F374840

General Info

Members Datasets Scaffolds Average Seq Length
267 177 267 249

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10000376|Ga0207677_1000037610
Length 268
Sequence MTRKAATTSPPAPLPSPAMSEGMRYERVGAAAVLTIDRPERRNAVDRAAAEGFRAGLREFEADDGARVLILTGAGGAAFCAGADLKAMDLEVDHPDGPMGPTRLTPSKPAIAAVDGWCLAGGVELALWCDLRIATPQSTFGLFERRWGVPLVDGGTQRLPRIVGMGRALELILLGRPVGAEEAHRIGLVNELVEPGKHLDRALELAERIASFPQETMLADRQAAIEGFGLPLKDGIALEHELGRQTLHVALEGAQRFSSGEGRHGEGV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 13.11
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000405 3300001977 Bacteria 6405
2 Ga0070683_100095010 3300005329 Bacteria 2802
3 Ga0070683_100315910 3300005329 Bacteria 1486
4 Ga0070677_10000048 3300005333 Bacteria 37331
5 Ga0070682_100000029 3300005337 Bacteria 183516
6 Ga0068868_100000451 3300005338 Bacteria 27446
7 Ga0068868_100002935 3300005338 Bacteria 11829
8 Ga0070691_10028085 3300005341 Bacteria 2627
9 Ga0070668_100065734 3300005347 Bacteria 2813
10 Ga0070671_100504379 3300005355 Bacteria 1041
11 Ga0070674_100000033 3300005356 Bacteria 63982
12 Ga0070674_100010008 3300005356 Bacteria 5709
13 Ga0070674_100510603 3300005356 Bacteria 1002
14 Ga0070673_100032178 3300005364 Bacteria 3945
15 Ga0070688_100295989 3300005365 Bacteria 1168
16 Ga0070659_100033215 3300005366 Bacteria 4006
17 Ga0070659_100117967 3300005366 Bacteria 2146
18 Ga0070713_100415897 3300005436 Bacteria 1258
19 Ga0070710_10077192 3300005437 Bacteria 1935
20 Ga0070711_100008682 3300005439 Bacteria 6232
21 Ga0070700_100003681 3300005441 Bacteria 7925
22 Ga0070663_100017122 3300005455 Bacteria 4723
23 Ga0070678_100018900 3300005456 Bacteria 4477
24 Ga0070662_100000008 3300005457 Bacteria 168754
25 Ga0070662_100379388 3300005457 Bacteria 1163
26 Ga0070681_10003882 3300005458 Bacteria 14072
27 Ga0068867_100000179 3300005459 Bacteria 41694
28 Ga0070679_100000823 3300005530 Bacteria 26958
29 Ga0070684_100047241 3300005535 Bacteria 3730
30 Ga0068853_100001640 3300005539 Bacteria 16358
31 Ga0070672_100254761 3300005543 Bacteria 1479
32 Ga0070693_100000793 3300005547 Bacteria 13960
33 Ga0070665_100000120 3300005548 Bacteria 148340
34 Ga0070665_100555088 3300005548 Bacteria 1161
35 Ga0068855_100748687 3300005563 Bacteria 1042
36 Ga0070664_100015666 3300005564 Bacteria 6204
37 Ga0070664_100129393 3300005564 Bacteria 2217
38 Ga0068857_100363955 3300005577 Bacteria 1341
39 Ga0068854_100005952 3300005578 Bacteria 7726
40 Ga0068854_100361487 3300005578 Bacteria 1191
41 Ga0068856_100040534 3300005614 Bacteria 4575
42 Ga0068864_100009102 3300005618 Bacteria 8185
43 Ga0068866_10000002 3300005718 Bacteria 394090
44 Ga0068866_10041459 3300005718 Bacteria 2284
45 Ga0068863_100009454 3300005841 Bacteria 9511
46 Ga0068858_100000035 3300005842 Bacteria 140466
47 Ga0068858_100000042 3300005842 Bacteria 132482
48 Ga0068860_100005398 3300005843 Bacteria 12971
49 Ga0081455_10187878 3300005937 Bacteria 1559
50 Ga0081455_10300493 3300005937 Bacteria 1152
51 Ga0075365_10196912 3300006038 Bacteria 1411
52 Ga0070715_10000015 3300006163 Bacteria 152816
53 Ga0070716_100039172 3300006173 Bacteria 2629
54 Ga0075435_100115174 3300007076 Bacteria 2238
55 Ga0105245_10000150 3300009098 Bacteria 66121
56 Ga0105245_10000327 3300009098 Bacteria 44888
57 Ga0105245_10002476 3300009098 Bacteria 16694
58 Ga0105243_10119891 3300009148 Bacteria 2216
59 Ga0105242_10087004 3300009176 Bacteria 2623
60 Ga0105237_10610377 3300009545 Bacteria 1098
61 Ga0105238_10000240 3300009551 Bacteria 61138
62 Ga0105249_10000095 3300009553 Bacteria 121300
63 Ga0105249_10127652 3300009553 Bacteria 2424
64 Ga0105249_10195794 3300009553 Bacteria 1975
65 Ga0105239_10060695 3300010375 Bacteria 4150
66 Ga0105239_10925431 3300010375 Bacteria 1001
67 Ga0105246_10038448 3300011119 Bacteria 3217
68 Ga0157370_10008336 3300013104 Bacteria 11178
69 Ga0157369_10357250 3300013105 Bacteria 1517
70 Ga0157374_10000668 3300013296 Bacteria 30198
