F374827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 167 | 267 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300025934|Ga0207686_10159306|Ga0207686_101593061 |
| Length | 244 |
| Sequence | VGAALGWGAFAASSLILGALLGLWRRWPDRVVGVVLAFGAGALISAVSFDLAQEGVRLGGADSVALGLAAGGVTYFLADGLIDRLSQPRPRGSAVSTAPSANNGTALALGAFLDGIPEQMVLGIGLATGGGVSAGLLAAIFISNLPEAVGSATGMRAAGHAPRVVMRLWVSVAVICTLATVAGYGIADNVSGDFQAAVDGFAAGALLVMLIDSMIPQASQQAGKVAGLVTVLGFSVAAALSSIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 98 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 99 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 100 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 101 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 102 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 103 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 104 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 127 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 131 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 135 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 136 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 154 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 155 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 156 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 157 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 165 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.74 |
| Nodule | 0 |
| Rhizoplane | 7.49 |
| Rhizosphere | 83.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000300 | 3300000549 | Bacteria | 8822 |
| 2 | LJQas_1010408 | 3300000549 | Bacteria | 1114 |
| 3 | JGI24034J26672_10000180 | 3300002239 | Bacteria | 8646 |
| 4 | JGI24742J22300_10003380 | 3300002244 | Bacteria | 2589 |
| 5 | JGI25407J50210_10032757 | 3300003373 | Bacteria | 1343 |
| 6 | Ga0070658_10287317 | 3300005327 | Bacteria | 1401 |
| 7 | Ga0070683_100002781 | 3300005329 | Bacteria | 13987 |
| 8 | Ga0070677_10000002 | 3300005333 | Bacteria | 87295 |
| 9 | Ga0070666_10011180 | 3300005335 | Bacteria | 5626 |
| 10 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 11 | Ga0068868_100000095 | 3300005338 | Bacteria | 54537 |
| 12 | Ga0068868_100002347 | 3300005338 | Bacteria | 13098 |
| 13 | Ga0070691_10109034 | 3300005341 | Bacteria | 1383 |
| 14 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 15 | Ga0070692_10001832 | 3300005345 | Bacteria | 7969 |
| 16 | Ga0070692_10187238 | 3300005345 | Unclassified | 1203 |
| 17 | Ga0070669_100004289 | 3300005353 | Bacteria | 10305 |
| 18 | Ga0070675_100000028 | 3300005354 | Bacteria | 103914 |
| 19 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 20 | Ga0070674_100374157 | 3300005356 | Bacteria | 1157 |
| 21 | Ga0070688_100000251 | 3300005365 | Bacteria | 28262 |
| 22 | Ga0070688_100196095 | 3300005365 | Bacteria | 1410 |
| 23 | Ga0070659_100000080 | 3300005366 | Bacteria | 73366 |
| 24 | Ga0070667_100049975 | 3300005367 | Bacteria | 3523 |
| 25 | Ga0070710_10000019 | 3300005437 | Bacteria | 88049 |
| 26 | Ga0070711_100003931 | 3300005439 | Bacteria | 8735 |
| 27 | Ga0070700_100011279 | 3300005441 | Bacteria | 4947 |
| 28 | Ga0070678_100008208 | 3300005456 | Bacteria | 6243 |
