F374827

General Info

Members Datasets Scaffolds Average Seq Length
267 167 267 217

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10159306|Ga0207686_101593061
Length 244
Sequence VGAALGWGAFAASSLILGALLGLWRRWPDRVVGVVLAFGAGALISAVSFDLAQEGVRLGGADSVALGLAAGGVTYFLADGLIDRLSQPRPRGSAVSTAPSANNGTALALGAFLDGIPEQMVLGIGLATGGGVSAGLLAAIFISNLPEAVGSATGMRAAGHAPRVVMRLWVSVAVICTLATVAGYGIADNVSGDFQAAVDGFAAGALLVMLIDSMIPQASQQAGKVAGLVTVLGFSVAAALSSIG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 7.49
Rhizosphere 83.9
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000300 3300000549 Bacteria 8822
2 LJQas_1010408 3300000549 Bacteria 1114
3 JGI24034J26672_10000180 3300002239 Bacteria 8646
4 JGI24742J22300_10003380 3300002244 Bacteria 2589
5 JGI25407J50210_10032757 3300003373 Bacteria 1343
6 Ga0070658_10287317 3300005327 Bacteria 1401
7 Ga0070683_100002781 3300005329 Bacteria 13987
8 Ga0070677_10000002 3300005333 Bacteria 87295
9 Ga0070666_10011180 3300005335 Bacteria 5626
10 Ga0070682_100000023 3300005337 Bacteria 206016
11 Ga0068868_100000095 3300005338 Bacteria 54537
12 Ga0068868_100002347 3300005338 Bacteria 13098
13 Ga0070691_10109034 3300005341 Bacteria 1383
14 Ga0070661_100000004 3300005344 Bacteria 243876
15 Ga0070692_10001832 3300005345 Bacteria 7969
16 Ga0070692_10187238 3300005345 Unclassified 1203
17 Ga0070669_100004289 3300005353 Bacteria 10305
18 Ga0070675_100000028 3300005354 Bacteria 103914
19 Ga0070674_100000003 3300005356 Bacteria 258221
20 Ga0070674_100374157 3300005356 Bacteria 1157
21 Ga0070688_100000251 3300005365 Bacteria 28262
22 Ga0070688_100196095 3300005365 Bacteria 1410
23 Ga0070659_100000080 3300005366 Bacteria 73366
24 Ga0070667_100049975 3300005367 Bacteria 3523
25 Ga0070710_10000019 3300005437 Bacteria 88049
26 Ga0070711_100003931 3300005439 Bacteria 8735
27 Ga0070700_100011279 3300005441 Bacteria 4947
28 Ga0070678_100008208 3300005456 Bacteria 6243
29 Ga0070678_100085923 3300005456 Bacteria 2398
30 Ga0070678_100466907 3300005456 Bacteria 1108
31 Ga0070685_10000053 3300005466 Bacteria 70868
32 Ga0070684_100017638 3300005535 Bacteria 5865
33 Ga0068853_100000104 3300005539 Bacteria 56511
34 Ga0068853_100058058 3300005539 Bacteria 3340
35 Ga0070672_100000567 3300005543 Bacteria 21663
36 Ga0070696_100347375 3300005546 Bacteria 1148
37 Ga0070665_100004723 3300005548 Bacteria 14190
38 Ga0070665_100007281 3300005548 Bacteria 11249
39 Ga0070665_100680353 3300005548 Bacteria 1042
40 Ga0070704_100617756 3300005549 Bacteria 954
41 Ga0070664_100010607 3300005564 Bacteria 7467
42 Ga0070702_100200351 3300005615 Bacteria 1321
43 Ga0068852_100000539 3300005616 Bacteria 24879
44 Ga0068852_100077754 3300005616 Bacteria 2934
45 Ga0068866_10000002 3300005718 Bacteria 394090
46 Ga0068861_100061108 3300005719 Bacteria 2891
47 Ga0068851_10001243 3300005834 Bacteria 11078
48 Ga0068851_10007448 3300005834 Bacteria 5026
49 Ga0068863_100000021 3300005841 Bacteria 198088
50 Ga0081455_10007367 3300005937 Bacteria 11599
51 Ga0081455_10017593 3300005937 Bacteria 6843
52 Ga0081455_10042199 3300005937 Bacteria 4004
53 Ga0081455_10247797 3300005937 Bacteria 1305
54 Ga0081538_10000999 3300005981 Bacteria 30090
55 Ga0081538_10001744 3300005981 Bacteria 22108
56 Ga0081538_10006163 3300005981 Bacteria 10632
57 Ga0081538_10016048 3300005981 Bacteria 5763
58 Ga0081538_10035465 3300005981 Bacteria 3276
59 Ga0081538_10040514 3300005981 Bacteria 2970
60 Ga0081538_10047903 3300005981 Bacteria 2615
61 Ga0081538_10145186 3300005981 Bacteria 1086
62 Ga0081540_1046834 3300005983 Bacteria 2179
63 Ga0075365_10027292 3300006038 Bacteria 3631
64 Ga0075365_10105567 3300006038 Bacteria 1932
65 Ga0075363_100216082 3300006048 Bacteria 1098
66 Ga0075364_10017960 3300006051 Bacteria 4424
67 Ga0075364_10069269 3300006051 Bacteria 2321
68 Ga0075364_10100336 3300006051 Bacteria 1927
69 Ga0075364_10229943 3300006051 Bacteria 1259
70 Ga0075367_10052273 3300006178 Bacteria 2417
