F374840
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 177 | 267 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300026023|Ga0207677_10000376|Ga0207677_1000037610 |
| Length | 268 |
| Sequence | MTRKAATTSPPAPLPSPAMSEGMRYERVGAAAVLTIDRPERRNAVDRAAAEGFRAGLREFEADDGARVLILTGAGGAAFCAGADLKAMDLEVDHPDGPMGPTRLTPSKPAIAAVDGWCLAGGVELALWCDLRIATPQSTFGLFERRWGVPLVDGGTQRLPRIVGMGRALELILLGRPVGAEEAHRIGLVNELVEPGKHLDRALELAERIASFPQETMLADRQAAIEGFGLPLKDGIALEHELGRQTLHVALEGAQRFSSGEGRHGEGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 164 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 13.11 |
| Rhizosphere | 85.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000405 | 3300001977 | Bacteria | 6405 |
| 2 | Ga0070683_100095010 | 3300005329 | Bacteria | 2802 |
| 3 | Ga0070683_100315910 | 3300005329 | Bacteria | 1486 |
| 4 | Ga0070677_10000048 | 3300005333 | Bacteria | 37331 |
| 5 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 6 | Ga0068868_100000451 | 3300005338 | Bacteria | 27446 |
| 7 | Ga0068868_100002935 | 3300005338 | Bacteria | 11829 |
| 8 | Ga0070691_10028085 | 3300005341 | Bacteria | 2627 |
| 9 | Ga0070668_100065734 | 3300005347 | Bacteria | 2813 |
| 10 | Ga0070671_100504379 | 3300005355 | Bacteria | 1041 |
| 11 | Ga0070674_100000033 | 3300005356 | Bacteria | 63982 |
| 12 | Ga0070674_100010008 | 3300005356 | Bacteria | 5709 |
| 13 | Ga0070674_100510603 | 3300005356 | Bacteria | 1002 |
| 14 | Ga0070673_100032178 | 3300005364 | Bacteria | 3945 |
| 15 | Ga0070688_100295989 | 3300005365 | Bacteria | 1168 |
| 16 | Ga0070659_100033215 | 3300005366 | Bacteria | 4006 |
| 17 | Ga0070659_100117967 | 3300005366 | Bacteria | 2146 |
| 18 | Ga0070713_100415897 | 3300005436 | Bacteria | 1258 |
| 19 | Ga0070710_10077192 | 3300005437 | Bacteria | 1935 |
| 20 | Ga0070711_100008682 | 3300005439 | Bacteria | 6232 |
| 21 | Ga0070700_100003681 | 3300005441 | Bacteria | 7925 |
| 22 | Ga0070663_100017122 | 3300005455 | Bacteria | 4723 |
| 23 | Ga0070678_100018900 | 3300005456 | Bacteria | 4477 |
| 24 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 25 | Ga0070662_100379388 | 3300005457 | Bacteria | 1163 |
| 26 | Ga0070681_10003882 | 3300005458 | Bacteria | 14072 |
| 27 | Ga0068867_100000179 | 3300005459 | Bacteria | 41694 |
| 28 | Ga0070679_100000823 | 3300005530 | Bacteria | 26958 |
| 29 | Ga0070684_100047241 | 3300005535 | Bacteria | 3730 |
| 30 | Ga0068853_100001640 | 3300005539 | Bacteria | 16358 |
| 31 | Ga0070672_100254761 | 3300005543 | Bacteria | 1479 |
| 32 | Ga0070693_100000793 | 3300005547 | Bacteria | 13960 |
| 33 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 34 | Ga0070665_100555088 | 3300005548 | Bacteria | 1161 |
| 35 | Ga0068855_100748687 | 3300005563 | Bacteria | 1042 |
| 36 | Ga0070664_100015666 | 3300005564 | Bacteria | 6204 |
| 37 | Ga0070664_100129393 | 3300005564 | Bacteria | 2217 |
| 38 | Ga0068857_100363955 | 3300005577 | Bacteria | 1341 |
| 39 | Ga0068854_100005952 | 3300005578 | Bacteria | 7726 |
| 40 | Ga0068854_100361487 | 3300005578 | Bacteria | 1191 |
| 41 | Ga0068856_100040534 | 3300005614 | Bacteria | 4575 |
| 42 | Ga0068864_100009102 | 3300005618 | Bacteria | 8185 |
| 43 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 44 | Ga0068866_10041459 | 3300005718 | Bacteria | 2284 |
| 45 | Ga0068863_100009454 | 3300005841 | Bacteria | 9511 |
| 46 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 47 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 48 | Ga0068860_100005398 | 3300005843 | Bacteria | 12971 |
| 49 | Ga0081455_10187878 | 3300005937 | Bacteria | 1559 |
| 50 | Ga0081455_10300493 | 3300005937 | Bacteria | 1152 |
| 51 | Ga0075365_10196912 | 3300006038 | Bacteria | 1411 |
| 52 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 53 | Ga0070716_100039172 | 3300006173 | Bacteria | 2629 |
| 54 | Ga0075435_100115174 | 3300007076 | Bacteria | 2238 |
| 55 | Ga0105245_10000150 | 3300009098 | Bacteria | 66121 |
| 56 | Ga0105245_10000327 | 3300009098 | Bacteria | 44888 |
| 57 | Ga0105245_10002476 | 3300009098 | Bacteria | 16694 |
| 58 | Ga0105243_10119891 | 3300009148 | Bacteria | 2216 |
| 59 | Ga0105242_10087004 | 3300009176 | Bacteria | 2623 |
| 60 | Ga0105237_10610377 | 3300009545 | Bacteria | 1098 |
| 61 | Ga0105238_10000240 | 3300009551 | Bacteria | 61138 |
| 62 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 63 | Ga0105249_10127652 | 3300009553 | Bacteria | 2424 |
| 64 | Ga0105249_10195794 | 3300009553 | Bacteria | 1975 |
| 65 | Ga0105239_10060695 | 3300010375 | Bacteria | 4150 |
| 66 | Ga0105239_10925431 | 3300010375 | Bacteria | 1001 |
| 67 | Ga0105246_10038448 | 3300011119 | Bacteria | 3217 |
| 68 | Ga0157370_10008336 | 3300013104 | Bacteria | 11178 |
| 69 | Ga0157369_10357250 | 3300013105 | Bacteria | 1517 |