| 29 | Ga0070678_100085923 | 3300005456 | Bacteria | 2398 |
| 30 | Ga0070678_100466907 | 3300005456 | Bacteria | 1108 |
| 31 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 32 | Ga0070684_100017638 | 3300005535 | Bacteria | 5865 |
| 33 | Ga0068853_100000104 | 3300005539 | Bacteria | 56511 |
| 34 | Ga0068853_100058058 | 3300005539 | Bacteria | 3340 |
| 35 | Ga0070672_100000567 | 3300005543 | Bacteria | 21663 |
| 36 | Ga0070696_100347375 | 3300005546 | Bacteria | 1148 |
| 37 | Ga0070665_100004723 | 3300005548 | Bacteria | 14190 |
| 38 | Ga0070665_100007281 | 3300005548 | Bacteria | 11249 |
| 39 | Ga0070665_100680353 | 3300005548 | Bacteria | 1042 |
| 40 | Ga0070704_100617756 | 3300005549 | Bacteria | 954 |
| 41 | Ga0070664_100010607 | 3300005564 | Bacteria | 7467 |
| 42 | Ga0070702_100200351 | 3300005615 | Bacteria | 1321 |
| 43 | Ga0068852_100000539 | 3300005616 | Bacteria | 24879 |
| 44 | Ga0068852_100077754 | 3300005616 | Bacteria | 2934 |
| 45 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 46 | Ga0068861_100061108 | 3300005719 | Bacteria | 2891 |
| 47 | Ga0068851_10001243 | 3300005834 | Bacteria | 11078 |
| 48 | Ga0068851_10007448 | 3300005834 | Bacteria | 5026 |
| 49 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 50 | Ga0081455_10007367 | 3300005937 | Bacteria | 11599 |
| 51 | Ga0081455_10017593 | 3300005937 | Bacteria | 6843 |
| 52 | Ga0081455_10042199 | 3300005937 | Bacteria | 4004 |
| 53 | Ga0081455_10247797 | 3300005937 | Bacteria | 1305 |
| 54 | Ga0081538_10000999 | 3300005981 | Bacteria | 30090 |
| 55 | Ga0081538_10001744 | 3300005981 | Bacteria | 22108 |
| 56 | Ga0081538_10006163 | 3300005981 | Bacteria | 10632 |
| 57 | Ga0081538_10016048 | 3300005981 | Bacteria | 5763 |
| 58 | Ga0081538_10035465 | 3300005981 | Bacteria | 3276 |
| 59 | Ga0081538_10040514 | 3300005981 | Bacteria | 2970 |
| 60 | Ga0081538_10047903 | 3300005981 | Bacteria | 2615 |
| 61 | Ga0081538_10145186 | 3300005981 | Bacteria | 1086 |
| 62 | Ga0081540_1046834 | 3300005983 | Bacteria | 2179 |
| 63 | Ga0075365_10027292 | 3300006038 | Bacteria | 3631 |
| 64 | Ga0075365_10105567 | 3300006038 | Bacteria | 1932 |
| 65 | Ga0075363_100216082 | 3300006048 | Bacteria | 1098 |
| 66 | Ga0075364_10017960 | 3300006051 | Bacteria | 4424 |
| 67 | Ga0075364_10069269 | 3300006051 | Bacteria | 2321 |
| 68 | Ga0075364_10100336 | 3300006051 | Bacteria | 1927 |
| 69 | Ga0075364_10229943 | 3300006051 | Bacteria | 1259 |
| 70 | Ga0075367_10052273 | 3300006178 | Bacteria | 2417 |
| 71 | Ga0075367_10100496 | 3300006178 | Bacteria | 1767 |
| 72 | Ga0075428_100040283 | 3300006844 | Bacteria | 5141 |
| 73 | Ga0075430_100186030 | 3300006846 | Bacteria | 1727 |
| 74 | Ga0075431_100037110 | 3300006847 | Bacteria | 5022 |
| 75 | Ga0075429_100005232 | 3300006880 | Bacteria | 11163 |
| 76 | Ga0111539_10351476 | 3300009094 | Bacteria | 1715 |
| 77 | Ga0111539_10472253 | 3300009094 | Bacteria | 1461 |
| 78 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 79 | Ga0105245_10277646 | 3300009098 | Unclassified | 1636 |
| 80 | Ga0114129_10031774 | 3300009147 | Bacteria | 7463 |
| 81 | Ga0114129_10036597 | 3300009147 | Bacteria | 6930 |