71 Ga0075367_10100496 3300006178 Bacteria 1767
72 Ga0075428_100040283 3300006844 Bacteria 5141
73 Ga0075430_100186030 3300006846 Bacteria 1727
74 Ga0075431_100037110 3300006847 Bacteria 5022
75 Ga0075429_100005232 3300006880 Bacteria 11163
76 Ga0111539_10351476 3300009094 Bacteria 1715
77 Ga0111539_10472253 3300009094 Bacteria 1461
78 Ga0105245_10000040 3300009098 Bacteria 144005
79 Ga0105245_10277646 3300009098 Unclassified 1636
80 Ga0114129_10031774 3300009147 Bacteria 7463
81 Ga0114129_10036597 3300009147 Bacteria 6930
82 Ga0114129_10453034 3300009147 Bacteria 1682
83 Ga0105243_10013964 3300009148 Bacteria 6077
84 Ga0105243_10130739 3300009148 Bacteria 2129
85 Ga0105242_10032653 3300009176 Bacteria 4164
86 Ga0105248_10000175 3300009177 Bacteria 74795
87 Ga0105248_10371632 3300009177 Unclassified 1610
88 Ga0105239_11076420 3300010375 Bacteria 925
89 Ga0157371_10036470 3300013102 Bacteria 3521
90 Ga0157370_10013746 3300013104 Bacteria 8321
91 Ga0157378_10005783 3300013297 Bacteria 10838
92 Ga0157378_10056089 3300013297 Bacteria 3510
93 Ga0157372_10000210 3300013307 Bacteria 65290
94 Ga0157375_10581144 3300013308 Bacteria 1280
95 Ga0157375_10734883 3300013308 Bacteria 1139
96 Ga0157380_10389234 3300014326 Bacteria 1319
97 Ga0157379_10003275 3300014968 Bacteria 13715
98 Ga0163161_10000022 3300017792 Bacteria 207890
99 Ga0207656_10004764 3300025321 Bacteria 4761
100 Ga0207682_10000012 3300025893 Bacteria 84521
101 Ga0207692_10000004 3300025898 Bacteria 413600
102 Ga0207642_10000001 3300025899 Bacteria 714030
103 Ga0207642_10000003 3300025899 Bacteria 650651
104 Ga0207642_10000004 3300025899 Bacteria 407822
105 Ga0207680_10004412 3300025903 Bacteria 6670
106 Ga0207705_10031788 3300025909 Bacteria 3770
107 Ga0207663_10001792 3300025916 Bacteria 10130
108 Ga0207649_10000003 3300025920 Bacteria 388908
109 Ga0207681_10003168 3300025923 Bacteria 10332
110 Ga0207659_10000018 3300025926 Bacteria 156920
111 Ga0207687_10000142 3300025927 Bacteria 47994
112 Ga0207687_10214828 3300025927 Unclassified 1511
113 Ga0207690_10000126 3300025932 Bacteria 63035
114 Ga0207686_10159306 3300025934 Bacteria 1580
115 Ga0207686_10185990 3300025934 Bacteria 1477
116 Ga0207709_10054267 3300025935 Bacteria 2470
117 Ga0207669_10000036 3300025937 Bacteria 78568
118 Ga0207691_10000002 3300025940 Bacteria 189785
119 Ga0207661_10000693 3300025944 Bacteria 21892
120 Ga0207661_10000774 3300025944 Bacteria 20762
121 Ga0207661_10466734 3300025944 Bacteria 1151
122 Ga0207679_10017833 3300025945 Bacteria 4746
123 Ga0207640_10243595 3300025981 Bacteria 1391
124 Ga0207658_10024833 3300025986 Bacteria 4194
125 Ga0207658_10294352 3300025986 Bacteria 1396
126 Ga0207677_10000246 3300026023 Bacteria 41847
127 Ga0207677_10000361 3300026023 Bacteria 31898
128 Ga0207677_11001434 3300026023 Bacteria 758
129 Ga0207639_10000644 3300026041 Bacteria 24030
130 Ga0207708_10008186 3300026075 Bacteria 7744
131 Ga0207708_10052827 3300026075 Bacteria 3095
132 Ga0207708_10489116 3300026075 Bacteria 1030
133 Ga0207641_10000151 3300026088 Bacteria 99225
134 Ga0207675_100014252 3300026118 Bacteria 7410
135 Ga0207683_10006424 3300026121 Bacteria 10067
136 Ga0207683_10054449 3300026121 Bacteria 3508
137 Ga0207683_10391191 3300026121 Bacteria 1278
138 Ga0207683_10832291 3300026121 Bacteria 857
139 Ga0207698_10000004 3300026142 Bacteria 313614
140 Ga0207698_10010067 3300026142 Bacteria 6056
141 Ga0268266_10001210 3300028379 Bacteria 31835
142 Ga0268266_10063771 3300028379 Bacteria 3181
143 Ga0268266_10597116 3300028379 Bacteria 1060
144 Ga0307413_10010396 3300031824 Bacteria 4512
145 Ga0307406_10062969 3300031901 Bacteria 2401
146 Ga0307411_10267647 3300032005 Bacteria 1353
147 Ga0395901_0119855 3300038443 Bacteria 2765
148 Ga0395901_0588755 3300038443 Bacteria 1123
149 Ga0451791_1179843 3300041451 Bacteria 2176
150 Ga0451837_0601391 3300041494 Bacteria 2032
151 Ga0451841_0356125 3300041498 Bacteria 3720
