F374867

General Info

Members Datasets Scaffolds Average Seq Length
267 176 534 326

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10012670|Ga0265340_100126703
Length 372
Sequence MSRVEFSVRIDNCCGSLRGQKPHPAQQSVECRAALVWYETFVLRVSKRIAKKREGLLFGLPRIRAAGIAYAAAAIIAATSALADDWPSRSITLIVPFGAGSGSDYVARIISARLSEILGQQIIIENVGGPDGYQMVLGAVDTFAQGQSLYKKPAYDSIKDFSPVALAVEQPLLLTVRNELPVKDLKEFVAYVKANQSKMQFGSAGVGAAPHLACYQLTSAIGASVTHVPYRGSAQALQDMIAGRLDYYCPLAIGAIPLITGNSIKALAILTPNRSPLLPDLPTAREQGVDFADGDYWMGFFVPQGTPEPIVTKLNAAINSAVETPSVQSRLRELATTVVAPDRRSPAYLRTLVQSEVTKWAAIIKASGIEPQ

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 2818991467 Bosea vestrisii 3192 Isolate Unclassified
176 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 17.6
Rhizosphere 72.66
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10012670 3300031247 Bacteria 4451
2 JGI25159J45721_1002370 3300002987 Bacteria 7186
3 JGI25406J46586_10042587 3300003203 Bacteria 1587
4 Ga0065165_1000044 3300005262 Bacteria 203774
5 Ga0070676_10284321 3300005328 Bacteria 1116
6 Ga0070670_100066168 3300005331 Bacteria 3100
7 Ga0070670_100133182 3300005331 Bacteria 2147
8 Ga0068869_100020250 3300005334 Bacteria 4560
9 Ga0068869_100285396 3300005334 Bacteria 1328
10 Ga0068868_100030917 3300005338 Bacteria 4108
11 Ga0070689_100006438 3300005340 Bacteria 8124
12 Ga0070668_100277597 3300005347 Bacteria 1398
13 Ga0070675_100047201 3300005354 Bacteria 3529
14 Ga0070675_100101986 3300005354 Bacteria 2418
15 Ga0070674_100015978 3300005356 Bacteria 4699
16 Ga0070674_100021002 3300005356 Bacteria 4184
17 Ga0070674_100214515 3300005356 Bacteria 1494
18 Ga0070673_100026677 3300005364 Bacteria 4271
19 Ga0070673_100035937 3300005364 Bacteria 3761
20 Ga0070659_100039482 3300005366 Bacteria 3685
21 Ga0070701_10052225 3300005438 Bacteria 2123
22 Ga0070711_100232256 3300005439 Bacteria 1438
23 Ga0070663_100021804 3300005455 Bacteria 4267
24 Ga0070698_100202001 3300005471 Bacteria 1923
25 Ga0070684_100088784 3300005535 Bacteria 2747
26 Ga0068853_100204782 3300005539 Bacteria 1797
27 Ga0070672_100041912 3300005543 Bacteria 3523
28 Ga0070686_100018248 3300005544 Bacteria 4113
29 Ga0070664_100027981 3300005564 Bacteria 4689
30 Ga0070664_100143446 3300005564 Bacteria 2104
31 Ga0068854_100026037 3300005578 Bacteria 4016
32 Ga0068864_100033822 3300005618 Bacteria 4346
33 Ga0068864_100049075 3300005618 Bacteria 3630
34 Ga0068870_10017936 3300005840 Bacteria 3409
35 Ga0068870_10033963 3300005840 Bacteria 2607
36 Ga0068863_100030151 3300005841 Bacteria 5181
37 Ga0068863_100274028 3300005841 Bacteria 1634
38 Ga0068858_100030804 3300005842 Bacteria 4982
39 Ga0068860_100083118 3300005843 Bacteria 3045
40 Ga0068862_100060220 3300005844 Bacteria 3260
41 Ga0081455_10151483 3300005937 Bacteria 1788
42 Ga0081455_10175471 3300005937 Bacteria 1628
43 Ga0081540_1000313 3300005983 Bacteria 50236
44 Ga0081539_10003190 3300005985 Bacteria 20734
45 Ga0070717_10196661 3300006028 Bacteria 1764