| 70 | Ga0157374_10000668 | 3300013296 | Bacteria | 30198 |
| 71 | Ga0157374_10004683 | 3300013296 | Bacteria | 11486 |
| 72 | Ga0157375_10000723 | 3300013308 | Bacteria | 29095 |
| 73 | Ga0163163_10519208 | 3300014325 | Unclassified | 1253 |
| 74 | Ga0157377_10000518 | 3300014745 | Bacteria | 16361 |
| 75 | Ga0157379_10104017 | 3300014968 | Bacteria | 2548 |
| 76 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 77 | Ga0207682_10000168 | 3300025893 | Bacteria | 30073 |
| 78 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 79 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 80 | Ga0207642_10079024 | 3300025899 | Bacteria | 1592 |
| 81 | Ga0207688_10009044 | 3300025901 | Bacteria | 5422 |
| 82 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 83 | Ga0207693_10089626 | 3300025915 | Bacteria | 2411 |
| 84 | Ga0207663_10018381 | 3300025916 | Bacteria | 3917 |
| 85 | Ga0207652_10001431 | 3300025921 | Bacteria | 21145 |
| 86 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 87 | Ga0207694_10148790 | 3300025924 | Bacteria | 1886 |
| 88 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 89 | Ga0207687_10000099 | 3300025927 | Bacteria | 63345 |
| 90 | Ga0207687_10043591 | 3300025927 | Bacteria | 3092 |
| 91 | Ga0207664_10077791 | 3300025929 | Bacteria | 2689 |
| 92 | Ga0207644_10062622 | 3300025931 | Bacteria | 2699 |
| 93 | Ga0207690_10030092 | 3300025932 | Bacteria | 3459 |
| 94 | Ga0207690_10072941 | 3300025932 | Bacteria | 2372 |
| 95 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 96 | Ga0207706_10018493 | 3300025933 | Bacteria | 6271 |
| 97 | Ga0207686_10217284 | 3300025934 | Bacteria | 1378 |
| 98 | Ga0207709_10051031 | 3300025935 | Bacteria | 2533 |
| 99 | Ga0207709_10106379 | 3300025935 | Bacteria | 1866 |
| 100 | Ga0207669_10000137 | 3300025937 | Bacteria | 35016 |
| 101 | Ga0207669_10024582 | 3300025937 | Bacteria | 3240 |
| 102 | Ga0207669_10095366 | 3300025937 | Bacteria | 1950 |
| 103 | Ga0207704_10024261 | 3300025938 | Bacteria | 3285 |
| 104 | Ga0207665_10050900 | 3300025939 | Bacteria | 2787 |
| 105 | Ga0207691_10290712 | 3300025940 | Bacteria | 1405 |
| 106 | Ga0207661_10024131 | 3300025944 | Bacteria | 4605 |
| 107 | Ga0207661_10584604 | 3300025944 | Bacteria | 1024 |
| 108 | Ga0207679_10040059 | 3300025945 | Bacteria | 3351 |
| 109 | Ga0207679_10104879 | 3300025945 | Bacteria | 2219 |
| 110 | Ga0207667_10217920 | 3300025949 | Bacteria | 1956 |
| 111 | Ga0207667_10591072 | 3300025949 | Bacteria | 1120 |
| 112 | Ga0207651_10020827 | 3300025960 | Bacteria | 3968 |
| 113 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 114 | Ga0207712_10071656 | 3300025961 | Bacteria | 2493 |
| 115 | Ga0207668_10030731 | 3300025972 | Bacteria | 3532 |
| 116 | Ga0207640_10004089 | 3300025981 | Bacteria | 7880 |
| 117 | Ga0207677_10000376 | 3300026023 | Bacteria | 30827 |
| 118 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 119 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 120 | Ga0207703_10625514 | 3300026035 | Bacteria | 1020 |
| 121 | Ga0207639_10001333 | 3300026041 | Bacteria | 16674 |
| 122 | Ga0207678_10275051 | 3300026067 | Bacteria | 1445 |
| 123 | Ga0207708_10007741 | 3300026075 | Bacteria | 7957 |
| 124 | Ga0207702_10186057 | 3300026078 | Bacteria | 1915 |
| 125 | Ga0207641_10003078 | 3300026088 | Bacteria | 15029 |
| 126 | Ga0207648_10000228 | 3300026089 | Bacteria | 60032 |
| 127 | Ga0207683_10019636 | 3300026121 | Bacteria | 5775 |
| 128 | Ga0207683_10035762 | 3300026121 | Bacteria | 4320 |
| 129 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 130 | Ga0268265_10563723 | 3300028380 | Bacteria | 1083 |
| 131 | Ga0268264_10005149 | 3300028381 | Bacteria | 11080 |
| 132 | Ga0265337_1000013 | 3300028556 | Bacteria | 82926 |
| 133 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 134 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 135 | Ga0265336_10002736 | 3300028666 | Bacteria | 7131 |
| 136 | Ga0265328_10000700 | 3300031239 | Bacteria | 15518 |
| 137 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 138 | Ga0265329_10001196 | 3300031242 | Bacteria | 12724 |
| 139 | Ga0265339_10004334 | 3300031249 | Bacteria | 9691 |
| 140 | Ga0265331_10001257 | 3300031250 | Bacteria | 19008 |
| 141 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 142 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 143 | Ga0373937_0010103 | 3300036401 | Bacteria | 8231 |
| 144 | Ga0373937_0021054 | 3300036401 | Bacteria | 5851 |
| 145 | Ga0373937_0644576 | 3300036401 | Bacteria | 1005 |
| 146 | Ga0395898_0450440 | 3300037466 | Bacteria | 1226 |
| 147 | Ga0395901_0220444 | 3300038443 | Bacteria | 1983 |
| 148 | Ga0451853_0441842 | 3300041512 | Bacteria | 822 |