71 Ga0157374_10004683 3300013296 Bacteria 11486
72 Ga0157375_10000723 3300013308 Bacteria 29095
73 Ga0163163_10519208 3300014325 Unclassified 1253
74 Ga0157377_10000518 3300014745 Bacteria 16361
75 Ga0157379_10104017 3300014968 Bacteria 2548
76 Ga0163161_10000058 3300017792 Bacteria 114035
77 Ga0207682_10000168 3300025893 Bacteria 30073
78 Ga0207642_10000001 3300025899 Bacteria 714030
79 Ga0207642_10000003 3300025899 Bacteria 650651
80 Ga0207642_10079024 3300025899 Bacteria 1592
81 Ga0207688_10009044 3300025901 Bacteria 5422
82 Ga0207685_10000001 3300025905 Bacteria 604473
83 Ga0207693_10089626 3300025915 Bacteria 2411
84 Ga0207663_10018381 3300025916 Bacteria 3917
85 Ga0207652_10001431 3300025921 Bacteria 21145
86 Ga0207694_10000067 3300025924 Bacteria 128108
87 Ga0207694_10148790 3300025924 Bacteria 1886
88 Ga0207687_10000021 3300025927 Bacteria 226396
89 Ga0207687_10000099 3300025927 Bacteria 63345
90 Ga0207687_10043591 3300025927 Bacteria 3092
91 Ga0207664_10077791 3300025929 Bacteria 2689
92 Ga0207644_10062622 3300025931 Bacteria 2699
93 Ga0207690_10030092 3300025932 Bacteria 3459
94 Ga0207690_10072941 3300025932 Bacteria 2372
95 Ga0207706_10000016 3300025933 Bacteria 170697
96 Ga0207706_10018493 3300025933 Bacteria 6271
97 Ga0207686_10217284 3300025934 Bacteria 1378
98 Ga0207709_10051031 3300025935 Bacteria 2533
99 Ga0207709_10106379 3300025935 Bacteria 1866
100 Ga0207669_10000137 3300025937 Bacteria 35016
101 Ga0207669_10024582 3300025937 Bacteria 3240
102 Ga0207669_10095366 3300025937 Bacteria 1950
103 Ga0207704_10024261 3300025938 Bacteria 3285
104 Ga0207665_10050900 3300025939 Bacteria 2787
105 Ga0207691_10290712 3300025940 Bacteria 1405
106 Ga0207661_10024131 3300025944 Bacteria 4605
107 Ga0207661_10584604 3300025944 Bacteria 1024
108 Ga0207679_10040059 3300025945 Bacteria 3351
109 Ga0207679_10104879 3300025945 Bacteria 2219
110 Ga0207667_10217920 3300025949 Bacteria 1956
111 Ga0207667_10591072 3300025949 Bacteria 1120
112 Ga0207651_10020827 3300025960 Bacteria 3968
113 Ga0207712_10000003 3300025961 Bacteria 615314
114 Ga0207712_10071656 3300025961 Bacteria 2493
115 Ga0207668_10030731 3300025972 Bacteria 3532
116 Ga0207640_10004089 3300025981 Bacteria 7880
117 Ga0207677_10000376 3300026023 Bacteria 30827
118 Ga0207703_10000060 3300026035 Bacteria 134334
119 Ga0207703_10000067 3300026035 Bacteria 125623
120 Ga0207703_10625514 3300026035 Bacteria 1020
121 Ga0207639_10001333 3300026041 Bacteria 16674
122 Ga0207678_10275051 3300026067 Bacteria 1445
123 Ga0207708_10007741 3300026075 Bacteria 7957
124 Ga0207702_10186057 3300026078 Bacteria 1915
125 Ga0207641_10003078 3300026088 Bacteria 15029
126 Ga0207648_10000228 3300026089 Bacteria 60032
127 Ga0207683_10019636 3300026121 Bacteria 5775
128 Ga0207683_10035762 3300026121 Bacteria 4320
129 Ga0268266_10000023 3300028379 Bacteria 501899
130 Ga0268265_10563723 3300028380 Bacteria 1083
131 Ga0268264_10005149 3300028381 Bacteria 11080
132 Ga0265337_1000013 3300028556 Bacteria 82926
133 Ga0265326_10000012 3300028558 Bacteria 175352
134 Ga0265322_10000003 3300028654 Bacteria 468671
135 Ga0265336_10002736 3300028666 Bacteria 7131
136 Ga0265328_10000700 3300031239 Bacteria 15518
137 Ga0265320_10000001 3300031240 Bacteria 847191
138 Ga0265329_10001196 3300031242 Bacteria 12724
139 Ga0265339_10004334 3300031249 Bacteria 9691
140 Ga0265331_10001257 3300031250 Bacteria 19008
141 Ga0265327_10000003 3300031251 Bacteria 852750
142 Ga0265314_10000044 3300031711 Bacteria 207337
143 Ga0373937_0010103 3300036401 Bacteria 8231
144 Ga0373937_0021054 3300036401 Bacteria 5851
145 Ga0373937_0644576 3300036401 Bacteria 1005
146 Ga0395898_0450440 3300037466 Bacteria 1226
147 Ga0395901_0220444 3300038443 Bacteria 1983
148 Ga0451853_0441842 3300041512 Bacteria 822
149 Ga0451853_0632861 3300041512 Bacteria 2150
150 Ga0466963_0000710 3300044694 Bacteria 16256
151 Ga0466967_0160094 3300045976 Bacteria 2112
152 Ga0466967_0715289 3300045976 Bacteria 992