46 Ga0075368_10043613 3300006042 Bacteria 1768
47 Ga0070712_100002220 3300006175 Bacteria 11948
48 Ga0070712_100010533 3300006175 Bacteria 5837
49 Ga0075362_10019411 3300006177 Bacteria 2826
50 Ga0075366_10140857 3300006195 Bacteria 1458
51 Ga0075366_10221490 3300006195 Bacteria 1153
52 Ga0097621_100090050 3300006237 Bacteria 2566
53 Ga0068871_100073067 3300006358 Bacteria 2827
54 Ga0075428_100028896 3300006844 Bacteria 6136
55 Ga0075428_100165743 3300006844 Bacteria 2397
56 Ga0075431_100072196 3300006847 Bacteria 3562
57 Ga0075431_100344729 3300006847 Bacteria 1499
58 Ga0075433_10011487 3300006852 Bacteria 7130
59 Ga0075433_10093805 3300006852 Bacteria 2656
60 Ga0075434_100002827 3300006871 Bacteria 15376
61 Ga0075434_100004583 3300006871 Bacteria 12479
62 Ga0075429_100208313 3300006880 Bacteria 1713
63 Ga0068865_100124042 3300006881 Bacteria 1925
64 Ga0068865_100173078 3300006881 Bacteria 1657
65 Ga0099795_10000393 3300007788 Bacteria 7907
66 Ga0099795_10012506 3300007788 Bacteria 2577
67 Ga0105240_10109640 3300009093 Bacteria 3342
68 Ga0111539_10033770 3300009094 Bacteria 6209
69 Ga0111539_10080900 3300009094 Bacteria 3821
70 Ga0111539_10138864 3300009094 Bacteria 2846
71 Ga0105245_10100795 3300009098 Bacteria 2672
72 Ga0105247_10008160 3300009101 Bacteria 6397
73 Ga0105247_10039234 3300009101 Bacteria 2893
74 Ga0114129_10015568 3300009147 Bacteria 10811
75 Ga0105243_10069910 3300009148 Bacteria 2833
76 Ga0105242_10145964 3300009176 Bacteria 2058
77 Ga0105248_10035171 3300009177 Bacteria 5605
78 Ga0105248_10474314 3300009177 Bacteria 1410
79 Ga0105237_10318891 3300009545 Bacteria 1558
80 Ga0105237_10455202 3300009545 Bacteria 1286
81 Ga0105238_10381609 3300009551 Bacteria 1401
82 Ga0105249_10163952 3300009553 Bacteria 2150
83 Ga0105249_10218869 3300009553 Bacteria 1873
84 Ga0105239_10242227 3300010375 Bacteria 2024
85 Ga0157369_10491180 3300013105 Bacteria 1270
86 Ga0163162_10058414 3300013306 Bacteria 3886
87 Ga0163162_10674507 3300013306 Bacteria 1156
88 Ga0157375_10122174 3300013308 Bacteria 2715
89 Ga0157375_10505320 3300013308 Bacteria 1373
90 Ga0163163_10050335 3300014325 Bacteria 4102
91 Ga0157380_10111051 3300014326 Bacteria 2304
92 Ga0157380_10209236 3300014326 Bacteria 1737
93 Ga0157377_10002968 3300014745 Bacteria 7589
94 Ga0157376_10038379 3300014969 Bacteria 3897
95 Ga0157376_10275991 3300014969 Bacteria 1581
96 Ga0213876_10170662 3300021384 Bacteria 1157
97 Ga0209130_1000089 3300025284 Bacteria 152711
98 Ga0209025_1000034 3300025294 Bacteria 413205
99 Ga0207682_10000330 3300025893 Bacteria 21622
100 Ga0207642_10005583 3300025899 Bacteria 4117
101 Ga0207710_10049038 3300025900 Bacteria 1891
102 Ga0207688_10000626 3300025901 Bacteria 17390
103 Ga0207688_10091267 3300025901 Bacteria 1749
104 Ga0207680_10033667 3300025903 Bacteria 2925
105 Ga0207685_10047043 3300025905 Bacteria 1645
106 Ga0207645_10015832 3300025907 Bacteria 4997
107 Ga0207645_10169983 3300025907 Bacteria 1428
108 Ga0207643_10000774 3300025908 Bacteria 19490