| 82 | Ga0114129_10453034 | 3300009147 | Bacteria | 1682 |
| 83 | Ga0105243_10013964 | 3300009148 | Bacteria | 6077 |
| 84 | Ga0105243_10130739 | 3300009148 | Bacteria | 2129 |
| 85 | Ga0105242_10032653 | 3300009176 | Bacteria | 4164 |
| 86 | Ga0105248_10000175 | 3300009177 | Bacteria | 74795 |
| 87 | Ga0105248_10371632 | 3300009177 | Unclassified | 1610 |
| 88 | Ga0105239_11076420 | 3300010375 | Bacteria | 925 |
| 89 | Ga0157371_10036470 | 3300013102 | Bacteria | 3521 |
| 90 | Ga0157370_10013746 | 3300013104 | Bacteria | 8321 |
| 91 | Ga0157378_10005783 | 3300013297 | Bacteria | 10838 |
| 92 | Ga0157378_10056089 | 3300013297 | Bacteria | 3510 |
| 93 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 94 | Ga0157375_10581144 | 3300013308 | Bacteria | 1280 |
| 95 | Ga0157375_10734883 | 3300013308 | Bacteria | 1139 |
| 96 | Ga0157380_10389234 | 3300014326 | Bacteria | 1319 |
| 97 | Ga0157379_10003275 | 3300014968 | Bacteria | 13715 |
| 98 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 99 | Ga0207656_10004764 | 3300025321 | Bacteria | 4761 |
| 100 | Ga0207682_10000012 | 3300025893 | Bacteria | 84521 |
| 101 | Ga0207692_10000004 | 3300025898 | Bacteria | 413600 |
| 102 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 103 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 104 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 105 | Ga0207680_10004412 | 3300025903 | Bacteria | 6670 |
| 106 | Ga0207705_10031788 | 3300025909 | Bacteria | 3770 |
| 107 | Ga0207663_10001792 | 3300025916 | Bacteria | 10130 |
| 108 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 109 | Ga0207681_10003168 | 3300025923 | Bacteria | 10332 |
| 110 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 111 | Ga0207687_10000142 | 3300025927 | Bacteria | 47994 |
| 112 | Ga0207687_10214828 | 3300025927 | Unclassified | 1511 |
| 113 | Ga0207690_10000126 | 3300025932 | Bacteria | 63035 |
| 114 | Ga0207686_10159306 | 3300025934 | Bacteria | 1580 |
| 115 | Ga0207686_10185990 | 3300025934 | Bacteria | 1477 |
| 116 | Ga0207709_10054267 | 3300025935 | Bacteria | 2470 |
| 117 | Ga0207669_10000036 | 3300025937 | Bacteria | 78568 |
| 118 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 119 | Ga0207661_10000693 | 3300025944 | Bacteria | 21892 |
| 120 | Ga0207661_10000774 | 3300025944 | Bacteria | 20762 |
| 121 | Ga0207661_10466734 | 3300025944 | Bacteria | 1151 |
| 122 | Ga0207679_10017833 | 3300025945 | Bacteria | 4746 |
| 123 | Ga0207640_10243595 | 3300025981 | Bacteria | 1391 |
| 124 | Ga0207658_10024833 | 3300025986 | Bacteria | 4194 |
| 125 | Ga0207658_10294352 | 3300025986 | Bacteria | 1396 |
| 126 | Ga0207677_10000246 | 3300026023 | Bacteria | 41847 |
| 127 | Ga0207677_10000361 | 3300026023 | Bacteria | 31898 |
| 128 | Ga0207677_11001434 | 3300026023 | Bacteria | 758 |
| 129 | Ga0207639_10000644 | 3300026041 | Bacteria | 24030 |
| 130 | Ga0207708_10008186 | 3300026075 | Bacteria | 7744 |
| 131 | Ga0207708_10052827 | 3300026075 | Bacteria | 3095 |
| 132 | Ga0207708_10489116 | 3300026075 | Bacteria | 1030 |
| 133 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 134 | Ga0207675_100014252 | 3300026118 | Bacteria | 7410 |
| 135 | Ga0207683_10006424 | 3300026121 | Bacteria | 10067 |