| 149 | Ga0451853_0632861 | 3300041512 | Bacteria | 2150 |
| 150 | Ga0466963_0000710 | 3300044694 | Bacteria | 16256 |
| 151 | Ga0466967_0160094 | 3300045976 | Bacteria | 2112 |
| 152 | Ga0466967_0715289 | 3300045976 | Bacteria | 992 |
| 153 | Ga0495592_0001063 | 3300046454 | Bacteria | 19010 |
| 154 | Ga0495592_0015237 | 3300046454 | Bacteria | 5837 |
| 155 | Ga0495592_0031092 | 3300046454 | Bacteria | 4037 |
| 156 | Ga0495592_0088599 | 3300046454 | Bacteria | 2224 |
| 157 | Ga0495603_0000302 | 3300046455 | Bacteria | 26272 |
| 158 | Ga0495603_0000672 | 3300046455 | Bacteria | 19385 |
| 159 | Ga0495629_0317197 | 3300046459 | Bacteria | 1066 |
| 160 | Ga0495641_0000187 | 3300046461 | Bacteria | 47961 |
| 161 | Ga0495641_0023926 | 3300046461 | Bacteria | 3025 |
| 162 | Ga0495651_0174342 | 3300046462 | Bacteria | 1528 |
| 163 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 164 | Ga0495662_0000022 | 3300046476 | Bacteria | 54342 |
| 165 | Ga0495608_0000406 | 3300046511 | Bacteria | 30178 |
| 166 | Ga0495608_0019975 | 3300046511 | Bacteria | 4607 |
| 167 | Ga0495608_0062991 | 3300046511 | Bacteria | 2435 |
| 168 | Ga0495620_0000344 | 3300046515 | Bacteria | 32387 |
| 169 | Ga0495628_0000070 | 3300046516 | Bacteria | 80592 |
| 170 | Ga0495628_0004688 | 3300046516 | Bacteria | 12060 |
| 171 | Ga0495628_0031488 | 3300046516 | Bacteria | 4290 |
| 172 | Ga0495628_0031670 | 3300046516 | Bacteria | 4277 |
| 173 | Ga0495628_0140105 | 3300046516 | Bacteria | 1846 |
| 174 | Ga0495628_0290052 | 3300046516 | Bacteria | 1213 |
| 175 | Ga0495628_0293512 | 3300046516 | Bacteria | 1205 |
| 176 | Ga0495628_0309290 | 3300046516 | Bacteria | 1168 |
| 177 | Ga0495630_0001004 | 3300046517 | Bacteria | 19578 |
| 178 | Ga0495630_0135610 | 3300046517 | Bacteria | 1870 |
| 179 | Ga0495644_0000600 | 3300046523 | Bacteria | 15119 |
| 180 | Ga0495652_0006039 | 3300046529 | Bacteria | 11327 |
| 181 | Ga0495640_0034817 | 3300046533 | Bacteria | 3566 |
| 182 | Ga0495586_0001124 | 3300046535 | Bacteria | 15053 |
| 183 | Ga0495587_0101815 | 3300046536 | Bacteria | 1654 |
| 184 | Ga0495598_0004671 | 3300046537 | Bacteria | 2982 |
| 185 | Ga0495621_0005720 | 3300046539 | Bacteria | 3592 |
| 186 | Ga0495645_0009243 | 3300046543 | Bacteria | 6890 |
| 187 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 188 | Ga0495634_0000592 | 3300046642 | Bacteria | 35197 |
| 189 | Ga0495634_0000910 | 3300046642 | Bacteria | 28215 |
| 190 | Ga0495634_0011662 | 3300046642 | Bacteria | 6393 |
| 191 | Ga0495634_0097255 | 3300046642 | Bacteria | 1906 |
| 192 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 193 | Ga0495635_0115182 | 3300046663 | Bacteria | 1835 |
| 194 | Ga0495657_0008606 | 3300046675 | Bacteria | 7787 |
| 195 | Ga0495599_0187453 | 3300046678 | Bacteria | 1273 |
| 196 | Ga0495647_0000037 | 3300046681 | Bacteria | 42482 |
| 197 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 198 | Ga0495669_0000382 | 3300046684 | Bacteria | 22273 |
| 199 | Ga0495613_0000257 | 3300046689 | Bacteria | 50000 |
| 200 | Ga0495613_0014270 | 3300046689 | Bacteria | 5896 |
| 201 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 202 | Ga0495624_0032449 | 3300046690 | Bacteria | 3386 |
| 203 | Ga0495670_0057675 | 3300046691 | Bacteria | 1949 |
| 204 | Ga0495649_0003377 | 3300046694 | Bacteria | 10795 |
| 205 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 206 | Ga0495676_0000646 | 3300047321 | Bacteria | 28924 |
| 207 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 208 | Ga0495680_0001062 | 3300047322 | Bacteria | 30410 |
| 209 | Ga0495680_0002013 | 3300047322 | Bacteria | 21325 |
| 210 | Ga0495685_007491 | 3300047447 | Bacteria | 3605 |
| 211 | Ga0495593_0062769 | 3300047673 | Bacteria | 1941 |
| 212 | Ga0495602_0001999 | 3300048088 | Bacteria | 20491 |
| 213 | Ga0496100_0000116 | 3300048903 | Bacteria | 45781 |
| 214 | Ga0496100_0007372 | 3300048903 | Bacteria | 6065 |
| 215 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 216 | Ga0496101_0026168 | 3300048904 | Bacteria | 4055 |
| 217 | Ga0496101_0118595 | 3300048904 | Bacteria | 1999 |
| 218 | Ga0496102_0024171 | 3300048905 | Bacteria | 5401 |
| 219 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 220 | Ga0496104_0000147 | 3300048907 | Bacteria | 65131 |
| 221 | Ga0496104_0159959 | 3300048907 | Bacteria | 2160 |
| 222 | Ga0496104_0381458 | 3300048907 | Unclassified | 1322 |
| 223 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 224 | Ga0496105_0000138 | 3300048908 | Bacteria | 48896 |
| 225 | Ga0496105_0011410 | 3300048908 | Bacteria | 7019 |
| 226 | Ga0496105_0014661 | 3300048908 | Bacteria | 6241 |
| 227 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 228 | Ga0496106_0000177 | 3300048909 | Bacteria | 45808 |