109 Ga0207643_10037637 3300025908 Bacteria 2715
110 Ga0207695_10084411 3300025913 Bacteria 3206
111 Ga0207693_10003801 3300025915 Bacteria 12853
112 Ga0207693_10023566 3300025915 Bacteria 4886
113 Ga0207662_10030437 3300025918 Bacteria 3132
114 Ga0207657_10113910 3300025919 Bacteria 2231
115 Ga0207650_10033944 3300025925 Bacteria 3699
116 Ga0207650_10104418 3300025925 Bacteria 2186
117 Ga0207659_10042594 3300025926 Bacteria 3184
118 Ga0207659_10109487 3300025926 Bacteria 2097
119 Ga0207687_10068042 3300025927 Bacteria 2536
120 Ga0207644_10039248 3300025931 Bacteria 3341
121 Ga0207706_10010359 3300025933 Bacteria 8515
122 Ga0207670_10018829 3300025936 Bacteria 4206
123 Ga0207670_10122866 3300025936 Bacteria 1890
124 Ga0207704_10056999 3300025938 Bacteria 2397
125 Ga0207704_10185225 3300025938 Bacteria 1508
126 Ga0207691_10012628 3300025940 Bacteria 8093
127 Ga0207691_10018234 3300025940 Bacteria 6649
128 Ga0207691_10116405 3300025940 Bacteria 2372
129 Ga0207711_10006880 3300025941 Bacteria 9548
130 Ga0207689_10006173 3300025942 Bacteria 10605
131 Ga0207689_10019550 3300025942 Bacteria 5707
132 Ga0207679_10031585 3300025945 Bacteria 3708
133 Ga0207712_10173602 3300025961 Bacteria 1687
134 Ga0207668_10088442 3300025972 Bacteria 2269
135 Ga0207640_10122568 3300025981 Bacteria 1865
136 Ga0207658_10021690 3300025986 Bacteria 4463
137 Ga0207658_10188181 3300025986 Bacteria 1714
138 Ga0207658_10249344 3300025986 Bacteria 1508
139 Ga0207703_10027589 3300026035 Bacteria 4471
140 Ga0207678_10004882 3300026067 Bacteria 12044
141 Ga0207708_10004733 3300026075 Bacteria 10015
142 Ga0207702_10034807 3300026078 Bacteria 4213
143 Ga0207641_10036266 3300026088 Bacteria 4115
144 Ga0207641_10173607 3300026088 Bacteria 1969
145 Ga0207641_10312279 3300026088 Bacteria 1488
146 Ga0207648_10004741 3300026089 Bacteria 13897
147 Ga0207648_10356310 3300026089 Unclassified 1320
148 Ga0207676_10022934 3300026095 Bacteria 4596
149 Ga0207675_100003208 3300026118 Bacteria 16041
150 Ga0207675_100435432 3300026118 Bacteria 1297
151 Ga0207683_10003556 3300026121 Bacteria 13593
152 Ga0207683_10009400 3300026121 Bacteria 8330
153 Ga0207428_10047522 3300027907 Bacteria 3446
154 Ga0268266_10213231 3300028379 Bacteria 1772
155 Ga0268265_10084713 3300028380 Bacteria 2513
156 Ga0265332_10003642 3300031238 Bacteria 7386
157 Ga0265340_10024641 3300031247 Bacteria 3054
158 Ga0265342_10000210 3300031712 Bacteria 65961
159 Ga0265342_10068028 3300031712 Bacteria 2082
160 Ga0307416_100578891 3300032002 Bacteria 1200
161 Ga0373926_0037036 3300035083 Bacteria 1735
162 Ga0373951_0060317 3300035091 Bacteria 949
163 Ga0373945_0055328 3300035116 Unclassified 1469
164 Ga0373931_0047217 3300035691 Bacteria 2279
165 Ga0373931_0049914 3300035691 Bacteria 2225
166 Ga0373927_0062997 3300035695 Bacteria 2398
167 Ga0373947_0037597 3300035725 Bacteria 2873
168 Ga0373925_0024375 3300037068 Bacteria 4418
169 Ga0436364_1415563 3300037853 Bacteria 2344