153 Ga0495592_0001063 3300046454 Bacteria 19010
154 Ga0495592_0015237 3300046454 Bacteria 5837
155 Ga0495592_0031092 3300046454 Bacteria 4037
156 Ga0495592_0088599 3300046454 Bacteria 2224
157 Ga0495603_0000302 3300046455 Bacteria 26272
158 Ga0495603_0000672 3300046455 Bacteria 19385
159 Ga0495629_0317197 3300046459 Bacteria 1066
160 Ga0495641_0000187 3300046461 Bacteria 47961
161 Ga0495641_0023926 3300046461 Bacteria 3025
162 Ga0495651_0174342 3300046462 Bacteria 1528
163 Ga0495582_0000005 3300046473 Bacteria 156170
164 Ga0495662_0000022 3300046476 Bacteria 54342
165 Ga0495608_0000406 3300046511 Bacteria 30178
166 Ga0495608_0019975 3300046511 Bacteria 4607
167 Ga0495608_0062991 3300046511 Bacteria 2435
168 Ga0495620_0000344 3300046515 Bacteria 32387
169 Ga0495628_0000070 3300046516 Bacteria 80592
170 Ga0495628_0004688 3300046516 Bacteria 12060
171 Ga0495628_0031488 3300046516 Bacteria 4290
172 Ga0495628_0031670 3300046516 Bacteria 4277
173 Ga0495628_0140105 3300046516 Bacteria 1846
174 Ga0495628_0290052 3300046516 Bacteria 1213
175 Ga0495628_0293512 3300046516 Bacteria 1205
176 Ga0495628_0309290 3300046516 Bacteria 1168
177 Ga0495630_0001004 3300046517 Bacteria 19578
178 Ga0495630_0135610 3300046517 Bacteria 1870
179 Ga0495644_0000600 3300046523 Bacteria 15119
180 Ga0495652_0006039 3300046529 Bacteria 11327
181 Ga0495640_0034817 3300046533 Bacteria 3566
182 Ga0495586_0001124 3300046535 Bacteria 15053
183 Ga0495587_0101815 3300046536 Bacteria 1654
184 Ga0495598_0004671 3300046537 Bacteria 2982
185 Ga0495621_0005720 3300046539 Bacteria 3592
186 Ga0495645_0009243 3300046543 Bacteria 6890
187 Ga0495667_0000015 3300046559 Bacteria 200377
188 Ga0495634_0000592 3300046642 Bacteria 35197
189 Ga0495634_0000910 3300046642 Bacteria 28215
190 Ga0495634_0011662 3300046642 Bacteria 6393
191 Ga0495634_0097255 3300046642 Bacteria 1906
192 Ga0495635_0000009 3300046663 Bacteria 259024
193 Ga0495635_0115182 3300046663 Bacteria 1835
194 Ga0495657_0008606 3300046675 Bacteria 7787
195 Ga0495599_0187453 3300046678 Bacteria 1273
196 Ga0495647_0000037 3300046681 Bacteria 42482
197 Ga0495658_0000019 3300046683 Bacteria 91606
198 Ga0495669_0000382 3300046684 Bacteria 22273
199 Ga0495613_0000257 3300046689 Bacteria 50000
200 Ga0495613_0014270 3300046689 Bacteria 5896
201 Ga0495624_0000013 3300046690 Bacteria 115278
202 Ga0495624_0032449 3300046690 Bacteria 3386
203 Ga0495670_0057675 3300046691 Bacteria 1949
204 Ga0495649_0003377 3300046694 Bacteria 10795
205 Ga0495604_0000033 3300047317 Bacteria 134810
206 Ga0495676_0000646 3300047321 Bacteria 28924
207 Ga0495680_0000023 3300047322 Bacteria 116444
208 Ga0495680_0001062 3300047322 Bacteria 30410
209 Ga0495680_0002013 3300047322 Bacteria 21325
210 Ga0495685_007491 3300047447 Bacteria 3605
211 Ga0495593_0062769 3300047673 Bacteria 1941
212 Ga0495602_0001999 3300048088 Bacteria 20491
213 Ga0496100_0000116 3300048903 Bacteria 45781
214 Ga0496100_0007372 3300048903 Bacteria 6065
215 Ga0496101_0000003 3300048904 Bacteria 406565
216 Ga0496101_0026168 3300048904 Bacteria 4055
217 Ga0496101_0118595 3300048904 Bacteria 1999
218 Ga0496102_0024171 3300048905 Bacteria 5401
219 Ga0496104_0000003 3300048907 Bacteria 669219
220 Ga0496104_0000147 3300048907 Bacteria 65131
221 Ga0496104_0159959 3300048907 Bacteria 2160
222 Ga0496104_0381458 3300048907 Unclassified 1322
223 Ga0496105_0000008 3300048908 Bacteria 335652
224 Ga0496105_0000138 3300048908 Bacteria 48896
225 Ga0496105_0011410 3300048908 Bacteria 7019
226 Ga0496105_0014661 3300048908 Bacteria 6241
227 Ga0496106_0000013 3300048909 Bacteria 202263
228 Ga0496106_0000177 3300048909 Bacteria 45808
229 Ga0496106_0027758 3300048909 Bacteria 4216
230 Ga0496107_0000081 3300048910 Bacteria 45824
231 Ga0496107_0044209 3300048910 Bacteria 3201
232 Ga0496108_0000002 3300048911 Bacteria 700890
233 Ga0496108_0004351 3300048911 Bacteria 11388
234 Ga0496109_0000001 3300048912 Bacteria 700852