| 229 | Ga0496106_0027758 | 3300048909 | Bacteria | 4216 |
| 230 | Ga0496107_0000081 | 3300048910 | Bacteria | 45824 |
| 231 | Ga0496107_0044209 | 3300048910 | Bacteria | 3201 |
| 232 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 233 | Ga0496108_0004351 | 3300048911 | Bacteria | 11388 |
| 234 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 235 | Ga0496109_0000237 | 3300048912 | Bacteria | 53743 |
| 236 | Ga0496109_0083279 | 3300048912 | Bacteria | 2949 |
| 237 | Ga0496110_0016197 | 3300048913 | Bacteria | 6218 |
| 238 | Ga0496110_0020908 | 3300048913 | Bacteria | 5529 |
| 239 | Ga0496110_0041459 | 3300048913 | Bacteria | 4017 |
| 240 | Ga0496111_0008241 | 3300048914 | Bacteria | 6891 |
| 241 | Ga0496111_0040566 | 3300048914 | Bacteria | 3339 |
| 242 | Ga0496112_0065433 | 3300048915 | Bacteria | 3587 |
| 243 | Ga0496112_0711770 | 3300048915 | Bacteria | 932 |
| 244 | Ga0496113_0050418 | 3300048916 | Bacteria | 3103 |
| 245 | Ga0496113_0221942 | 3300048916 | Bacteria | 1506 |
| 246 | Ga0496114_0240246 | 3300048917 | Bacteria | 1593 |
| 247 | Ga0496115_0006099 | 3300048918 | Bacteria | 8806 |
| 248 | Ga0501042_0079236 | 3300049578 | Bacteria | 2353 |
| 249 | Ga0501075_0000855 | 3300049591 | Bacteria | 19203 |
| 250 | Ga0501075_0301056 | 3300049591 | Bacteria | 1222 |
| 251 | Ga0501076_0150554 | 3300049592 | Bacteria | 1893 |
| 252 | Ga0501081_0373606 | 3300049743 | Bacteria | 1053 |
| 253 | nmdc:mga08y16_462699_c1 | 3300050511 | Bacteria | 1292 |
| 254 | nmdc:mga0rr50_157568_c1 | 3300050513 | Bacteria | 1840 |
| 255 | nmdc:mga0a205_12_c3 | 3300050515 | Bacteria | 28260 |
| 256 | Ga0495601_0001565 | 3300053077 | Bacteria | 12649 |
| 257 | Ga0495612_0000843 | 3300053078 | Bacteria | 12451 |
| 258 | Ga0495612_0006267 | 3300053078 | Bacteria | 4900 |
| 259 | Ga0495612_0062205 | 3300053078 | Bacteria | 1547 |
| 260 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 261 | Ga0495595_0017403 | 3300053084 | Bacteria | 3093 |
| 262 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 263 | Ga0495619_0000192 | 3300053085 | Bacteria | 45153 |
| 264 | Ga0495619_0000980 | 3300053085 | Bacteria | 18685 |
| 265 | Ga0495619_0024858 | 3300053085 | Bacteria | 3843 |
| 266 | Ga0495619_0050609 | 3300053085 | Bacteria | 2743 |
| 267 | Ga0500614_003324 | 3300053123 | Bacteria | 3470 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0381458 | Ga0496104_0381458_592_1302 | 223 |
| 2 | 3300005456 | Ga0070678_100018900 | Ga0070678_1000189005 | 227 |
| 3 | 3300026121 | Ga0207683_10035762 | Ga0207683_100357625 | 227 |
| 4 | 3300046689 | Ga0495613_0000257 | Ga0495613_0000257_23959_24711 | 232 |
| 5 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_197102_197863 | 233 |
| 6 | 3300046511 | Ga0495608_0019975 | Ga0495608_0019975_3523_4275 | 234 |
| 7 | 3300046642 | Ga0495634_0097255 | Ga0495634_0097255_949_1698 | 234 |
| 8 | 3300005337 | Ga0070682_100000029 | Ga0070682_100000029155 | 235 |
| 9 | 3300005458 | Ga0070681_10003882 | Ga0070681_100038824 | 235 |
| 10 | 3300005530 | Ga0070679_100000823 | Ga0070679_10000082322 | 235 |
| 11 | 3300010375 | Ga0105239_10925431 | Ga0105239_109254312 | 235 |
| 12 | 3300025921 | Ga0207652_10001431 | Ga0207652_1000143112 | 235 |
| 13 | 3300046675 | Ga0495657_0008606 | Ga0495657_0008606_3278_4030 | 235 |
| 14 | 3300046681 | Ga0495647_0000037 | Ga0495647_0000037_31849_32601 | 235 |
| 15 | 3300046690 | Ga0495624_0032449 | Ga0495624_0032449_202_954 | 235 |
| 16 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_44059_44820 | 235 |
| 17 | 3300005329 | Ga0070683_100315910 | Ga0070683_1003159102 | 236 |
| 18 | 3300005535 | Ga0070684_100047241 | Ga0070684_1000472414 | 236 |
| 19 | 3300005578 | Ga0068854_100005952 | Ga0068854_1000059526 | 236 |
| 20 | 3300006173 | Ga0070716_100039172 | Ga0070716_1000391723 | 236 |
| 21 | 3300009098 | Ga0105245_10000327 | Ga0105245_1000032710 | 236 |
| 22 | 3300009553 | Ga0105249_10000095 | Ga0105249_100000955 | 236 |
| 23 | 3300014968 | Ga0157379_10104017 | Ga0157379_101040172 | 236 |
| 24 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002110 | 236 |
| 25 | 3300025939 | Ga0207665_10050900 | Ga0207665_100509002 | 236 |
| 26 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003499 | 236 |
| 27 | 3300025981 | Ga0207640_10004089 | Ga0207640_100040896 | 236 |
| 28 | 3300046684 | Ga0495669_0000382 | Ga0495669_0000382_3540_4301 | 236 |
| 29 | 3300047447 | Ga0495685_007491 | Ga0495685_007491_1982_2734 | 236 |
| 30 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_141497_142258 | 236 |
| 31 | 3300048908 | Ga0496105_0000008 | Ga0496105_0000008_330609_331370 | 236 |
| 32 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_228257_229009 | 236 |
| 33 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_228219_228971 | 236 |