152 Ga0451855_0877801 3300041511 Bacteria 736
153 Ga0451853_2436621 3300041512 Bacteria 1235
154 Ga0439448_0014052 3300042005 Unclassified 2412
155 Ga0439463_010259 3300042016 Bacteria 2303
156 Ga0451577_0319458 3300042876 Bacteria 1408
157 Ga0439440_0007333 3300042993 Unclassified 2238
158 Ga0495629_0165014 3300046459 Bacteria 1538
159 Ga0495641_0000040 3300046461 Bacteria 82337
160 Ga0495641_0049376 3300046461 Bacteria 1926
161 Ga0495584_0268839 3300046491 Bacteria 867
162 Ga0495606_0000017 3300046507 Bacteria 284549
163 Ga0495608_0020564 3300046511 Bacteria 4537
164 Ga0495620_0057298 3300046515 Bacteria 1636
165 Ga0495631_0150730 3300046518 Bacteria 998
166 Ga0495644_0113188 3300046523 Bacteria 1030
167 Ga0495656_0000222 3300046615 Bacteria 20249
168 Ga0495635_0464127 3300046663 Bacteria 836
169 Ga0495588_0000073 3300046674 Bacteria 219005
170 Ga0495647_0000049 3300046681 Bacteria 34446
171 Ga0495669_0003378 3300046684 Bacteria 6569
172 Ga0495613_0000094 3300046689 Bacteria 86601
173 Ga0495624_0000831 3300046690 Bacteria 24421
174 Ga0495589_0085477 3300046794 Bacteria 1533
175 Ga0495600_0021782 3300046809 Bacteria 4109
176 Ga0495604_0003648 3300047317 Bacteria 12274
177 Ga0495604_0012257 3300047317 Bacteria 6815
178 Ga0495676_0341536 3300047321 Bacteria 1002
179 Ga0495602_0000041 3300048088 Bacteria 126954
180 Ga0496104_0241256 3300048907 Bacteria 1720
181 Ga0496106_0237878 3300048909 Bacteria 1455
182 Ga0496107_0026065 3300048910 Bacteria 4143
183 Ga0496107_0185528 3300048910 Bacteria 1545
184 Ga0496108_0000039 3300048911 Bacteria 149440
185 Ga0496108_0402756 3300048911 Bacteria 1195
186 Ga0496109_0000038 3300048912 Bacteria 150745
187 Ga0496109_0000264 3300048912 Bacteria 50480
188 Ga0496109_0164035 3300048912 Bacteria 2082
189 Ga0496109_0697400 3300048912 Bacteria 953
190 Ga0496110_0176756 3300048913 Bacteria 1938
191 Ga0496110_0616296 3300048913 Bacteria 984
192 Ga0496111_0008958 3300048914 Bacteria 6657
193 Ga0496112_0000002 3300048915 Bacteria 782039
194 Ga0496112_0017954 3300048915 Bacteria 6657
195 Ga0496112_0254419 3300048915 Bacteria 1707
196 Ga0496113_0192170 3300048916 Bacteria 1620
197 Ga0496113_0323336 3300048916 Bacteria 1236
198 Ga0496114_0403966 3300048917 Bacteria 1210
199 Ga0496124_0173317 3300048927 Bacteria 1668
200 Ga0501036_0047544 3300049572 Bacteria 3633
201 Ga0501038_0261546 3300049574 Bacteria 1367
202 Ga0501040_0014806 3300049576 Bacteria 5147
203 Ga0501040_0355380 3300049576 Bacteria 1050
204 Ga0501041_0018033 3300049577 Bacteria 4202
205 Ga0501041_0021762 3300049577 Bacteria 3840
206 Ga0501041_0070584 3300049577 Bacteria 2144
207 Ga0501042_0009269 3300049578 Bacteria 6552
208 Ga0501042_0017237 3300049578 Bacteria 4979
209 Ga0501042_0065236 3300049578 Bacteria 2602
210 Ga0501046_0033075 3300049580 Bacteria 4182
211 Ga0501046_0143034 3300049580 Bacteria 1809
212 Ga0501046_0171880 3300049580 Bacteria 1626
213 Ga0501046_0386594 3300049580 Bacteria 1012
214 Ga0501048_0013604 3300049582 Bacteria 6038
215 Ga0501048_0174753 3300049582 Bacteria 1522
216 Ga0501068_0400768 3300049584 Bacteria 885
217 Ga0501071_0051574 3300049587 Bacteria 2965
218 Ga0501071_0370844 3300049587 Bacteria 1091
219 Ga0501072_0041035 3300049588 Bacteria 3634
220 Ga0501072_0114861 3300049588 Bacteria 2143
221 Ga0501072_0379158 3300049588 Bacteria 1122
222 Ga0501074_0075947 3300049590 Bacteria 2412
223 Ga0501074_0095826 3300049590 Bacteria 2125
224 Ga0501074_0149678 3300049590 Bacteria 1669
225 Ga0501075_0026442 3300049591 Bacteria 4272
226 Ga0501075_0086186 3300049591 Bacteria 2379
227 Ga0501075_0154897 3300049591 Bacteria 1747
228 Ga0501076_0003463 3300049592 Bacteria 11077
229 Ga0501076_0094585 3300049592 Bacteria 2406
230 Ga0501076_0179519 3300049592 Bacteria 1726
231 Ga0501079_0016623 3300049741 Bacteria 5620
232 Ga0501079_0025467 3300049741 Bacteria 4537
233 Ga0501079_0037189 3300049741 Bacteria 3751
234 Ga0501081_0021819 3300049743 Bacteria 4278