235 Ga0496109_0000237 3300048912 Bacteria 53743
236 Ga0496109_0083279 3300048912 Bacteria 2949
237 Ga0496110_0016197 3300048913 Bacteria 6218
238 Ga0496110_0020908 3300048913 Bacteria 5529
239 Ga0496110_0041459 3300048913 Bacteria 4017
240 Ga0496111_0008241 3300048914 Bacteria 6891
241 Ga0496111_0040566 3300048914 Bacteria 3339
242 Ga0496112_0065433 3300048915 Bacteria 3587
243 Ga0496112_0711770 3300048915 Bacteria 932
244 Ga0496113_0050418 3300048916 Bacteria 3103
245 Ga0496113_0221942 3300048916 Bacteria 1506
246 Ga0496114_0240246 3300048917 Bacteria 1593
247 Ga0496115_0006099 3300048918 Bacteria 8806
248 Ga0501042_0079236 3300049578 Bacteria 2353
249 Ga0501075_0000855 3300049591 Bacteria 19203
250 Ga0501075_0301056 3300049591 Bacteria 1222
251 Ga0501076_0150554 3300049592 Bacteria 1893
252 Ga0501081_0373606 3300049743 Bacteria 1053
253 nmdc:mga08y16_462699_c1 3300050511 Bacteria 1292
254 nmdc:mga0rr50_157568_c1 3300050513 Bacteria 1840
255 nmdc:mga0a205_12_c3 3300050515 Bacteria 28260
256 Ga0495601_0001565 3300053077 Bacteria 12649
257 Ga0495612_0000843 3300053078 Bacteria 12451
258 Ga0495612_0006267 3300053078 Bacteria 4900
259 Ga0495612_0062205 3300053078 Bacteria 1547
260 Ga0495595_0000109 3300053084 Bacteria 37617
261 Ga0495595_0017403 3300053084 Bacteria 3093
262 Ga0495619_0000024 3300053085 Bacteria 180821
263 Ga0495619_0000192 3300053085 Bacteria 45153
264 Ga0495619_0000980 3300053085 Bacteria 18685
265 Ga0495619_0024858 3300053085 Bacteria 3843
266 Ga0495619_0050609 3300053085 Bacteria 2743
267 Ga0500614_003324 3300053123 Bacteria 3470

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0381458 Ga0496104_0381458_592_1302 223
2 3300005456 Ga0070678_100018900 Ga0070678_1000189005 227
3 3300026121 Ga0207683_10035762 Ga0207683_100357625 227
4 3300046689 Ga0495613_0000257 Ga0495613_0000257_23959_24711 232
5 3300048909 Ga0496106_0000013 Ga0496106_0000013_197102_197863 233
6 3300046511 Ga0495608_0019975 Ga0495608_0019975_3523_4275 234
7 3300046642 Ga0495634_0097255 Ga0495634_0097255_949_1698 234
8 3300005337 Ga0070682_100000029 Ga0070682_100000029155 235
9 3300005458 Ga0070681_10003882 Ga0070681_100038824 235
10 3300005530 Ga0070679_100000823 Ga0070679_10000082322 235
11 3300010375 Ga0105239_10925431 Ga0105239_109254312 235
12 3300025921 Ga0207652_10001431 Ga0207652_1000143112 235
13 3300046675 Ga0495657_0008606 Ga0495657_0008606_3278_4030 235
14 3300046681 Ga0495647_0000037 Ga0495647_0000037_31849_32601 235
15 3300046690 Ga0495624_0032449 Ga0495624_0032449_202_954 235
16 3300047322 Ga0495680_0000023 Ga0495680_0000023_44059_44820 235
17 3300005329 Ga0070683_100315910 Ga0070683_1003159102 236
18 3300005535 Ga0070684_100047241 Ga0070684_1000472414 236
19 3300005578 Ga0068854_100005952 Ga0068854_1000059526 236
20 3300006173 Ga0070716_100039172 Ga0070716_1000391723 236
21 3300009098 Ga0105245_10000327 Ga0105245_1000032710 236
22 3300009553 Ga0105249_10000095 Ga0105249_100000955 236
23 3300014968 Ga0157379_10104017 Ga0157379_101040172 236
24 3300025927 Ga0207687_10000021 Ga0207687_1000002110 236
25 3300025939 Ga0207665_10050900 Ga0207665_100509002 236
26 3300025961 Ga0207712_10000003 Ga0207712_10000003499 236
27 3300025981 Ga0207640_10004089 Ga0207640_100040896 236
28 3300046684 Ga0495669_0000382 Ga0495669_0000382_3540_4301 236
29 3300047447 Ga0495685_007491 Ga0495685_007491_1982_2734 236
30 3300048907 Ga0496104_0000003 Ga0496104_0000003_141497_142258 236
31 3300048908 Ga0496105_0000008 Ga0496105_0000008_330609_331370 236
32 3300048911 Ga0496108_0000002 Ga0496108_0000002_228257_229009 236
33 3300048912 Ga0496109_0000001 Ga0496109_0000001_228219_228971 236
34 3300005329 Ga0070683_100095010 Ga0070683_1000950103 237
35 3300005842 Ga0068858_100000042 Ga0068858_100000042126 237
36 3300009098 Ga0105245_10000150 Ga0105245_1000015032 237
37 3300009176 Ga0105242_10087004 Ga0105242_100870042 237
38 3300009553 Ga0105249_10195794 Ga0105249_101957943 237