| 136 | Ga0207683_10054449 | 3300026121 | Bacteria | 3508 |
| 137 | Ga0207683_10391191 | 3300026121 | Bacteria | 1278 |
| 138 | Ga0207683_10832291 | 3300026121 | Bacteria | 857 |
| 139 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 140 | Ga0207698_10010067 | 3300026142 | Bacteria | 6056 |
| 141 | Ga0268266_10001210 | 3300028379 | Bacteria | 31835 |
| 142 | Ga0268266_10063771 | 3300028379 | Bacteria | 3181 |
| 143 | Ga0268266_10597116 | 3300028379 | Bacteria | 1060 |
| 144 | Ga0307413_10010396 | 3300031824 | Bacteria | 4512 |
| 145 | Ga0307406_10062969 | 3300031901 | Bacteria | 2401 |
| 146 | Ga0307411_10267647 | 3300032005 | Bacteria | 1353 |
| 147 | Ga0395901_0119855 | 3300038443 | Bacteria | 2765 |
| 148 | Ga0395901_0588755 | 3300038443 | Bacteria | 1123 |
| 149 | Ga0451791_1179843 | 3300041451 | Bacteria | 2176 |
| 150 | Ga0451837_0601391 | 3300041494 | Bacteria | 2032 |
| 151 | Ga0451841_0356125 | 3300041498 | Bacteria | 3720 |
| 152 | Ga0451855_0877801 | 3300041511 | Bacteria | 736 |
| 153 | Ga0451853_2436621 | 3300041512 | Bacteria | 1235 |
| 154 | Ga0439448_0014052 | 3300042005 | Unclassified | 2412 |
| 155 | Ga0439463_010259 | 3300042016 | Bacteria | 2303 |
| 156 | Ga0451577_0319458 | 3300042876 | Bacteria | 1408 |
| 157 | Ga0439440_0007333 | 3300042993 | Unclassified | 2238 |
| 158 | Ga0495629_0165014 | 3300046459 | Bacteria | 1538 |
| 159 | Ga0495641_0000040 | 3300046461 | Bacteria | 82337 |
| 160 | Ga0495641_0049376 | 3300046461 | Bacteria | 1926 |
| 161 | Ga0495584_0268839 | 3300046491 | Bacteria | 867 |
| 162 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 163 | Ga0495608_0020564 | 3300046511 | Bacteria | 4537 |
| 164 | Ga0495620_0057298 | 3300046515 | Bacteria | 1636 |
| 165 | Ga0495631_0150730 | 3300046518 | Bacteria | 998 |
| 166 | Ga0495644_0113188 | 3300046523 | Bacteria | 1030 |
| 167 | Ga0495656_0000222 | 3300046615 | Bacteria | 20249 |
| 168 | Ga0495635_0464127 | 3300046663 | Bacteria | 836 |
| 169 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 170 | Ga0495647_0000049 | 3300046681 | Bacteria | 34446 |
| 171 | Ga0495669_0003378 | 3300046684 | Bacteria | 6569 |
| 172 | Ga0495613_0000094 | 3300046689 | Bacteria | 86601 |
| 173 | Ga0495624_0000831 | 3300046690 | Bacteria | 24421 |
| 174 | Ga0495589_0085477 | 3300046794 | Bacteria | 1533 |
| 175 | Ga0495600_0021782 | 3300046809 | Bacteria | 4109 |
| 176 | Ga0495604_0003648 | 3300047317 | Bacteria | 12274 |
| 177 | Ga0495604_0012257 | 3300047317 | Bacteria | 6815 |
| 178 | Ga0495676_0341536 | 3300047321 | Bacteria | 1002 |
| 179 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 180 | Ga0496104_0241256 | 3300048907 | Bacteria | 1720 |
| 181 | Ga0496106_0237878 | 3300048909 | Bacteria | 1455 |
| 182 | Ga0496107_0026065 | 3300048910 | Bacteria | 4143 |
| 183 | Ga0496107_0185528 | 3300048910 | Bacteria | 1545 |
| 184 | Ga0496108_0000039 | 3300048911 | Bacteria | 149440 |
| 185 | Ga0496108_0402756 | 3300048911 | Bacteria | 1195 |
| 186 | Ga0496109_0000038 | 3300048912 | Bacteria | 150745 |
| 187 | Ga0496109_0000264 | 3300048912 | Bacteria | 50480 |
| 188 | Ga0496109_0164035 | 3300048912 | Bacteria | 2082 |