170 Ga0436365_0294235 3300039437 Bacteria 1231
171 Ga0436365_0296348 3300039437 Bacteria 1480
172 Ga0436365_0932375 3300039437 Bacteria 2087
173 Ga0436365_1457707 3300039437 Bacteria 3035
174 Ga0436363_0636705 3300039450 Unclassified 1763
175 Ga0495629_0058501 3300046459 Bacteria 2695
176 Ga0495653_0149627 3300046463 Bacteria 1633
177 Ga0495662_0058849 3300046476 Bacteria 1856
178 Ga0495618_0144993 3300046514 Bacteria 1518
179 Ga0495620_0035907 3300046515 Bacteria 2224
180 Ga0495630_0080148 3300046517 Bacteria 2463
181 Ga0495643_0069776 3300046522 Bacteria 1847
182 Ga0495640_0014763 3300046533 Bacteria 5900
183 Ga0495640_0285300 3300046533 Bacteria 1028
184 Ga0495645_0247359 3300046543 Bacteria 1187
185 Ga0495624_0155133 3300046690 Bacteria 1400
186 Ga0495581_0260148 3300047315 Bacteria 1015
187 Ga0495684_0220389 3300047471 Bacteria 1391
188 Ga0495614_0106544 3300048089 Bacteria 1229
189 Ga0496100_0037072 3300048903 Bacteria 3079
190 Ga0496100_0081065 3300048903 Bacteria 2192
191 Ga0496100_0142405 3300048903 Bacteria 1701
192 Ga0496100_0300468 3300048903 Bacteria 1201
193 Ga0496101_0014164 3300048904 Bacteria 5356
194 Ga0496102_0014715 3300048905 Bacteria 6801
195 Ga0496104_0000262 3300048907 Bacteria 46388
196 Ga0496104_0006129 3300048907 Bacteria 10553
197 Ga0496104_0014990 3300048907 Bacteria 7011
198 Ga0496104_0073689 3300048907 Bacteria 3248
199 Ga0496104_0080523 3300048907 Bacteria 3105
200 Ga0496104_0100498 3300048907 Bacteria 2769
201 Ga0496104_0111764 3300048907 Bacteria 2620
202 Ga0496104_0166711 3300048907 Bacteria 2112
203 Ga0496104_0624155 3300048907 Bacteria 987
204 Ga0496105_0142499 3300048908 Bacteria 1972
205 Ga0496105_0284494 3300048908 Bacteria 1332
206 Ga0496106_0025060 3300048909 Bacteria 4437
207 Ga0496106_0324712 3300048909 Bacteria 1235
208 Ga0496107_0005533 3300048910 Bacteria 8646
209 Ga0496107_0125595 3300048910 Bacteria 1892
210 Ga0496108_0112036 3300048911 Bacteria 2334
211 Ga0496108_0151305 3300048911 Bacteria 2002
212 Ga0496109_0014359 3300048912 Bacteria 6891
213 Ga0496109_0375799 3300048912 Bacteria 1342
214 Ga0496109_0616210 3300048912 Bacteria 1022
215 Ga0496110_0038881 3300048913 Bacteria 4141
216 Ga0496110_0079455 3300048913 Bacteria 2920
217 Ga0496110_0236991 3300048913 Bacteria 1660
218 Ga0496111_0034959 3300048914 Bacteria 3589
219 Ga0496111_0124720 3300048914 Bacteria 1903
220 Ga0496111_0246691 3300048914 Bacteria 1326
221 Ga0496112_0002917 3300048915 Bacteria 13926
222 Ga0496112_0011300 3300048915 Bacteria 8146
223 Ga0496112_0012464 3300048915 Bacteria 7817
224 Ga0496112_0101689 3300048915 Bacteria 2844
225 Ga0496113_0004617 3300048916 Bacteria 8488
226 Ga0496113_0004917 3300048916 Bacteria 8278
227 Ga0496113_0007806 3300048916 Bacteria 6914
228 Ga0496114_0046473 3300048917 Bacteria 3608
229 Ga0496114_0095057 3300048917 Bacteria 2535
230 Ga0496114_0209378 3300048917 Bacteria 1710
231 Ga0496114_0238854 3300048917 Bacteria 1597
232 Ga0496115_0003259 3300048918 Bacteria 11644