39 3300013308 Ga0157375_10000723 Ga0157375_1000072319 237
40 3300014325 Ga0163163_10519208 Ga0163163_105192082 237
41 3300025927 Ga0207687_10000099 Ga0207687_1000009931 237
42 3300025934 Ga0207686_10217284 Ga0207686_102172841 237
43 3300026035 Ga0207703_10000060 Ga0207703_1000006010 237
44 3300046454 Ga0495592_0031092 Ga0495592_0031092_2534_3247 237
45 3300046461 Ga0495641_0000187 Ga0495641_0000187_28722_29474 237
46 3300046511 Ga0495608_0062991 Ga0495608_0062991_259_1011 237
47 3300046516 Ga0495628_0031488 Ga0495628_0031488_471_1223 237
48 3300046516 Ga0495628_0140105 Ga0495628_0140105_911_1663 237
49 3300046516 Ga0495628_0309290 Ga0495628_0309290_185_937 237
50 3300046517 Ga0495630_0001004 Ga0495630_0001004_9549_10310 237
51 3300046517 Ga0495630_0135610 Ga0495630_0135610_487_1239 237
52 3300046663 Ga0495635_0115182 Ga0495635_0115182_785_1549 237
53 3300046678 Ga0495599_0187453 Ga0495599_0187453_123_875 237
54 3300046689 Ga0495613_0014270 Ga0495613_0014270_185_937 237
55 3300047321 Ga0495676_0000646 Ga0495676_0000646_26848_27600 237
56 3300048908 Ga0496105_0014661 Ga0496105_0014661_2659_3411 237
57 3300048911 Ga0496108_0004351 Ga0496108_0004351_6410_7162 237
58 3300048913 Ga0496110_0016197 Ga0496110_0016197_4993_5745 237
59 3300053077 Ga0495601_0001565 Ga0495601_0001565_5374_6126 237
60 3300053078 Ga0495612_0006267 Ga0495612_0006267_3054_3806 237
61 3300053123 Ga0500614_003324 Ga0500614_003324_1782_2534 237
62 3300036401 Ga0373937_0644576 Ga0373937_0644576_153_905 242
63 3300005338 Ga0068868_100000451 Ga0068868_10000045110 246
64 3300005356 Ga0070674_100000033 Ga0070674_10000003324 246
65 3300005457 Ga0070662_100000008 Ga0070662_10000000898 246
66 3300005563 Ga0068855_100748687 Ga0068855_1007486871 246
67 3300005718 Ga0068866_10000002 Ga0068866_1000000278 246
68 3300005843 Ga0068860_100005398 Ga0068860_10000539810 246
69 3300006163 Ga0070715_10000015 Ga0070715_1000001590 246
70 3300025899 Ga0207642_10000001 Ga0207642_10000001530 246
71 3300025899 Ga0207642_10000003 Ga0207642_10000003530 246
72 3300025905 Ga0207685_10000001 Ga0207685_10000001336 246
73 3300025933 Ga0207706_10000016 Ga0207706_1000001676 246
74 3300025937 Ga0207669_10000137 Ga0207669_1000013724 246
75 3300025949 Ga0207667_10591072 Ga0207667_105910721 246
76 3300028381 Ga0268264_10005149 Ga0268264_100051497 246
77 3300046516 Ga0495628_0290052 Ga0495628_0290052_22_762 246
78 3300053078 Ga0495612_0000843 Ga0495612_0000843_4552_5292 246
79 3300005937 Ga0081455_10300493 Ga0081455_103004931 247
80 3300049743 Ga0501081_0373606 Ga0501081_0373606_174_926 248
81 3300053085 Ga0495619_0050609 Ga0495619_0050609_437_1183 248
82 3300005366 Ga0070659_100033215 Ga0070659_1000332153 249
83 3300005937 Ga0081455_10187878 Ga0081455_101878782 249
84 3300025932 Ga0207690_10030092 Ga0207690_100300922 249
85 3300037466 Ga0395898_0450440 Ga0395898_0450440_406_1194 249
86 3300038443 Ga0395901_0220444 Ga0395901_0220444_849_1637 249
87 3300041512 Ga0451853_0441842 Ga0451853_0441842_40_792 249
88 3300046454 Ga0495592_0088599 Ga0495592_0088599_645_1430 249
89 3300046461 Ga0495641_0023926 Ga0495641_0023926_981_1766 249
90 3300046516 Ga0495628_0031670 Ga0495628_0031670_2181_2966 249
91 3300046523 Ga0495644_0000600 Ga0495644_0000600_7668_8417 249
92 3300046529 Ga0495652_0006039 Ga0495652_0006039_4314_5099 249
93 3300046537 Ga0495598_0004671 Ga0495598_0004671_26_775 249
94 3300046691 Ga0495670_0057675 Ga0495670_0057675_1184_1933 249
95 3300049578 Ga0501042_0079236 Ga0501042_0079236_1141_1890 249
96 3300001977 JGI24746J21847_1000405 JGI24746J21847_10004055 250
97 3300005333 Ga0070677_10000048 Ga0070677_1000004822 250
98 3300005338 Ga0068868_100002935 Ga0068868_1000029352 250
99 3300005341 Ga0070691_10028085 Ga0070691_100280852 250
100 3300005347 Ga0070668_100065734 Ga0070668_1000657343 250
101 3300005355 Ga0070671_100504379 Ga0070671_1005043791 250
102 3300005356 Ga0070674_100010008 Ga0070674_1000100088 250
103 3300005356 Ga0070674_100510603 Ga0070674_1005106031 250