| 34 | 3300005329 | Ga0070683_100095010 | Ga0070683_1000950103 | 237 |
| 35 | 3300005842 | Ga0068858_100000042 | Ga0068858_100000042126 | 237 |
| 36 | 3300009098 | Ga0105245_10000150 | Ga0105245_1000015032 | 237 |
| 37 | 3300009176 | Ga0105242_10087004 | Ga0105242_100870042 | 237 |
| 38 | 3300009553 | Ga0105249_10195794 | Ga0105249_101957943 | 237 |
| 39 | 3300013308 | Ga0157375_10000723 | Ga0157375_1000072319 | 237 |
| 40 | 3300014325 | Ga0163163_10519208 | Ga0163163_105192082 | 237 |
| 41 | 3300025927 | Ga0207687_10000099 | Ga0207687_1000009931 | 237 |
| 42 | 3300025934 | Ga0207686_10217284 | Ga0207686_102172841 | 237 |
| 43 | 3300026035 | Ga0207703_10000060 | Ga0207703_1000006010 | 237 |
| 44 | 3300046454 | Ga0495592_0031092 | Ga0495592_0031092_2534_3247 | 237 |
| 45 | 3300046461 | Ga0495641_0000187 | Ga0495641_0000187_28722_29474 | 237 |
| 46 | 3300046511 | Ga0495608_0062991 | Ga0495608_0062991_259_1011 | 237 |
| 47 | 3300046516 | Ga0495628_0031488 | Ga0495628_0031488_471_1223 | 237 |
| 48 | 3300046516 | Ga0495628_0140105 | Ga0495628_0140105_911_1663 | 237 |
| 49 | 3300046516 | Ga0495628_0309290 | Ga0495628_0309290_185_937 | 237 |
| 50 | 3300046517 | Ga0495630_0001004 | Ga0495630_0001004_9549_10310 | 237 |
| 51 | 3300046517 | Ga0495630_0135610 | Ga0495630_0135610_487_1239 | 237 |
| 52 | 3300046663 | Ga0495635_0115182 | Ga0495635_0115182_785_1549 | 237 |
| 53 | 3300046678 | Ga0495599_0187453 | Ga0495599_0187453_123_875 | 237 |
| 54 | 3300046689 | Ga0495613_0014270 | Ga0495613_0014270_185_937 | 237 |
| 55 | 3300047321 | Ga0495676_0000646 | Ga0495676_0000646_26848_27600 | 237 |
| 56 | 3300048908 | Ga0496105_0014661 | Ga0496105_0014661_2659_3411 | 237 |
| 57 | 3300048911 | Ga0496108_0004351 | Ga0496108_0004351_6410_7162 | 237 |
| 58 | 3300048913 | Ga0496110_0016197 | Ga0496110_0016197_4993_5745 | 237 |
| 59 | 3300053077 | Ga0495601_0001565 | Ga0495601_0001565_5374_6126 | 237 |
| 60 | 3300053078 | Ga0495612_0006267 | Ga0495612_0006267_3054_3806 | 237 |
| 61 | 3300053123 | Ga0500614_003324 | Ga0500614_003324_1782_2534 | 237 |
| 62 | 3300036401 | Ga0373937_0644576 | Ga0373937_0644576_153_905 | 242 |
| 63 | 3300005338 | Ga0068868_100000451 | Ga0068868_10000045110 | 246 |
| 64 | 3300005356 | Ga0070674_100000033 | Ga0070674_10000003324 | 246 |
| 65 | 3300005457 | Ga0070662_100000008 | Ga0070662_10000000898 | 246 |
| 66 | 3300005563 | Ga0068855_100748687 | Ga0068855_1007486871 | 246 |
| 67 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000278 | 246 |
| 68 | 3300005843 | Ga0068860_100005398 | Ga0068860_10000539810 | 246 |
| 69 | 3300006163 | Ga0070715_10000015 | Ga0070715_1000001590 | 246 |
| 70 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001530 | 246 |
| 71 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003530 | 246 |
| 72 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001336 | 246 |
| 73 | 3300025933 | Ga0207706_10000016 | Ga0207706_1000001676 | 246 |
| 74 | 3300025937 | Ga0207669_10000137 | Ga0207669_1000013724 | 246 |
| 75 | 3300025949 | Ga0207667_10591072 | Ga0207667_105910721 | 246 |
| 76 | 3300028381 | Ga0268264_10005149 | Ga0268264_100051497 | 246 |
| 77 | 3300046516 | Ga0495628_0290052 | Ga0495628_0290052_22_762 | 246 |
| 78 | 3300053078 | Ga0495612_0000843 | Ga0495612_0000843_4552_5292 | 246 |
| 79 | 3300005937 | Ga0081455_10300493 | Ga0081455_103004931 | 247 |
| 80 | 3300049743 | Ga0501081_0373606 | Ga0501081_0373606_174_926 | 248 |
| 81 | 3300053085 | Ga0495619_0050609 | Ga0495619_0050609_437_1183 | 248 |
| 82 | 3300005366 | Ga0070659_100033215 | Ga0070659_1000332153 | 249 |
| 83 | 3300005937 | Ga0081455_10187878 | Ga0081455_101878782 | 249 |
| 84 | 3300025932 | Ga0207690_10030092 | Ga0207690_100300922 | 249 |
| 85 | 3300037466 | Ga0395898_0450440 | Ga0395898_0450440_406_1194 | 249 |
| 86 | 3300038443 | Ga0395901_0220444 | Ga0395901_0220444_849_1637 | 249 |
| 87 | 3300041512 | Ga0451853_0441842 | Ga0451853_0441842_40_792 | 249 |
| 88 | 3300046454 | Ga0495592_0088599 | Ga0495592_0088599_645_1430 | 249 |
| 89 | 3300046461 | Ga0495641_0023926 | Ga0495641_0023926_981_1766 | 249 |
| 90 | 3300046516 | Ga0495628_0031670 | Ga0495628_0031670_2181_2966 | 249 |
| 91 | 3300046523 | Ga0495644_0000600 | Ga0495644_0000600_7668_8417 | 249 |
| 92 | 3300046529 | Ga0495652_0006039 | Ga0495652_0006039_4314_5099 | 249 |
| 93 | 3300046537 | Ga0495598_0004671 | Ga0495598_0004671_26_775 | 249 |
| 94 | 3300046691 | Ga0495670_0057675 | Ga0495670_0057675_1184_1933 | 249 |
| 95 | 3300049578 | Ga0501042_0079236 | Ga0501042_0079236_1141_1890 | 249 |
| 96 | 3300001977 | JGI24746J21847_1000405 | JGI24746J21847_10004055 | 250 |
| 97 | 3300005333 | Ga0070677_10000048 | Ga0070677_1000004822 | 250 |