233 Ga0496115_0008789 3300048918 Bacteria 7484
234 Ga0496115_0054326 3300048918 Bacteria 3216
235 Ga0496115_0214560 3300048918 Bacteria 1589
236 Ga0496122_0006463 3300048925 Bacteria 13444
237 Ga0496123_0002932 3300048926 Bacteria 19952
238 Ga0496126_0084700 3300048929 Bacteria 2796
239 Ga0501072_0005488 3300049588 Bacteria 9654
240 Ga0501075_0179060 3300049591 Bacteria 1618
241 Ga0501076_0139888 3300049592 Unclassified 1966
242 Ga0501079_0322536 3300049741 Unclassified 1209
243 Ga0501083_0016896 3300049744 Bacteria 5097
244 nmdc:mga0yw44_7510_c1 3300050492 Bacteria 5369
245 nmdc:mga0k408_4192_c1 3300050493 Bacteria 2153
246 nmdc:mga05p37_59232_c1 3300050507 Bacteria 4716
247 nmdc:mga09592_159781_c1 3300050508 Bacteria 1946
248 nmdc:mga0qj67_12705_c1 3300050509 Bacteria 6350
249 nmdc:mga08y16_25727_c1 3300050511 Bacteria 6209
250 nmdc:mga0n895_614210_c1 3300050512 Bacteria 1088
251 nmdc:mga0n895_6241_c1 3300050512 Bacteria 10092
252 nmdc:mga0n895_71080_c1 3300050512 Bacteria 3450
253 nmdc:mga0n895_8014_c1 3300050512 Bacteria 9111
254 nmdc:mga0a205_53465_c1 3300050515 Bacteria 3898
255 Ga0495601_0126774 3300053077 Bacteria 1661
256 Ga0495601_0285462 3300053077 Bacteria 1076
257 Ga0495612_0103132 3300053078 Bacteria 1216
258 Ga0495595_0061211 3300053084 Bacteria 1763
259 Ga0500577_0067592 3300053142 Unclassified 1393
260 Ga0500604_0051697 3300053151 Bacteria 1270
261 Ga0500616_0011349 3300053153 Bacteria 5269
262 Ga0500616_0144577 3300053153 Bacteria 1107
263 Ga0500622_0010862 3300053156 Bacteria 4975
264 Ga0501084_0084632 3300054114 Bacteria 2662
265 Ga0501082_0000025 3300060353 Bacteria 103262
266 2819722311 2818991467 Bacteria 5893227
267 2939636155 2939631187 Bacteria 6118131
268 Ga0265340_10012670
269 JGI25159J45721_1002370
270 JGI25406J46586_10042587
271 Ga0065165_1000044
272 Ga0070676_10284321
273 Ga0070670_100066168
274 Ga0070670_100133182
275 Ga0068869_100020250
276 Ga0068869_100285396
277 Ga0068868_100030917
278 Ga0070689_100006438
279 Ga0070668_100277597
280 Ga0070675_100047201
281 Ga0070675_100101986
282 Ga0070674_100015978
283 Ga0070674_100021002
284 Ga0070674_100214515
285 Ga0070673_100026677
286 Ga0070673_100035937
287 Ga0070659_100039482
288 Ga0070701_10052225
289 Ga0070711_100232256
290 Ga0070663_100021804
291 Ga0070698_100202001
292 Ga0070684_100088784
293 Ga0068853_100204782
294 Ga0070672_100041912
295 Ga0070686_100018248
296 Ga0070664_100027981
297 Ga0070664_100143446
298 Ga0068854_100026037
299 Ga0068864_100033822
300 Ga0068864_100049075
301 Ga0068870_10017936
302 Ga0068870_10033963
303 Ga0068863_100030151
304 Ga0068863_100274028
305 Ga0068858_100030804
306 Ga0068860_100083118
307 Ga0068862_100060220
308 Ga0081455_10151483
309 Ga0081455_10175471
310 Ga0081540_1000313
311 Ga0081539_10003190
312 Ga0070717_10196661
313 Ga0075368_10043613
314 Ga0070712_100002220
315 Ga0070712_100010533
316 Ga0075362_10019411
317 Ga0075366_10140857
318 Ga0075366_10221490
319 Ga0097621_100090050
320 Ga0068871_100073067