| 189 | Ga0496109_0697400 | 3300048912 | Bacteria | 953 |
| 190 | Ga0496110_0176756 | 3300048913 | Bacteria | 1938 |
| 191 | Ga0496110_0616296 | 3300048913 | Bacteria | 984 |
| 192 | Ga0496111_0008958 | 3300048914 | Bacteria | 6657 |
| 193 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 194 | Ga0496112_0017954 | 3300048915 | Bacteria | 6657 |
| 195 | Ga0496112_0254419 | 3300048915 | Bacteria | 1707 |
| 196 | Ga0496113_0192170 | 3300048916 | Bacteria | 1620 |
| 197 | Ga0496113_0323336 | 3300048916 | Bacteria | 1236 |
| 198 | Ga0496114_0403966 | 3300048917 | Bacteria | 1210 |
| 199 | Ga0496124_0173317 | 3300048927 | Bacteria | 1668 |
| 200 | Ga0501036_0047544 | 3300049572 | Bacteria | 3633 |
| 201 | Ga0501038_0261546 | 3300049574 | Bacteria | 1367 |
| 202 | Ga0501040_0014806 | 3300049576 | Bacteria | 5147 |
| 203 | Ga0501040_0355380 | 3300049576 | Bacteria | 1050 |
| 204 | Ga0501041_0018033 | 3300049577 | Bacteria | 4202 |
| 205 | Ga0501041_0021762 | 3300049577 | Bacteria | 3840 |
| 206 | Ga0501041_0070584 | 3300049577 | Bacteria | 2144 |
| 207 | Ga0501042_0009269 | 3300049578 | Bacteria | 6552 |
| 208 | Ga0501042_0017237 | 3300049578 | Bacteria | 4979 |
| 209 | Ga0501042_0065236 | 3300049578 | Bacteria | 2602 |
| 210 | Ga0501046_0033075 | 3300049580 | Bacteria | 4182 |
| 211 | Ga0501046_0143034 | 3300049580 | Bacteria | 1809 |
| 212 | Ga0501046_0171880 | 3300049580 | Bacteria | 1626 |
| 213 | Ga0501046_0386594 | 3300049580 | Bacteria | 1012 |
| 214 | Ga0501048_0013604 | 3300049582 | Bacteria | 6038 |
| 215 | Ga0501048_0174753 | 3300049582 | Bacteria | 1522 |
| 216 | Ga0501068_0400768 | 3300049584 | Bacteria | 885 |
| 217 | Ga0501071_0051574 | 3300049587 | Bacteria | 2965 |
| 218 | Ga0501071_0370844 | 3300049587 | Bacteria | 1091 |
| 219 | Ga0501072_0041035 | 3300049588 | Bacteria | 3634 |
| 220 | Ga0501072_0114861 | 3300049588 | Bacteria | 2143 |
| 221 | Ga0501072_0379158 | 3300049588 | Bacteria | 1122 |
| 222 | Ga0501074_0075947 | 3300049590 | Bacteria | 2412 |
| 223 | Ga0501074_0095826 | 3300049590 | Bacteria | 2125 |
| 224 | Ga0501074_0149678 | 3300049590 | Bacteria | 1669 |
| 225 | Ga0501075_0026442 | 3300049591 | Bacteria | 4272 |
| 226 | Ga0501075_0086186 | 3300049591 | Bacteria | 2379 |
| 227 | Ga0501075_0154897 | 3300049591 | Bacteria | 1747 |
| 228 | Ga0501076_0003463 | 3300049592 | Bacteria | 11077 |
| 229 | Ga0501076_0094585 | 3300049592 | Bacteria | 2406 |
| 230 | Ga0501076_0179519 | 3300049592 | Bacteria | 1726 |
| 231 | Ga0501079_0016623 | 3300049741 | Bacteria | 5620 |
| 232 | Ga0501079_0025467 | 3300049741 | Bacteria | 4537 |
| 233 | Ga0501079_0037189 | 3300049741 | Bacteria | 3751 |
| 234 | Ga0501081_0021819 | 3300049743 | Bacteria | 4278 |
| 235 | Ga0501081_0033730 | 3300049743 | Bacteria | 3480 |
| 236 | Ga0501081_0056787 | 3300049743 | Bacteria | 2706 |
| 237 | Ga0501083_0157391 | 3300049744 | Bacteria | 1487 |
| 238 | Ga0501045_0022750 | 3300049824 | Bacteria | 4489 |
| 239 | Ga0501045_0027680 | 3300049824 | Bacteria | 4087 |
| 240 | Ga0501045_0048245 | 3300049824 | Bacteria | 3104 |
| 241 | Ga0501045_0121970 | 3300049824 | Bacteria | 1935 |
| 242 | Ga0501045_0344744 | 3300049824 | Bacteria | 1109 |