104 3300005364 Ga0070673_100032178 Ga0070673_1000321782 250
105 3300005365 Ga0070688_100295989 Ga0070688_1002959891 250
106 3300005366 Ga0070659_100117967 Ga0070659_1001179672 250
107 3300005436 Ga0070713_100415897 Ga0070713_1004158972 250
108 3300005437 Ga0070710_10077192 Ga0070710_100771922 250
109 3300005439 Ga0070711_100008682 Ga0070711_1000086823 250
110 3300005441 Ga0070700_100003681 Ga0070700_1000036816 250
111 3300005455 Ga0070663_100017122 Ga0070663_1000171221 250
112 3300005457 Ga0070662_100379388 Ga0070662_1003793882 250
113 3300005459 Ga0068867_100000179 Ga0068867_10000017942 250
114 3300005539 Ga0068853_100001640 Ga0068853_10000164010 250
115 3300005543 Ga0070672_100254761 Ga0070672_1002547612 250
116 3300005547 Ga0070693_100000793 Ga0070693_1000007939 250
117 3300005548 Ga0070665_100000120 Ga0070665_10000012012 250
118 3300005548 Ga0070665_100555088 Ga0070665_1005550882 250
119 3300005564 Ga0070664_100015666 Ga0070664_1000156666 250
120 3300005564 Ga0070664_100129393 Ga0070664_1001293932 250
121 3300005577 Ga0068857_100363955 Ga0068857_1003639552 250
122 3300005578 Ga0068854_100361487 Ga0068854_1003614872 250
123 3300005614 Ga0068856_100040534 Ga0068856_1000405345 250
124 3300005618 Ga0068864_100009102 Ga0068864_1000091027 250
125 3300005718 Ga0068866_10041459 Ga0068866_100414592 250
126 3300005841 Ga0068863_100009454 Ga0068863_1000094543 250
127 3300005842 Ga0068858_100000035 Ga0068858_10000003510 250
128 3300006038 Ga0075365_10196912 Ga0075365_101969122 250
129 3300007076 Ga0075435_100115174 Ga0075435_1001151742 250
130 3300009098 Ga0105245_10002476 Ga0105245_100024762 250
131 3300009148 Ga0105243_10119891 Ga0105243_101198913 250
132 3300009545 Ga0105237_10610377 Ga0105237_106103772 250
133 3300009551 Ga0105238_10000240 Ga0105238_1000024042 250
134 3300009553 Ga0105249_10127652 Ga0105249_101276522 250
135 3300010375 Ga0105239_10060695 Ga0105239_100606952 250
136 3300011119 Ga0105246_10038448 Ga0105246_100384482 250
137 3300013104 Ga0157370_10008336 Ga0157370_100083365 250
138 3300013105 Ga0157369_10357250 Ga0157369_103572502 250
139 3300013296 Ga0157374_10000668 Ga0157374_100006687 250
140 3300013296 Ga0157374_10004683 Ga0157374_100046836 250
141 3300014745 Ga0157377_10000518 Ga0157377_1000051812 250
142 3300017792 Ga0163161_10000058 Ga0163161_1000005858 250
143 3300025893 Ga0207682_10000168 Ga0207682_1000016811 250
144 3300025899 Ga0207642_10079024 Ga0207642_100790242 250
145 3300025901 Ga0207688_10009044 Ga0207688_100090445 250
146 3300025915 Ga0207693_10089626 Ga0207693_100896262 250
147 3300025916 Ga0207663_10018381 Ga0207663_100183814 250
148 3300025924 Ga0207694_10000067 Ga0207694_10000067106 250
149 3300025924 Ga0207694_10148790 Ga0207694_101487902 250
150 3300025927 Ga0207687_10043591 Ga0207687_100435912 250
151 3300025929 Ga0207664_10077791 Ga0207664_100777912 250
152 3300025931 Ga0207644_10062622 Ga0207644_100626222 250
153 3300025932 Ga0207690_10072941 Ga0207690_100729412 250
154 3300025933 Ga0207706_10018493 Ga0207706_100184933 250
155 3300025935 Ga0207709_10051031 Ga0207709_100510312 250
156 3300025935 Ga0207709_10106379 Ga0207709_101063792 250
157 3300025937 Ga0207669_10024582 Ga0207669_100245822 250
158 3300025937 Ga0207669_10095366 Ga0207669_100953662 250
159 3300025938 Ga0207704_10024261 Ga0207704_100242612 250
160 3300025940 Ga0207691_10290712 Ga0207691_102907122 250
161 3300025944 Ga0207661_10024131 Ga0207661_100241311 250
162 3300025944 Ga0207661_10584604 Ga0207661_105846041 250
163 3300025945 Ga0207679_10040059 Ga0207679_100400593 250
164 3300025945 Ga0207679_10104879 Ga0207679_101048792 250
165 3300025949 Ga0207667_10217920 Ga0207667_102179202 250
166 3300025960 Ga0207651_10020827 Ga0207651_100208274 250
167 3300025961 Ga0207712_10071656 Ga0207712_100716562 250
168 3300025972 Ga0207668_10030731 Ga0207668_100307315 250
169 3300026023 Ga0207677_10000376 Ga0207677_1000037610 250