321 Ga0075428_100028896
322 Ga0075428_100165743
323 Ga0075431_100072196
324 Ga0075431_100344729
325 Ga0075433_10011487
326 Ga0075433_10093805
327 Ga0075434_100002827
328 Ga0075434_100004583
329 Ga0075429_100208313
330 Ga0068865_100124042
331 Ga0068865_100173078
332 Ga0099795_10000393
333 Ga0099795_10012506
334 Ga0105240_10109640
335 Ga0111539_10033770
336 Ga0111539_10080900
337 Ga0111539_10138864
338 Ga0105245_10100795
339 Ga0105247_10008160
340 Ga0105247_10039234
341 Ga0114129_10015568
342 Ga0105243_10069910
343 Ga0105242_10145964
344 Ga0105248_10035171
345 Ga0105248_10474314
346 Ga0105237_10318891
347 Ga0105237_10455202
348 Ga0105238_10381609
349 Ga0105249_10163952
350 Ga0105249_10218869
351 Ga0105239_10242227
352 Ga0157369_10491180
353 Ga0163162_10058414
354 Ga0163162_10674507
355 Ga0157375_10122174
356 Ga0157375_10505320
357 Ga0163163_10050335
358 Ga0157380_10111051
359 Ga0157380_10209236
360 Ga0157377_10002968
361 Ga0157376_10038379
362 Ga0157376_10275991
363 Ga0213876_10170662
364 Ga0209130_1000089
365 Ga0209025_1000034
366 Ga0207682_10000330
367 Ga0207642_10005583
368 Ga0207710_10049038
369 Ga0207688_10000626
370 Ga0207688_10091267
371 Ga0207680_10033667
372 Ga0207685_10047043
373 Ga0207645_10015832
374 Ga0207645_10169983
375 Ga0207643_10000774
376 Ga0207643_10037637
377 Ga0207695_10084411
378 Ga0207693_10003801
379 Ga0207693_10023566
380 Ga0207662_10030437
381 Ga0207657_10113910
382 Ga0207650_10033944
383 Ga0207650_10104418
384 Ga0207659_10042594
385 Ga0207659_10109487
386 Ga0207687_10068042
387 Ga0207644_10039248
388 Ga0207706_10010359
389 Ga0207670_10018829
390 Ga0207670_10122866
391 Ga0207704_10056999
392 Ga0207704_10185225
393 Ga0207691_10012628
394 Ga0207691_10018234
395 Ga0207691_10116405
396 Ga0207711_10006880
397 Ga0207689_10006173
398 Ga0207689_10019550
399 Ga0207679_10031585
400 Ga0207712_10173602
401 Ga0207668_10088442
402 Ga0207640_10122568
403 Ga0207658_10021690
404 Ga0207658_10188181
405 Ga0207658_10249344
406 Ga0207703_10027589
407 Ga0207678_10004882
408 Ga0207708_10004733
409 Ga0207702_10034807
410 Ga0207641_10036266
411 Ga0207641_10173607
412 Ga0207641_10312279
413 Ga0207648_10004741
414 Ga0207648_10356310
415 Ga0207676_10022934
416 Ga0207675_100003208
417 Ga0207675_100435432
418 Ga0207683_10003556
419 Ga0207683_10009400
420 Ga0207428_10047522
421 Ga0268266_10213231
422 Ga0268265_10084713
423 Ga0265332_10003642
424 Ga0265340_10024641
425 Ga0265342_10000210
426 Ga0265342_10068028
427 Ga0307416_100578891
428 Ga0373926_0037036
429 Ga0373951_0060317
430 Ga0373945_0055328
431 Ga0373931_0047217
432 Ga0373931_0049914
433 Ga0373927_0062997
434 Ga0373947_0037597
435 Ga0373925_0024375
436 Ga0436364_1415563
437 Ga0436365_0294235
438 Ga0436365_0296348
439 Ga0436365_0932375
440 Ga0436365_1457707
441 Ga0436363_0636705
442 Ga0495629_0058501
443 Ga0495653_0149627
444 Ga0495662_0058849
445 Ga0495618_0144993
446 Ga0495620_0035907
447 Ga0495630_0080148
448 Ga0495643_0069776
449 Ga0495640_0014763
450 Ga0495640_0285300
451 Ga0495645_0247359
452 Ga0495624_0155133
453 Ga0495581_0260148
454 Ga0495684_0220389
455 Ga0495614_0106544
456 Ga0496100_0037072
457 Ga0496100_0081065
458 Ga0496100_0142405
459 Ga0496100_0300468
460 Ga0496101_0014164
461 Ga0496102_0014715
462 Ga0496104_0000262
463 Ga0496104_0006129
464 Ga0496104_0014990
465 Ga0496104_0073689
466 Ga0496104_0080523
467 Ga0496104_0100498
468 Ga0496104_0111764
469 Ga0496104_0166711
470 Ga0496104_0624155
471 Ga0496105_0142499
472 Ga0496105_0284494
473 Ga0496106_0025060
474 Ga0496106_0324712
475 Ga0496107_0005533
476 Ga0496107_0125595
477 Ga0496108_0112036
478 Ga0496108_0151305
479 Ga0496109_0014359
480 Ga0496109_0375799
481 Ga0496109_0616210
482 Ga0496110_0038881
483 Ga0496110_0079455
484 Ga0496110_0236991
485 Ga0496111_0034959
486 Ga0496111_0124720
487 Ga0496111_0246691
488 Ga0496112_0002917
489 Ga0496112_0011300
490 Ga0496112_0012464
491 Ga0496112_0101689
492 Ga0496113_0004617
493 Ga0496113_0004917
494 Ga0496113_0007806
495 Ga0496114_0046473
496 Ga0496114_0095057
497 Ga0496114_0209378
498 Ga0496114_0238854
499 Ga0496115_0003259
500 Ga0496115_0008789
501 Ga0496115_0054326
502 Ga0496115_0214560
503 Ga0496122_0006463
504 Ga0496123_0002932
505 Ga0496126_0084700
506 Ga0501072_0005488
507 Ga0501075_0179060
508 Ga0501076_0139888
509 Ga0501079_0322536
510 Ga0501083_0016896
511 nmdc:mga0yw44_7510_c1
512 nmdc:mga0k408_4192_c1
513 nmdc:mga05p37_59232_c1
514 nmdc:mga09592_159781_c1
515 nmdc:mga0qj67_12705_c1
516 nmdc:mga08y16_25727_c1
517 nmdc:mga0n895_614210_c1
518 nmdc:mga0n895_6241_c1
519 nmdc:mga0n895_71080_c1
520 nmdc:mga0n895_8014_c1
521 nmdc:mga0a205_53465_c1
522 Ga0495601_0126774
523 Ga0495601_0285462
524 Ga0495612_0103132
525 Ga0495595_0061211
526 Ga0500577_0067592
527 Ga0500604_0051697
528 Ga0500616_0011349
529 Ga0500616_0144577
530 Ga0500622_0010862
531 Ga0501084_0084632
532 Ga0501082_0000025
533 2819722311
534 2939636155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

106

369

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9502 21 318
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9471 21 318
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9467 23 318
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9405 23 318
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9243 24 315
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9621 121 238 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9198 121 243 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9158 121 238 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9144 20 318 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9112 121 242 3.40.190.10
ID Description Score Start End GO Terms
AF-J2SVG2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9789 48 318
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9787 46 318
AF-A0A439F197-F1-model_v4 deleted 0.978 75 318
AF-A0A4Q3P7R6-F1-model_v4 deleted 0.9774 97 318
AF-A0A4Q2LCI4-F1-model_v4 deleted 0.9738 35 318

Map