| 98 | 3300005338 | Ga0068868_100002935 | Ga0068868_1000029352 | 250 |
| 99 | 3300005341 | Ga0070691_10028085 | Ga0070691_100280852 | 250 |
| 100 | 3300005347 | Ga0070668_100065734 | Ga0070668_1000657343 | 250 |
| 101 | 3300005355 | Ga0070671_100504379 | Ga0070671_1005043791 | 250 |
| 102 | 3300005356 | Ga0070674_100010008 | Ga0070674_1000100088 | 250 |
| 103 | 3300005356 | Ga0070674_100510603 | Ga0070674_1005106031 | 250 |
| 104 | 3300005364 | Ga0070673_100032178 | Ga0070673_1000321782 | 250 |
| 105 | 3300005365 | Ga0070688_100295989 | Ga0070688_1002959891 | 250 |
| 106 | 3300005366 | Ga0070659_100117967 | Ga0070659_1001179672 | 250 |
| 107 | 3300005436 | Ga0070713_100415897 | Ga0070713_1004158972 | 250 |
| 108 | 3300005437 | Ga0070710_10077192 | Ga0070710_100771922 | 250 |
| 109 | 3300005439 | Ga0070711_100008682 | Ga0070711_1000086823 | 250 |
| 110 | 3300005441 | Ga0070700_100003681 | Ga0070700_1000036816 | 250 |
| 111 | 3300005455 | Ga0070663_100017122 | Ga0070663_1000171221 | 250 |
| 112 | 3300005457 | Ga0070662_100379388 | Ga0070662_1003793882 | 250 |
| 113 | 3300005459 | Ga0068867_100000179 | Ga0068867_10000017942 | 250 |
| 114 | 3300005539 | Ga0068853_100001640 | Ga0068853_10000164010 | 250 |
| 115 | 3300005543 | Ga0070672_100254761 | Ga0070672_1002547612 | 250 |
| 116 | 3300005547 | Ga0070693_100000793 | Ga0070693_1000007939 | 250 |
| 117 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012012 | 250 |
| 118 | 3300005548 | Ga0070665_100555088 | Ga0070665_1005550882 | 250 |
| 119 | 3300005564 | Ga0070664_100015666 | Ga0070664_1000156666 | 250 |
| 120 | 3300005564 | Ga0070664_100129393 | Ga0070664_1001293932 | 250 |
| 121 | 3300005577 | Ga0068857_100363955 | Ga0068857_1003639552 | 250 |
| 122 | 3300005578 | Ga0068854_100361487 | Ga0068854_1003614872 | 250 |
| 123 | 3300005614 | Ga0068856_100040534 | Ga0068856_1000405345 | 250 |
| 124 | 3300005618 | Ga0068864_100009102 | Ga0068864_1000091027 | 250 |
| 125 | 3300005718 | Ga0068866_10041459 | Ga0068866_100414592 | 250 |
| 126 | 3300005841 | Ga0068863_100009454 | Ga0068863_1000094543 | 250 |
| 127 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003510 | 250 |
| 128 | 3300006038 | Ga0075365_10196912 | Ga0075365_101969122 | 250 |
| 129 | 3300007076 | Ga0075435_100115174 | Ga0075435_1001151742 | 250 |
| 130 | 3300009098 | Ga0105245_10002476 | Ga0105245_100024762 | 250 |
| 131 | 3300009148 | Ga0105243_10119891 | Ga0105243_101198913 | 250 |
| 132 | 3300009545 | Ga0105237_10610377 | Ga0105237_106103772 | 250 |
| 133 | 3300009551 | Ga0105238_10000240 | Ga0105238_1000024042 | 250 |
| 134 | 3300009553 | Ga0105249_10127652 | Ga0105249_101276522 | 250 |
| 135 | 3300010375 | Ga0105239_10060695 | Ga0105239_100606952 | 250 |
| 136 | 3300011119 | Ga0105246_10038448 | Ga0105246_100384482 | 250 |
| 137 | 3300013104 | Ga0157370_10008336 | Ga0157370_100083365 | 250 |
| 138 | 3300013105 | Ga0157369_10357250 | Ga0157369_103572502 | 250 |
| 139 | 3300013296 | Ga0157374_10000668 | Ga0157374_100006687 | 250 |
| 140 | 3300013296 | Ga0157374_10004683 | Ga0157374_100046836 | 250 |
| 141 | 3300014745 | Ga0157377_10000518 | Ga0157377_1000051812 | 250 |
| 142 | 3300017792 | Ga0163161_10000058 | Ga0163161_1000005858 | 250 |
| 143 | 3300025893 | Ga0207682_10000168 | Ga0207682_1000016811 | 250 |
| 144 | 3300025899 | Ga0207642_10079024 | Ga0207642_100790242 | 250 |
| 145 | 3300025901 | Ga0207688_10009044 | Ga0207688_100090445 | 250 |
| 146 | 3300025915 | Ga0207693_10089626 | Ga0207693_100896262 | 250 |
| 147 | 3300025916 | Ga0207663_10018381 | Ga0207663_100183814 | 250 |
| 148 | 3300025924 | Ga0207694_10000067 | Ga0207694_10000067106 | 250 |
| 149 | 3300025924 | Ga0207694_10148790 | Ga0207694_101487902 | 250 |
| 150 | 3300025927 | Ga0207687_10043591 | Ga0207687_100435912 | 250 |
| 151 | 3300025929 | Ga0207664_10077791 | Ga0207664_100777912 | 250 |
| 152 | 3300025931 | Ga0207644_10062622 | Ga0207644_100626222 | 250 |
| 153 | 3300025932 | Ga0207690_10072941 | Ga0207690_100729412 | 250 |
| 154 | 3300025933 | Ga0207706_10018493 | Ga0207706_100184933 | 250 |
| 155 | 3300025935 | Ga0207709_10051031 | Ga0207709_100510312 | 250 |
| 156 | 3300025935 | Ga0207709_10106379 | Ga0207709_101063792 | 250 |
| 157 | 3300025937 | Ga0207669_10024582 | Ga0207669_100245822 | 250 |
| 158 | 3300025937 | Ga0207669_10095366 | Ga0207669_100953662 | 250 |
| 159 | 3300025938 | Ga0207704_10024261 | Ga0207704_100242612 | 250 |
| 160 | 3300025940 | Ga0207691_10290712 | Ga0207691_102907122 | 250 |
| 161 | 3300025944 | Ga0207661_10024131 | Ga0207661_100241311 | 250 |
| 162 | 3300025944 | Ga0207661_10584604 | Ga0207661_105846041 | 250 |
| 163 | 3300025945 | Ga0207679_10040059 | Ga0207679_100400593 | 250 |
| 164 | 3300025945 | Ga0207679_10104879 | Ga0207679_101048792 | 250 |