| 243 | nmdc:mga03n38_109853_c1 | 3300050490 | Bacteria | 1341 |
| 244 | nmdc:mga03n38_121721_c1 | 3300050490 | Bacteria | 1283 |
| 245 | nmdc:mga03n38_94308_c1 | 3300050490 | Bacteria | 1431 |
| 246 | nmdc:mga00v17_11172_c1 | 3300050491 | Bacteria | 4931 |
| 247 | nmdc:mga00v17_192377_c1 | 3300050491 | Bacteria | 1318 |
| 248 | nmdc:mga00v17_24818_c1 | 3300050491 | Bacteria | 2287 |
| 249 | nmdc:mga0yw44_4234_c1 | 3300050492 | Bacteria | 6538 |
| 250 | nmdc:mga06z11_337190_c1 | 3300050494 | Bacteria | 901 |
| 251 | nmdc:mga05p37_118739_c1 | 3300050507 | Bacteria | 3249 |
| 252 | nmdc:mga05p37_123626_c1 | 3300050507 | Bacteria | 3178 |
| 253 | nmdc:mga05p37_150840_c1 | 3300050507 | Bacteria | 2843 |
| 254 | nmdc:mga09592_7671_c1 | 3300050508 | Bacteria | 8772 |
| 255 | nmdc:mga0qj67_172194_c1 | 3300050509 | Bacteria | 1758 |
| 256 | nmdc:mga06r32_27173_c1 | 3300050510 | Bacteria | 5342 |
| 257 | nmdc:mga06r32_629951_c1 | 3300050510 | Bacteria | 1042 |
| 258 | nmdc:mga08y16_281251_c1 | 3300050511 | Bacteria | 1716 |
| 259 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 260 | Ga0495601_0088678 | 3300053077 | Bacteria | 1989 |
| 261 | Ga0495595_0002179 | 3300053084 | Bacteria | 7613 |
| 262 | Ga0500614_000359 | 3300053123 | Bacteria | 11912 |
| 263 | Ga0501084_0005559 | 3300054114 | Bacteria | 10345 |
| 264 | Ga0501084_0354564 | 3300054114 | Bacteria | 1239 |
| 265 | Ga0501082_0195574 | 3300060353 | Bacteria | 1759 |
| 266 | Ga0501082_0282782 | 3300060353 | Bacteria | 1444 |
| 267 | Ga0530510_0035179 | 3300061734 | Bacteria | 3609 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1046834 | Ga0081540_10468343 | 156 |
| 2 | 3300006844 | Ga0075428_100040283 | Ga0075428_1000402834 | 161 |
| 3 | 3300006846 | Ga0075430_100186030 | Ga0075430_1001860303 | 161 |
| 4 | 3300006847 | Ga0075431_100037110 | Ga0075431_1000371103 | 161 |
| 5 | 3300009147 | Ga0114129_10031774 | Ga0114129_100317747 | 161 |
| 6 | 3300050507 | nmdc:mga05p37_123626_c1 | nmdc:mga05p37_123626_c1_1376_2074 | 161 |
| 7 | 3300050509 | nmdc:mga0qj67_172194_c1 | nmdc:mga0qj67_172194_c1_957_1655 | 161 |
| 8 | 3300050510 | nmdc:mga06r32_27173_c1 | nmdc:mga06r32_27173_c1_4049_4747 | 161 |
| 9 | 3300046491 | Ga0495584_0268839 | Ga0495584_0268839_83_781 | 162 |
| 10 | 3300046523 | Ga0495644_0113188 | Ga0495644_0113188_233_931 | 162 |
| 11 | 3300046794 | Ga0495589_0085477 | Ga0495589_0085477_685_1383 | 162 |
| 12 | 3300047317 | Ga0495604_0012257 | Ga0495604_0012257_4838_5587 | 164 |
| 13 | 3300049587 | Ga0501071_0370844 | Ga0501071_0370844_479_1060 | 164 |
| 14 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_190882_191631 | 164 |
| 15 | 3300005937 | Ga0081455_10007367 | Ga0081455_100073678 | 165 |
| 16 | 3300009177 | Ga0105248_10000175 | Ga0105248_1000017566 | 165 |
| 17 | 3300006051 | Ga0075364_10017960 | Ga0075364_100179605 | 167 |
| 18 | 3300050491 | nmdc:mga00v17_192377_c1 | nmdc:mga00v17_192377_c1_492_1232 | 167 |
| 19 | 3300050510 | nmdc:mga06r32_629951_c1 | nmdc:mga06r32_629951_c1_24_623 | 167 |
| 20 | 3300047317 | Ga0495604_0003648 | Ga0495604_0003648_5833_6582 | 168 |
| 21 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_15631_16380 | 168 |