235 Ga0501081_0033730 3300049743 Bacteria 3480
236 Ga0501081_0056787 3300049743 Bacteria 2706
237 Ga0501083_0157391 3300049744 Bacteria 1487
238 Ga0501045_0022750 3300049824 Bacteria 4489
239 Ga0501045_0027680 3300049824 Bacteria 4087
240 Ga0501045_0048245 3300049824 Bacteria 3104
241 Ga0501045_0121970 3300049824 Bacteria 1935
242 Ga0501045_0344744 3300049824 Bacteria 1109
243 nmdc:mga03n38_109853_c1 3300050490 Bacteria 1341
244 nmdc:mga03n38_121721_c1 3300050490 Bacteria 1283
245 nmdc:mga03n38_94308_c1 3300050490 Bacteria 1431
246 nmdc:mga00v17_11172_c1 3300050491 Bacteria 4931
247 nmdc:mga00v17_192377_c1 3300050491 Bacteria 1318
248 nmdc:mga00v17_24818_c1 3300050491 Bacteria 2287
249 nmdc:mga0yw44_4234_c1 3300050492 Bacteria 6538
250 nmdc:mga06z11_337190_c1 3300050494 Bacteria 901
251 nmdc:mga05p37_118739_c1 3300050507 Bacteria 3249
252 nmdc:mga05p37_123626_c1 3300050507 Bacteria 3178
253 nmdc:mga05p37_150840_c1 3300050507 Bacteria 2843
254 nmdc:mga09592_7671_c1 3300050508 Bacteria 8772
255 nmdc:mga0qj67_172194_c1 3300050509 Bacteria 1758
256 nmdc:mga06r32_27173_c1 3300050510 Bacteria 5342
257 nmdc:mga06r32_629951_c1 3300050510 Bacteria 1042
258 nmdc:mga08y16_281251_c1 3300050511 Bacteria 1716
259 Ga0495601_0000017 3300053077 Bacteria 204209
260 Ga0495601_0088678 3300053077 Bacteria 1989
261 Ga0495595_0002179 3300053084 Bacteria 7613
262 Ga0500614_000359 3300053123 Bacteria 11912
263 Ga0501084_0005559 3300054114 Bacteria 10345
264 Ga0501084_0354564 3300054114 Bacteria 1239
265 Ga0501082_0195574 3300060353 Bacteria 1759
266 Ga0501082_0282782 3300060353 Bacteria 1444
267 Ga0530510_0035179 3300061734 Bacteria 3609

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1046834 Ga0081540_10468343 156
2 3300006844 Ga0075428_100040283 Ga0075428_1000402834 161
3 3300006846 Ga0075430_100186030 Ga0075430_1001860303 161
4 3300006847 Ga0075431_100037110 Ga0075431_1000371103 161
5 3300009147 Ga0114129_10031774 Ga0114129_100317747 161
6 3300050507 nmdc:mga05p37_123626_c1 nmdc:mga05p37_123626_c1_1376_2074 161
7 3300050509 nmdc:mga0qj67_172194_c1 nmdc:mga0qj67_172194_c1_957_1655 161
8 3300050510 nmdc:mga06r32_27173_c1 nmdc:mga06r32_27173_c1_4049_4747 161
9 3300046491 Ga0495584_0268839 Ga0495584_0268839_83_781 162
10 3300046523 Ga0495644_0113188 Ga0495644_0113188_233_931 162
11 3300046794 Ga0495589_0085477 Ga0495589_0085477_685_1383 162
12 3300047317 Ga0495604_0012257 Ga0495604_0012257_4838_5587 164
13 3300049587 Ga0501071_0370844 Ga0501071_0370844_479_1060 164
14 3300053077 Ga0495601_0000017 Ga0495601_0000017_190882_191631 164
15 3300005937 Ga0081455_10007367 Ga0081455_100073678 165
16 3300009177 Ga0105248_10000175 Ga0105248_1000017566 165
17 3300006051 Ga0075364_10017960 Ga0075364_100179605 167
18 3300050491 nmdc:mga00v17_192377_c1 nmdc:mga00v17_192377_c1_492_1232 167
19 3300050510 nmdc:mga06r32_629951_c1 nmdc:mga06r32_629951_c1_24_623 167
20 3300047317 Ga0495604_0003648 Ga0495604_0003648_5833_6582 168
21 3300048088 Ga0495602_0000041 Ga0495602_0000041_15631_16380 168
22 3300053084 Ga0495595_0002179 Ga0495595_0002179_408_1157 168
23 3300006038 Ga0075365_10027292 Ga0075365_100272924 169
24 3300006178 Ga0075367_10100496 Ga0075367_101004962 169
25 3300046689 Ga0495613_0000094 Ga0495613_0000094_69154_69942 169
26 3300049572 Ga0501036_0047544 Ga0501036_0047544_589_1284 171
27 3300049574 Ga0501038_0261546 Ga0501038_0261546_10_705 171
28 3300049577 Ga0501041_0018033 Ga0501041_0018033_3421_4116 171
29 3300049578 Ga0501042_0017237 Ga0501042_0017237_3026_3721 171
30 3300049580 Ga0501046_0143034 Ga0501046_0143034_164_859 171
31 3300049588 Ga0501072_0041035 Ga0501072_0041035_1796_2491 171
32 3300049591 Ga0501075_0086186 Ga0501075_0086186_930_1625 171
33 3300049741 Ga0501079_0037189 Ga0501079_0037189_1713_2408 171
34 3300049744 Ga0501083_0157391 Ga0501083_0157391_495_1190 171
35 3300049824 Ga0501045_0027680 Ga0501045_0027680_1600_2295 171