| 165 | 3300025949 | Ga0207667_10217920 | Ga0207667_102179202 | 250 |
| 166 | 3300025960 | Ga0207651_10020827 | Ga0207651_100208274 | 250 |
| 167 | 3300025961 | Ga0207712_10071656 | Ga0207712_100716562 | 250 |
| 168 | 3300025972 | Ga0207668_10030731 | Ga0207668_100307315 | 250 |
| 169 | 3300026023 | Ga0207677_10000376 | Ga0207677_1000037610 | 250 |
| 170 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006744 | 250 |
| 171 | 3300026035 | Ga0207703_10625514 | Ga0207703_106255142 | 250 |
| 172 | 3300026041 | Ga0207639_10001333 | Ga0207639_1000133310 | 250 |
| 173 | 3300026067 | Ga0207678_10275051 | Ga0207678_102750512 | 250 |
| 174 | 3300026075 | Ga0207708_10007741 | Ga0207708_100077416 | 250 |
| 175 | 3300026078 | Ga0207702_10186057 | Ga0207702_101860572 | 250 |
| 176 | 3300026088 | Ga0207641_10003078 | Ga0207641_100030782 | 250 |
| 177 | 3300026089 | Ga0207648_10000228 | Ga0207648_1000022841 | 250 |
| 178 | 3300026121 | Ga0207683_10019636 | Ga0207683_100196367 | 250 |
| 179 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023373 | 250 |
| 180 | 3300028380 | Ga0268265_10563723 | Ga0268265_105637231 | 250 |
| 181 | 3300028556 | Ga0265337_1000013 | Ga0265337_100001373 | 250 |
| 182 | 3300028558 | Ga0265326_10000012 | Ga0265326_1000001296 | 250 |
| 183 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003383 | 250 |
| 184 | 3300028666 | Ga0265336_10002736 | Ga0265336_100027363 | 250 |
| 185 | 3300031239 | Ga0265328_10000700 | Ga0265328_100007002 | 250 |
| 186 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001383 | 250 |
| 187 | 3300031242 | Ga0265329_10001196 | Ga0265329_1000119614 | 250 |
| 188 | 3300031249 | Ga0265339_10004334 | Ga0265339_100043342 | 250 |
| 189 | 3300031250 | Ga0265331_10001257 | Ga0265331_100012576 | 250 |
| 190 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003383 | 250 |
| 191 | 3300031711 | Ga0265314_10000044 | Ga0265314_1000004484 | 250 |
| 192 | 3300036401 | Ga0373937_0010103 | Ga0373937_0010103_5573_6325 | 250 |
| 193 | 3300036401 | Ga0373937_0021054 | Ga0373937_0021054_2887_3639 | 250 |
| 194 | 3300041512 | Ga0451853_0632861 | Ga0451853_0632861_138_890 | 250 |
| 195 | 3300044694 | Ga0466963_0000710 | Ga0466963_0000710_8477_9229 | 250 |
| 196 | 3300045976 | Ga0466967_0160094 | Ga0466967_0160094_1144_1896 | 250 |
| 197 | 3300045976 | Ga0466967_0715289 | Ga0466967_0715289_55_807 | 250 |
| 198 | 3300046454 | Ga0495592_0001063 | Ga0495592_0001063_11548_12309 | 250 |
| 199 | 3300046454 | Ga0495592_0015237 | Ga0495592_0015237_2913_3665 | 250 |
| 200 | 3300046455 | Ga0495603_0000302 | Ga0495603_0000302_15738_16490 | 250 |
| 201 | 3300046455 | Ga0495603_0000672 | Ga0495603_0000672_4021_4791 | 250 |
| 202 | 3300046459 | Ga0495629_0317197 | Ga0495629_0317197_79_831 | 250 |
| 203 | 3300046462 | Ga0495651_0174342 | Ga0495651_0174342_169_921 | 250 |
| 204 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_121595_122347 | 250 |
| 205 | 3300046476 | Ga0495662_0000022 | Ga0495662_0000022_30848_31600 | 250 |
| 206 | 3300046511 | Ga0495608_0000406 | Ga0495608_0000406_295_1047 | 250 |
| 207 | 3300046515 | Ga0495620_0000344 | Ga0495620_0000344_161_913 | 250 |
| 208 | 3300046516 | Ga0495628_0000070 | Ga0495628_0000070_78631_79383 | 250 |
| 209 | 3300046516 | Ga0495628_0004688 | Ga0495628_0004688_5367_6119 | 250 |
| 210 | 3300046516 | Ga0495628_0293512 | Ga0495628_0293512_280_1032 | 250 |
| 211 | 3300046533 | Ga0495640_0034817 | Ga0495640_0034817_2645_3397 | 250 |
| 212 | 3300046535 | Ga0495586_0001124 | Ga0495586_0001124_2641_3402 | 250 |
| 213 | 3300046536 | Ga0495587_0101815 | Ga0495587_0101815_744_1496 | 250 |
| 214 | 3300046539 | Ga0495621_0005720 | Ga0495621_0005720_1195_1947 | 250 |
| 215 | 3300046543 | Ga0495645_0009243 | Ga0495645_0009243_5940_6692 | 250 |
| 216 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_96938_97690 | 250 |
| 217 | 3300046642 | Ga0495634_0000592 | Ga0495634_0000592_23358_24110 | 250 |
| 218 | 3300046642 | Ga0495634_0000910 | Ga0495634_0000910_15667_16419 | 250 |
| 219 | 3300046642 | Ga0495634_0011662 | Ga0495634_0011662_2190_2975 | 250 |
| 220 | 3300046663 | Ga0495635_0000009 | Ga0495635_0000009_255226_255987 | 250 |
| 221 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_33834_34586 | 250 |
| 222 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_107817_108569 | 250 |
| 223 | 3300046694 | Ga0495649_0003377 | Ga0495649_0003377_4361_5113 | 250 |
| 224 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_43337_44089 | 250 |
| 225 | 3300047322 | Ga0495680_0001062 | Ga0495680_0001062_19750_20502 | 250 |
| 226 | 3300047322 | Ga0495680_0002013 | Ga0495680_0002013_10831_11583 | 250 |
| 227 | 3300047673 | Ga0495593_0062769 | Ga0495593_0062769_672_1424 | 250 |