170 3300026035 Ga0207703_10000067 Ga0207703_1000006744 250
171 3300026035 Ga0207703_10625514 Ga0207703_106255142 250
172 3300026041 Ga0207639_10001333 Ga0207639_1000133310 250
173 3300026067 Ga0207678_10275051 Ga0207678_102750512 250
174 3300026075 Ga0207708_10007741 Ga0207708_100077416 250
175 3300026078 Ga0207702_10186057 Ga0207702_101860572 250
176 3300026088 Ga0207641_10003078 Ga0207641_100030782 250
177 3300026089 Ga0207648_10000228 Ga0207648_1000022841 250
178 3300026121 Ga0207683_10019636 Ga0207683_100196367 250
179 3300028379 Ga0268266_10000023 Ga0268266_10000023373 250
180 3300028380 Ga0268265_10563723 Ga0268265_105637231 250
181 3300028556 Ga0265337_1000013 Ga0265337_100001373 250
182 3300028558 Ga0265326_10000012 Ga0265326_1000001296 250
183 3300028654 Ga0265322_10000003 Ga0265322_10000003383 250
184 3300028666 Ga0265336_10002736 Ga0265336_100027363 250
185 3300031239 Ga0265328_10000700 Ga0265328_100007002 250
186 3300031240 Ga0265320_10000001 Ga0265320_10000001383 250
187 3300031242 Ga0265329_10001196 Ga0265329_1000119614 250
188 3300031249 Ga0265339_10004334 Ga0265339_100043342 250
189 3300031250 Ga0265331_10001257 Ga0265331_100012576 250
190 3300031251 Ga0265327_10000003 Ga0265327_10000003383 250
191 3300031711 Ga0265314_10000044 Ga0265314_1000004484 250
192 3300036401 Ga0373937_0010103 Ga0373937_0010103_5573_6325 250
193 3300036401 Ga0373937_0021054 Ga0373937_0021054_2887_3639 250
194 3300041512 Ga0451853_0632861 Ga0451853_0632861_138_890 250
195 3300044694 Ga0466963_0000710 Ga0466963_0000710_8477_9229 250
196 3300045976 Ga0466967_0160094 Ga0466967_0160094_1144_1896 250
197 3300045976 Ga0466967_0715289 Ga0466967_0715289_55_807 250
198 3300046454 Ga0495592_0001063 Ga0495592_0001063_11548_12309 250
199 3300046454 Ga0495592_0015237 Ga0495592_0015237_2913_3665 250
200 3300046455 Ga0495603_0000302 Ga0495603_0000302_15738_16490 250
201 3300046455 Ga0495603_0000672 Ga0495603_0000672_4021_4791 250
202 3300046459 Ga0495629_0317197 Ga0495629_0317197_79_831 250
203 3300046462 Ga0495651_0174342 Ga0495651_0174342_169_921 250
204 3300046473 Ga0495582_0000005 Ga0495582_0000005_121595_122347 250
205 3300046476 Ga0495662_0000022 Ga0495662_0000022_30848_31600 250
206 3300046511 Ga0495608_0000406 Ga0495608_0000406_295_1047 250
207 3300046515 Ga0495620_0000344 Ga0495620_0000344_161_913 250
208 3300046516 Ga0495628_0000070 Ga0495628_0000070_78631_79383 250
209 3300046516 Ga0495628_0004688 Ga0495628_0004688_5367_6119 250
210 3300046516 Ga0495628_0293512 Ga0495628_0293512_280_1032 250
211 3300046533 Ga0495640_0034817 Ga0495640_0034817_2645_3397 250
212 3300046535 Ga0495586_0001124 Ga0495586_0001124_2641_3402 250
213 3300046536 Ga0495587_0101815 Ga0495587_0101815_744_1496 250
214 3300046539 Ga0495621_0005720 Ga0495621_0005720_1195_1947 250
215 3300046543 Ga0495645_0009243 Ga0495645_0009243_5940_6692 250
216 3300046559 Ga0495667_0000015 Ga0495667_0000015_96938_97690 250
217 3300046642 Ga0495634_0000592 Ga0495634_0000592_23358_24110 250
218 3300046642 Ga0495634_0000910 Ga0495634_0000910_15667_16419 250
219 3300046642 Ga0495634_0011662 Ga0495634_0011662_2190_2975 250
220 3300046663 Ga0495635_0000009 Ga0495635_0000009_255226_255987 250
221 3300046683 Ga0495658_0000019 Ga0495658_0000019_33834_34586 250
222 3300046690 Ga0495624_0000013 Ga0495624_0000013_107817_108569 250
223 3300046694 Ga0495649_0003377 Ga0495649_0003377_4361_5113 250
224 3300047317 Ga0495604_0000033 Ga0495604_0000033_43337_44089 250
225 3300047322 Ga0495680_0001062 Ga0495680_0001062_19750_20502 250
226 3300047322 Ga0495680_0002013 Ga0495680_0002013_10831_11583 250
227 3300047673 Ga0495593_0062769 Ga0495593_0062769_672_1424 250
228 3300048088 Ga0495602_0001999 Ga0495602_0001999_5497_6249 250
229 3300048903 Ga0496100_0000116 Ga0496100_0000116_4290_5051 250
230 3300048903 Ga0496100_0007372 Ga0496100_0007372_341_1114 250
231 3300048904 Ga0496101_0000003 Ga0496101_0000003_365074_365835 250
232 3300048904 Ga0496101_0026168 Ga0496101_0026168_3215_3988 250
233 3300048904 Ga0496101_0118595 Ga0496101_0118595_574_1326 250
234 3300048905 Ga0496102_0024171 Ga0496102_0024171_251_1024 250
235 3300048907 Ga0496104_0000147 Ga0496104_0000147_63126_63878 250
236 3300048907 Ga0496104_0159959 Ga0496104_0159959_185_958 250
237 3300048908 Ga0496105_0000138 Ga0496105_0000138_10477_11229 250
238 3300048908 Ga0496105_0011410 Ga0496105_0011410_2831_3604 250
239 3300048909 Ga0496106_0000177 Ga0496106_0000177_40731_41492 250
240 3300048909 Ga0496106_0027758 Ga0496106_0027758_3253_4026 250
241 3300048910 Ga0496107_0000081 Ga0496107_0000081_40731_41492 250
242 3300048910 Ga0496107_0044209 Ga0496107_0044209_335_1108 250
243 3300048912 Ga0496109_0000237 Ga0496109_0000237_21144_21896 250
244 3300048912 Ga0496109_0083279 Ga0496109_0083279_250_1023 250
245 3300048913 Ga0496110_0020908 Ga0496110_0020908_4167_4940 250
246 3300048913 Ga0496110_0041459 Ga0496110_0041459_1066_1818 250
247 3300048914 Ga0496111_0008241 Ga0496111_0008241_3861_4613 250
248 3300048914 Ga0496111_0040566 Ga0496111_0040566_1970_2743 250
249 3300048915 Ga0496112_0065433 Ga0496112_0065433_569_1342 250
250 3300048915 Ga0496112_0711770 Ga0496112_0711770_21_806 250
251 3300048916 Ga0496113_0050418 Ga0496113_0050418_2175_2948 250
252 3300048916 Ga0496113_0221942 Ga0496113_0221942_594_1346 250
253 3300048917 Ga0496114_0240246 Ga0496114_0240246_785_1558 250
254 3300048918 Ga0496115_0006099 Ga0496115_0006099_3797_4549 250
255 3300049591 Ga0501075_0000855 Ga0501075_0000855_3093_3845 250
256 3300049591 Ga0501075_0301056 Ga0501075_0301056_382_1134 250
257 3300049592 Ga0501076_0150554 Ga0501076_0150554_810_1562 250
258 3300050511 nmdc:mga08y16_462699_c1 nmdc:mga08y16_462699_c1_358_1131 250
259 3300050513 nmdc:mga0rr50_157568_c1 nmdc:mga0rr50_157568_c1_103_864 250
260 3300050515 nmdc:mga0a205_12_c3 nmdc:mga0a205_12_c3_24365_25117 250
261 3300053078 Ga0495612_0062205 Ga0495612_0062205_460_1212 250
262 3300053084 Ga0495595_0000109 Ga0495595_0000109_11764_12516 250
263 3300053084 Ga0495595_0017403 Ga0495595_0017403_847_1599 250
264 3300053085 Ga0495619_0000024 Ga0495619_0000024_10614_11366 250
265 3300053085 Ga0495619_0000192 Ga0495619_0000192_4549_5301 250
266 3300053085 Ga0495619_0000980 Ga0495619_0000980_12976_13728 250
267 3300053085 Ga0495619_0024858 Ga0495619_0024858_1725_2477 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

26

261

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

31

240

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r9q-assembly1.cif.gz_A structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9023 3 229
3qka-assembly1.cif.gz_E crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum 0.9018 2 236
4z0m-assembly1.cif.gz_C echa5 mycobacterium tuberculosis 0.8817 3 224
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.8811 4 228
3hrx-assembly2.cif.gz_E crystal structure of phenylacetic acid degradation protein paag 0.8803 5 227
ID Description Score Start End Superfamily
3qkaE02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9104 195 236 1.10.287.2460
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9073 84 192 3.90.226.20
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8997 2 194 3.90.226.10
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.895 2 194 3.90.226.10
3qkaE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8914 2 194 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7S3H8P0-F1-model_v4 Enoyl-CoA hydratase 0.9303 80 234 GO:0003824
AF-A0A848YEP7-F1-model_v4 Enoyl-CoA hydratase 0.9218 80 246
AF-A0A537ZCI5-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.907 1 250 GO:0003824
GO:0006631
AF-A0A1H6DHM3-F1-model_v4 Enoyl-CoA hydratase 0.9064 5 227 GO:0003824
GO:0006631
AF-A0A4R5AAP1-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9057 4 246 GO:0003824
GO:0006631

Feature Viewer

pLDDT pTM Quality
82.69 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map