36 3300025986 Ga0207658_10294352 Ga0207658_102943523 172
37 3300005937 Ga0081455_10042199 Ga0081455_100421995 174
38 3300049577 Ga0501041_0070584 Ga0501041_0070584_472_1161 174
39 3300049578 Ga0501042_0065236 Ga0501042_0065236_1169_1858 174
40 3300049582 Ga0501048_0174753 Ga0501048_0174753_22_711 174
41 3300049587 Ga0501071_0051574 Ga0501071_0051574_1864_2553 174
42 3300049588 Ga0501072_0114861 Ga0501072_0114861_1198_1887 174
43 3300049590 Ga0501074_0149678 Ga0501074_0149678_210_899 174
44 3300049591 Ga0501075_0154897 Ga0501075_0154897_603_1292 174
45 3300049741 Ga0501079_0025467 Ga0501079_0025467_1721_2410 174
46 3300049743 Ga0501081_0021819 Ga0501081_0021819_764_1453 174
47 3300049824 Ga0501045_0022750 Ga0501045_0022750_1682_2371 174
48 3300054114 Ga0501084_0354564 Ga0501084_0354564_319_1008 174
49 3300061734 Ga0530510_0035179 Ga0530510_0035179_2647_3336 174
50 3300009098 Ga0105245_10277646 Ga0105245_102776463 176
51 3300009176 Ga0105242_10032653 Ga0105242_100326533 176
52 3300025981 Ga0207640_10243595 Ga0207640_102435952 177
53 3300005354 Ga0070675_100000028 Ga0070675_10000002822 178
54 3300005834 Ga0068851_10007448 Ga0068851_100074486 178
55 3300013307 Ga0157372_10000210 Ga0157372_1000021059 178
56 3300025321 Ga0207656_10004764 Ga0207656_100047642 178
57 3300025926 Ga0207659_10000018 Ga0207659_10000018159 178
58 3300006038 Ga0075365_10105567 Ga0075365_101055673 179
59 3300006051 Ga0075364_10229943 Ga0075364_102299432 179
60 3300009094 Ga0111539_10472253 Ga0111539_104722532 179
61 3300050490 nmdc:mga03n38_94308_c1 nmdc:mga03n38_94308_c1_238_960 179
62 3300050492 nmdc:mga0yw44_4234_c1 nmdc:mga0yw44_4234_c1_3076_3798 179
63 3300050511 nmdc:mga08y16_281251_c1 nmdc:mga08y16_281251_c1_678_1421 179
64 3300005981 Ga0081538_10040514 Ga0081538_100405142 180
65 3300050491 nmdc:mga00v17_11172_c1 nmdc:mga00v17_11172_c1_2121_2843 180
66 3300005338 Ga0068868_100002347 Ga0068868_10000234713 181
67 3300046681 Ga0495647_0000049 Ga0495647_0000049_17007_17762 181
68 3300005344 Ga0070661_100000004 Ga0070661_10000000416 182
69 3300005365 Ga0070688_100000251 Ga0070688_10000025115 182
70 3300005466 Ga0070685_10000053 Ga0070685_1000005359 182
71 3300005539 Ga0068853_100058058 Ga0068853_1000580582 182
72 3300005616 Ga0068852_100000539 Ga0068852_1000005399 182
73 3300005834 Ga0068851_10001243 Ga0068851_1000124313 182
74 3300013102 Ga0157371_10036470 Ga0157371_100364703 182
75 3300013104 Ga0157370_10013746 Ga0157370_100137465 182
76 3300013297 Ga0157378_10056089 Ga0157378_100560892 182
77 3300025909 Ga0207705_10031788 Ga0207705_100317883 182
78 3300025920 Ga0207649_10000003 Ga0207649_10000003242 182
79 3300026023 Ga0207677_10000361 Ga0207677_1000036123 182
80 3300026142 Ga0207698_10000004 Ga0207698_10000004292 182
81 3300046507 Ga0495606_0000017 Ga0495606_0000017_261111_261860 182
82 3300046674 Ga0495588_0000073 Ga0495588_0000073_3527_4276 182
83 3300046809 Ga0495600_0021782 Ga0495600_0021782_1611_2339 182
84 3300047321 Ga0495676_0341536 Ga0495676_0341536_50_799 182
85 3300048914 Ga0496111_0008958 Ga0496111_0008958_3434_4183 182
86 3300048927 Ga0496124_0173317 Ga0496124_0173317_852_1601 182
87 3300046615 Ga0495656_0000222 Ga0495656_0000222_603_1331 183
88 3300005543 Ga0070672_100000567 Ga0070672_10000056718 184
89 3300025940 Ga0207691_10000002 Ga0207691_10000002124 184
90 3300048913 Ga0496110_0176756 Ga0496110_0176756_1000_1728 184
91 3300005345 Ga0070692_10187238 Ga0070692_101872382 185
92 3300005535 Ga0070684_100017638 Ga0070684_1000176386 185
93 3300005549 Ga0070704_100617756 Ga0070704_1006177561 185
94 3300009177 Ga0105248_10371632 Ga0105248_103716323 185
95 3300025927 Ga0207687_10214828 Ga0207687_102148281 185
96 3300025944 Ga0207661_10000774 Ga0207661_100007748 185
97 3300038443 Ga0395901_0588755 Ga0395901_0588755_70_798 185
98 3300005329 Ga0070683_100002781 Ga0070683_10000278116 186
99 3300005365 Ga0070688_100196095 Ga0070688_1001960952 186