| 228 | 3300048088 | Ga0495602_0001999 | Ga0495602_0001999_5497_6249 | 250 |
| 229 | 3300048903 | Ga0496100_0000116 | Ga0496100_0000116_4290_5051 | 250 |
| 230 | 3300048903 | Ga0496100_0007372 | Ga0496100_0007372_341_1114 | 250 |
| 231 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_365074_365835 | 250 |
| 232 | 3300048904 | Ga0496101_0026168 | Ga0496101_0026168_3215_3988 | 250 |
| 233 | 3300048904 | Ga0496101_0118595 | Ga0496101_0118595_574_1326 | 250 |
| 234 | 3300048905 | Ga0496102_0024171 | Ga0496102_0024171_251_1024 | 250 |
| 235 | 3300048907 | Ga0496104_0000147 | Ga0496104_0000147_63126_63878 | 250 |
| 236 | 3300048907 | Ga0496104_0159959 | Ga0496104_0159959_185_958 | 250 |
| 237 | 3300048908 | Ga0496105_0000138 | Ga0496105_0000138_10477_11229 | 250 |
| 238 | 3300048908 | Ga0496105_0011410 | Ga0496105_0011410_2831_3604 | 250 |
| 239 | 3300048909 | Ga0496106_0000177 | Ga0496106_0000177_40731_41492 | 250 |
| 240 | 3300048909 | Ga0496106_0027758 | Ga0496106_0027758_3253_4026 | 250 |
| 241 | 3300048910 | Ga0496107_0000081 | Ga0496107_0000081_40731_41492 | 250 |
| 242 | 3300048910 | Ga0496107_0044209 | Ga0496107_0044209_335_1108 | 250 |
| 243 | 3300048912 | Ga0496109_0000237 | Ga0496109_0000237_21144_21896 | 250 |
| 244 | 3300048912 | Ga0496109_0083279 | Ga0496109_0083279_250_1023 | 250 |
| 245 | 3300048913 | Ga0496110_0020908 | Ga0496110_0020908_4167_4940 | 250 |
| 246 | 3300048913 | Ga0496110_0041459 | Ga0496110_0041459_1066_1818 | 250 |
| 247 | 3300048914 | Ga0496111_0008241 | Ga0496111_0008241_3861_4613 | 250 |
| 248 | 3300048914 | Ga0496111_0040566 | Ga0496111_0040566_1970_2743 | 250 |
| 249 | 3300048915 | Ga0496112_0065433 | Ga0496112_0065433_569_1342 | 250 |
| 250 | 3300048915 | Ga0496112_0711770 | Ga0496112_0711770_21_806 | 250 |
| 251 | 3300048916 | Ga0496113_0050418 | Ga0496113_0050418_2175_2948 | 250 |
| 252 | 3300048916 | Ga0496113_0221942 | Ga0496113_0221942_594_1346 | 250 |
| 253 | 3300048917 | Ga0496114_0240246 | Ga0496114_0240246_785_1558 | 250 |
| 254 | 3300048918 | Ga0496115_0006099 | Ga0496115_0006099_3797_4549 | 250 |
| 255 | 3300049591 | Ga0501075_0000855 | Ga0501075_0000855_3093_3845 | 250 |
| 256 | 3300049591 | Ga0501075_0301056 | Ga0501075_0301056_382_1134 | 250 |
| 257 | 3300049592 | Ga0501076_0150554 | Ga0501076_0150554_810_1562 | 250 |
| 258 | 3300050511 | nmdc:mga08y16_462699_c1 | nmdc:mga08y16_462699_c1_358_1131 | 250 |
| 259 | 3300050513 | nmdc:mga0rr50_157568_c1 | nmdc:mga0rr50_157568_c1_103_864 | 250 |
| 260 | 3300050515 | nmdc:mga0a205_12_c3 | nmdc:mga0a205_12_c3_24365_25117 | 250 |
| 261 | 3300053078 | Ga0495612_0062205 | Ga0495612_0062205_460_1212 | 250 |
| 262 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_11764_12516 | 250 |
| 263 | 3300053084 | Ga0495595_0017403 | Ga0495595_0017403_847_1599 | 250 |
| 264 | 3300053085 | Ga0495619_0000024 | Ga0495619_0000024_10614_11366 | 250 |
| 265 | 3300053085 | Ga0495619_0000192 | Ga0495619_0000192_4549_5301 | 250 |
| 266 | 3300053085 | Ga0495619_0000980 | Ga0495619_0000980_12976_13728 | 250 |
| 267 | 3300053085 | Ga0495619_0024858 | Ga0495619_0024858_1725_2477 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r9q-assembly1.cif.gz_A | structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.9023 | 3 | 229 |
| 3qka-assembly1.cif.gz_E | crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum | 0.9018 | 2 | 236 |
| 4z0m-assembly1.cif.gz_C | echa5 mycobacterium tuberculosis | 0.8817 | 3 | 224 |
| 5xzd-assembly1.cif.gz_F | structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism | 0.8811 | 4 | 228 |
| 3hrx-assembly2.cif.gz_E | crystal structure of phenylacetic acid degradation protein paag | 0.8803 | 5 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qkaE02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9104 | 195 | 236 | 1.10.287.2460 |
| 3rsiB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; | 0.9073 | 84 | 192 | 3.90.226.20 |
| 4f47A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8997 | 2 | 194 | 3.90.226.10 |
| 4f47A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.895 | 2 | 194 | 3.90.226.10 |
| 3qkaE01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8914 | 2 | 194 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S3H8P0-F1-model_v4 | Enoyl-CoA hydratase | 0.9303 | 80 | 234 |
GO:0003824
|
| AF-A0A848YEP7-F1-model_v4 | Enoyl-CoA hydratase | 0.9218 | 80 | 246 |
|
| AF-A0A537ZCI5-F1-model_v4 | Crotonase/enoyl-CoA hydratase family protein | 0.907 | 1 | 250 |
GO:0003824
GO:0006631 |
| AF-A0A1H6DHM3-F1-model_v4 | Enoyl-CoA hydratase | 0.9064 | 5 | 227 |
GO:0003824
GO:0006631 |
| AF-A0A4R5AAP1-F1-model_v4 | Crotonase/enoyl-CoA hydratase family protein | 0.9057 | 4 | 246 |
GO:0003824
GO:0006631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar