_0692301_155_592 145
236 3300049575 Ga0501039_0180973 Ga0501039_0180973_389_826 145
237 3300049575 Ga0501039_0281596 Ga0501039_0281596_821_1270 145
238 3300049579 Ga0501043_0032474 Ga0501043_0032474_2856_3293 145
239 3300049579 Ga0501043_0053255 Ga0501043_0053255_566_1078 145
240 3300049581 Ga0501047_0013994 Ga0501047_0013994_4765_5202 145
241 3300049581 Ga0501047_0015840 Ga0501047_0015840_741_1178 145
242 3300049581 Ga0501047_0024123 Ga0501047_0024123_3591_4058 145
243 3300049581 Ga0501047_0957914 Ga0501047_0957914_200_637 145
244 3300049582 Ga0501048_0009973 Ga0501048_0009973_5763_6200 145
245 3300049582 Ga0501048_0238355 Ga0501048_0238355_97_534 145
246 3300049586 Ga0501070_0027585 Ga0501070_0027585_2038_2484 145
247 3300049586 Ga0501070_0156576 Ga0501070_0156576_1201_1638 145
248 3300049742 Ga0501080_0683472 Ga0501080_0683472_155_592 145
249 3300049742 Ga0501080_1022319 Ga0501080_1022319_234_671 145
250 3300049822 Ga0501035_0044998 Ga0501035_0044998_2762_3199 145
251 3300049822 Ga0501035_0072317 Ga0501035_0072317_2462_2899 145
252 3300049822 Ga0501035_0182377 Ga0501035_0182377_111_578 145
253 3300049822 Ga0501035_0212660 Ga0501035_0212660_955_1485 145
254 3300049822 Ga0501035_0388636 Ga0501035_0388636_264_701 145
255 3300049822 Ga0501035_0483375 Ga0501035_0483375_350_787 145
256 3300049823 Ga0501044_0048774 Ga0501044_0048774_32_547 145
257 3300049823 Ga0501044_0345153 Ga0501044_0345153_10_465 145
258 3300049823 Ga0501044_0352993 Ga0501044_0352993_189_626 145
259 3300049823 Ga0501044_0382129 Ga0501044_0382129_557_994 145
260 3300049823 Ga0501044_0461500 Ga0501044_0461500_477_914 145
261 3300049823 Ga0501044_0465895 Ga0501044_0465895_97_573 145
262 3300049823 Ga0501044_0598002 Ga0501044_0598002_414_851 145
263 3300050489 nmdc:mga03683_498087_c1 nmdc:mga03683_498087_c1_107_556 145
264 3300050496 nmdc:mga07m45_316066_c1 nmdc:mga07m45_316066_c1_38_487 145
265 3300053108 Ga0500562_052636 Ga0500562_052636_493_942 145
266 3300053117 Ga0500593_178090 Ga0500593_178090_59_508 145
267 3300053153 Ga0500616_0008116 Ga0500616_0008116_1293_1742 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

32

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.9009 4 143
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8491 3 143
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8476 2 145
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8452 4 143
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8334 1 144
ID Description Score Start End Superfamily
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8596 4 145 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8491 3 143 3.40.50.620
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8469 4 145 3.40.50.620
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8334 1 144 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8303 1 144 3.40.50.620
ID Description Score Start End GO Terms
AF-A3WUR7-F1-model_v4 Putative universal stress protein 0.8985 1 145
AF-A3WUR7-F1-model_v4 Putative universal stress protein 0.8921 1 145
AF-A0A840SK17-F1-model_v4 Nucleotide-binding universal stress UspA family protein 0.883 1 145
AF-N8RBB1-F1-model_v4 Universal stress protein 0.8758 2 143 GO:0005737
AF-A0A1I1X4A9-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.8743 1 145

Feature Viewer

pLDDT pTM Quality
87.4 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map