100 3300005456 Ga0070678_100008208 Ga0070678_1000082086 186
101 3300013297 Ga0157378_10005783 Ga0157378_1000578310 186
102 3300013308 Ga0157375_10734883 Ga0157375_107348832 186
103 3300025944 Ga0207661_10000693 Ga0207661_1000069316 186
104 3300026121 Ga0207683_10006424 Ga0207683_100064243 186
105 3300046461 Ga0495641_0049376 Ga0495641_0049376_848_1597 186
106 3300014968 Ga0157379_10003275 Ga0157379_1000327510 187
107 3300046459 Ga0495629_0165014 Ga0495629_0165014_138_866 187
108 3300005439 Ga0070711_100003931 Ga0070711_1000039316 188
109 3300025916 Ga0207663_10001792 Ga0207663_100017923 188
110 3300005367 Ga0070667_100049975 Ga0070667_1000499752 189
111 3300005564 Ga0070664_100010607 Ga0070664_1000106079 189
112 3300005937 Ga0081455_10017593 Ga0081455_100175937 189
113 3300014326 Ga0157380_10389234 Ga0157380_103892342 189
114 3300025945 Ga0207679_10017833 Ga0207679_100178333 189
115 3300025986 Ga0207658_10024833 Ga0207658_100248333 189
116 3300048910 Ga0496107_0185528 Ga0496107_0185528_712_1440 189
117 3300048911 Ga0496108_0000039 Ga0496108_0000039_42591_43325 190
118 3300048912 Ga0496109_0000038 Ga0496109_0000038_106345_107079 190
119 3300002239 JGI24034J26672_10000180 JGI24034J26672_100001809 191
120 3300002244 JGI24742J22300_10003380 JGI24742J22300_100033803 191
121 3300005333 Ga0070677_10000002 Ga0070677_1000000250 191
122 3300005981 Ga0081538_10001744 Ga0081538_1000174424 191
123 3300005981 Ga0081538_10006163 Ga0081538_1000616310 191
124 3300009098 Ga0105245_10000040 Ga0105245_10000040135 191
125 3300025893 Ga0207682_10000012 Ga0207682_1000001218 191
126 3300025927 Ga0207687_10000142 Ga0207687_100001424 191
127 3300003373 JGI25407J50210_10032757 JGI25407J50210_100327572 192
128 3300005327 Ga0070658_10287317 Ga0070658_102873172 192
129 3300005338 Ga0068868_100000095 Ga0068868_10000009540 192
130 3300005345 Ga0070692_10001832 Ga0070692_100018327 192
131 3300005548 Ga0070665_100007281 Ga0070665_1000072813 192
132 3300005981 Ga0081538_10000999 Ga0081538_1000099910 192
133 3300026023 Ga0207677_10000246 Ga0207677_100002468 192
134 3300028379 Ga0268266_10063771 Ga0268266_100637713 192
135 3300046663 Ga0495635_0464127 Ga0495635_0464127_37_765 192
136 3300048907 Ga0496104_0241256 Ga0496104_0241256_587_1327 192
137 3300006051 Ga0075364_10100336 Ga0075364_101003362 194
138 3300046518 Ga0495631_0150730 Ga0495631_0150730_260_958 194
139 3300005356 Ga0070674_100374157 Ga0070674_1003741571 195
140 3300005456 Ga0070678_100466907 Ga0070678_1004669071 195
141 3300005981 Ga0081538_10145186 Ga0081538_101451862 195
142 3300009148 Ga0105243_10013964 Ga0105243_100139645 195
143 3300025935 Ga0207709_10054267 Ga0207709_100542672 195
144 3300026121 Ga0207683_10391191 Ga0207683_103911912 195
145 3300031824 Ga0307413_10010396 Ga0307413_100103962 195
146 3300032005 Ga0307411_10267647 Ga0307411_102676472 195
147 3300048912 Ga0496109_0697400 Ga0496109_0697400_97_780 195
148 3300053077 Ga0495601_0088678 Ga0495601_0088678_46_774 195
149 3300005335 Ga0070666_10011180 Ga0070666_100111803 197
150 3300005548 Ga0070665_100004723 Ga0070665_1000047237 197
151 3300005616 Ga0068852_100077754 Ga0068852_1000777542 197
152 3300005981 Ga0081538_10047903 Ga0081538_100479035 197
153 3300025903 Ga0207680_10004412 Ga0207680_100044122 197
154 3300026142 Ga0207698_10010067 Ga0207698_100100672 197
155 3300028379 Ga0268266_10001210 Ga0268266_1000121031 197
156 3300046690 Ga0495624_0000831 Ga0495624_0000831_5417_6166 197
157 3300048912 Ga0496109_0000264 Ga0496109_0000264_29018_29767 197
158 3300005341 Ga0070691_10109034 Ga0070691_101090342 198
159 3300005456 Ga0070678_100085923 Ga0070678_1000859232 198
160 3300006048 Ga0075363_100216082 Ga0075363_1002160822 198
161 3300026121 Ga0207683_10054449 Ga0207683_100544492 198
162 3300031901 Ga0307406_10062969 Ga0307406_100629691 198
163 3300049576 Ga0501040_0355380 Ga0501040_0355380_213_908 198
164 3300049580 Ga0501046_0386594 Ga0501046_0386594_294_977 198
165 3300049584 Ga0501068_0400768 Ga0501068_0400768_149_844 198
166 3300049592 Ga0501076_0094585 Ga0501076_0094585_165_848 198
167 3300049824 Ga0501045_0121970 Ga0501045_0121970_160_843 198
168 3300050490 nmdc:mga03n38_109853_c1 nmdc:mga03n38_109853_c1_486_1181 198
169 3300060353 Ga0501082_0195574 Ga0501082_0195574_151_846 198
170 3300005546 Ga0070696_100347375 Ga0070696_1003473752 199
171 3300005937 Ga0081455_10247797 Ga0081455_102477972 199
172 3300006178 Ga0075367_10052273 Ga0075367_100522732 199
173 3300009147 Ga0114129_10453034 Ga0114129_104530343 199
174 3300026121 Ga0207683_10832291 Ga0207683_108322912 199
175 3300049576 Ga0501040_0014806 Ga0501040_0014806_1616_2299 199
176 3300049577 Ga0501041_0021762 Ga0501041_0021762_1072_1755 199
177 3300049578 Ga0501042_0009269 Ga0501042_0009269_2335_3018 199
178 3300049580 Ga0501046_0033075 Ga0501046_0033075_2348_3031 199
179 3300049582 Ga0501048_0013604 Ga0501048_0013604_1751_2434 199
180 3300049590 Ga0501074_0075947 Ga0501074_0075947_1615_2298 199
181 3300049591 Ga0501075_0026442 Ga0501075_0026442_2041_2724 199
182 3300049592 Ga0501076_0003463 Ga0501076_0003463_4909_5592 199
183 3300049741 Ga0501079_0016623 Ga0501079_0016623_808_1491 199
184 3300049743 Ga0501081_0033730 Ga0501081_0033730_1036_1719 199
185 3300049824 Ga0501045_0048245 Ga0501045_0048245_1921_2604 199
186 3300050490 nmdc:mga03n38_121721_c1 nmdc:mga03n38_121721_c1_411_1106 199
187 3300050494 nmdc:mga06z11_337190_c1 nmdc:mga06z11_337190_c1_155_850 199
188 3300050507 nmdc:mga05p37_150840_c1 nmdc:mga05p37_150840_c1_139_825 199
189 3300054114 Ga0501084_0005559 Ga0501084_0005559_8071_8754 199
190 3300005981 Ga0081538_10035465 Ga0081538_100354652 200
191 3300006880 Ga0075429_100005232 Ga0075429_1000052326 200
192 3300041451 Ga0451791_1179843 Ga0451791_1179843_875_1573 200
193 3300041494 Ga0451837_0601391 Ga0451837_0601391_728_1426 200
194 3300041498 Ga0451841_0356125 Ga0451841_0356125_262_960 200
195 3300041511 Ga0451855_0877801 Ga0451855_0877801_28_720 200
196 3300041512 Ga0451853_2436621 Ga0451853_2436621_45_743 200
197 3300042876 Ga0451577_0319458 Ga0451577_0319458_385_1104 200
198 3300049590 Ga0501074_0095826 Ga0501074_0095826_1199_1927 200
199 3300005981 Ga0081538_10016048 Ga0081538_100160484 201
200 3300026075 Ga0207708_10008186 Ga0207708_100081864 201
201 3300038443 Ga0395901_0119855 Ga0395901_0119855_563_1252 201
202 3300042005 Ga0439448_0014052 Ga0439448_0014052_66_755 201
203 3300042016 Ga0439463_010259 Ga0439463_010259_587_1276 201
204 3300042993 Ga0439440_0007333 Ga0439440_0007333_231_920 201
205 3300009094 Ga0111539_10351476 Ga0111539_103514762 202
206 3300009147 Ga0114129_10036597 Ga0114129_100365977 202
207 3300046684 Ga0495669_0003378 Ga0495669_0003378_5019_5732 202
208 3300048913 Ga0496110_0616296 Ga0496110_0616296_71_784 202
209 3300049588 Ga0501072_0379158 Ga0501072_0379158_14_730 202
210 3300050507 nmdc:mga05p37_118739_c1 nmdc:mga05p37_118739_c1_1924_2619 202
211 3300000549 LJQas_1010408 LJQas_10104083 203
212 3300005615 Ga0070702_100200351 Ga0070702_1002003512 203
213 3300010375 Ga0105239_11076420 Ga0105239_110764201 203
214 3300026023 Ga0207677_11001434 Ga0207677_110014341 203
215 3300026075 Ga0207708_10489116 Ga0207708_104891162 203
216 3300048909 Ga0496106_0237878 Ga0496106_0237878_85_807 203
217 3300048910 Ga0496107_0026065 Ga0496107_0026065_2890_3612 203
218 3300048911 Ga0496108_0402756 Ga0496108_0402756_287_1009 203
219 3300048912 Ga0496109_0164035 Ga0496109_0164035_409_1131 203
220 3300048915 Ga0496112_0017954 Ga0496112_0017954_5618_6340 203
221 3300048916 Ga0496113_0323336 Ga0496113_0323336_339_1061 203
222 3300048917 Ga0496114_0403966 Ga0496114_0403966_32_754 203
223 3300006051 Ga0075364_10069269 Ga0075364_100692693 204
224 3300049824 Ga0501045_0344744 Ga0501045_0344744_322_1041 204
225 3300050491 nmdc:mga00v17_24818_c1 nmdc:mga00v17_24818_c1_773_1492 204
226 3300005548 Ga0070665_100680353 Ga0070665_1006803532 205
227 3300017792 Ga0163161_10000022 Ga0163161_10000022205 205
228 3300025934 Ga0207686_10185990 Ga0207686_101859902 205
229 3300025944 Ga0207661_10466734 Ga0207661_104667342 205
230 3300028379 Ga0268266_10597116 Ga0268266_105971162 205
231 3300048916 Ga0496113_0192170 Ga0496113_0192170_45_770 205
232 3300049743 Ga0501081_0056787 Ga0501081_0056787_368_1093 205
233 3300000549 LJQas_1000300 LJQas_10003007 206
234 3300005337 Ga0070682_100000023 Ga0070682_10000002368 206
235 3300005353 Ga0070669_100004289 Ga0070669_10000428914 206
236 3300005356 Ga0070674_100000003 Ga0070674_100000003175 206
237 3300005366 Ga0070659_100000080 Ga0070659_10000008062 206
238 3300005437 Ga0070710_10000019 Ga0070710_1000001953 206
239 3300005441 Ga0070700_100011279 Ga0070700_1000112792 206
240 3300005539 Ga0068853_100000104 Ga0068853_10000010424 206
241 3300005718 Ga0068866_10000002 Ga0068866_10000002235 206
242 3300005719 Ga0068861_100061108 Ga0068861_1000611084 206
243 3300005841 Ga0068863_100000021 Ga0068863_100000021206 206
244 3300009148 Ga0105243_10130739 Ga0105243_101307392 206
245 3300013308 Ga0157375_10581144 Ga0157375_105811442 206
246 3300025898 Ga0207692_10000004 Ga0207692_1000000451 206
247 3300025899 Ga0207642_10000001 Ga0207642_10000001380 206
248 3300025899 Ga0207642_10000003 Ga0207642_10000003380 206
249 3300025899 Ga0207642_10000004 Ga0207642_10000004380 206
250 3300025923 Ga0207681_10003168 Ga0207681_1000316814 206
251 3300025932 Ga0207690_10000126 Ga0207690_1000012611 206
252 3300025934 Ga0207686_10159306 Ga0207686_101593061 206
253 3300025937 Ga0207669_10000036 Ga0207669_1000003644 206
254 3300026041 Ga0207639_10000644 Ga0207639_1000064419 206
255 3300026075 Ga0207708_10052827 Ga0207708_100528272 206
256 3300026088 Ga0207641_10000151 Ga0207641_10000151102 206
257 3300026118 Ga0207675_100014252 Ga0207675_1000142525 206
258 3300046461 Ga0495641_0000040 Ga0495641_0000040_27682_28410 206
259 3300046511 Ga0495608_0020564 Ga0495608_0020564_2409_3137 206
260 3300046515 Ga0495620_0057298 Ga0495620_0057298_593_1321 206
261 3300048915 Ga0496112_0000002 Ga0496112_0000002_606024_606752 206
262 3300048915 Ga0496112_0254419 Ga0496112_0254419_566_1294 206
263 3300049580 Ga0501046_0171880 Ga0501046_0171880_842_1570 206
264 3300049592 Ga0501076_0179519 Ga0501076_0179519_400_1128 206
265 3300050508 nmdc:mga09592_7671_c1 nmdc:mga09592_7671_c1_7447_8175 206
266 3300053123 Ga0500614_000359 Ga0500614_000359_10761_11489 206
267 3300060353 Ga0501082_0282782 Ga0501082_0282782_472_1200 206

Structural Annotation

Top 5 Hits

ID Description Score Start End
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.7213 4 206
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.72 4 206
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.7085 4 206
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.7072 4 206
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.7062 4 205
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4723 4 198 1.20.1250.20
af_Q8I4F6_299_497_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4397 6 194 1.20.1250.20
af_Q94AA1_189_464_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4142 6 205 1.20.1250.20
af_A0A0B4LFF4_625_844_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.41 7 198 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4043 4 198 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7T8CNJ1-F1-model_v4 deleted 0.8376 84 205
AF-A0A165MD40-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.8347 85 205 GO:0003700
GO:0005829
GO:0016020
AF-A0A2U0AEX8-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.8136 85 205 GO:0003700
GO:0005829
GO:0016020
AF-A0A0S7ZTR7-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.8 82 206 GO:0003700
GO:0005829
GO:0016020
AF-A0A7X3W6V8-F1-model_v4 deleted 0.7944 82 206

Feature Viewer

pLDDT pTM Quality
67.78 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map