| 22 | 3300053084 | Ga0495595_0002179 | Ga0495595_0002179_408_1157 | 168 |
| 23 | 3300006038 | Ga0075365_10027292 | Ga0075365_100272924 | 169 |
| 24 | 3300006178 | Ga0075367_10100496 | Ga0075367_101004962 | 169 |
| 25 | 3300046689 | Ga0495613_0000094 | Ga0495613_0000094_69154_69942 | 169 |
| 26 | 3300049572 | Ga0501036_0047544 | Ga0501036_0047544_589_1284 | 171 |
| 27 | 3300049574 | Ga0501038_0261546 | Ga0501038_0261546_10_705 | 171 |
| 28 | 3300049577 | Ga0501041_0018033 | Ga0501041_0018033_3421_4116 | 171 |
| 29 | 3300049578 | Ga0501042_0017237 | Ga0501042_0017237_3026_3721 | 171 |
| 30 | 3300049580 | Ga0501046_0143034 | Ga0501046_0143034_164_859 | 171 |
| 31 | 3300049588 | Ga0501072_0041035 | Ga0501072_0041035_1796_2491 | 171 |
| 32 | 3300049591 | Ga0501075_0086186 | Ga0501075_0086186_930_1625 | 171 |
| 33 | 3300049741 | Ga0501079_0037189 | Ga0501079_0037189_1713_2408 | 171 |
| 34 | 3300049744 | Ga0501083_0157391 | Ga0501083_0157391_495_1190 | 171 |
| 35 | 3300049824 | Ga0501045_0027680 | Ga0501045_0027680_1600_2295 | 171 |
| 36 | 3300025986 | Ga0207658_10294352 | Ga0207658_102943523 | 172 |
| 37 | 3300005937 | Ga0081455_10042199 | Ga0081455_100421995 | 174 |
| 38 | 3300049577 | Ga0501041_0070584 | Ga0501041_0070584_472_1161 | 174 |
| 39 | 3300049578 | Ga0501042_0065236 | Ga0501042_0065236_1169_1858 | 174 |
| 40 | 3300049582 | Ga0501048_0174753 | Ga0501048_0174753_22_711 | 174 |
| 41 | 3300049587 | Ga0501071_0051574 | Ga0501071_0051574_1864_2553 | 174 |
| 42 | 3300049588 | Ga0501072_0114861 | Ga0501072_0114861_1198_1887 | 174 |
| 43 | 3300049590 | Ga0501074_0149678 | Ga0501074_0149678_210_899 | 174 |
| 44 | 3300049591 | Ga0501075_0154897 | Ga0501075_0154897_603_1292 | 174 |
| 45 | 3300049741 | Ga0501079_0025467 | Ga0501079_0025467_1721_2410 | 174 |
| 46 | 3300049743 | Ga0501081_0021819 | Ga0501081_0021819_764_1453 | 174 |
| 47 | 3300049824 | Ga0501045_0022750 | Ga0501045_0022750_1682_2371 | 174 |
| 48 | 3300054114 | Ga0501084_0354564 | Ga0501084_0354564_319_1008 | 174 |
| 49 | 3300061734 | Ga0530510_0035179 | Ga0530510_0035179_2647_3336 | 174 |
| 50 | 3300009098 | Ga0105245_10277646 | Ga0105245_102776463 | 176 |
| 51 | 3300009176 | Ga0105242_10032653 | Ga0105242_100326533 | 176 |
| 52 | 3300025981 | Ga0207640_10243595 | Ga0207640_102435952 | 177 |
| 53 | 3300005354 | Ga0070675_100000028 | Ga0070675_10000002822 | 178 |
| 54 | 3300005834 | Ga0068851_10007448 | Ga0068851_100074486 | 178 |
| 55 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021059 | 178 |
| 56 | 3300025321 | Ga0207656_10004764 | Ga0207656_100047642 | 178 |
| 57 | 3300025926 | Ga0207659_10000018 | Ga0207659_10000018159 | 178 |
| 58 | 3300006038 | Ga0075365_10105567 | Ga0075365_101055673 | 179 |
| 59 | 3300006051 | Ga0075364_10229943 | Ga0075364_102299432 | 179 |
| 60 | 3300009094 | Ga0111539_10472253 | Ga0111539_104722532 | 179 |
| 61 | 3300050490 | nmdc:mga03n38_94308_c1 | nmdc:mga03n38_94308_c1_238_960 | 179 |
| 62 | 3300050492 | nmdc:mga0yw44_4234_c1 | nmdc:mga0yw44_4234_c1_3076_3798 | 179 |
| 63 | 3300050511 | nmdc:mga08y16_281251_c1 | nmdc:mga08y16_281251_c1_678_1421 | 179 |
| 64 | 3300005981 | Ga0081538_10040514 | Ga0081538_100405142 | 180 |
| 65 | 3300050491 | nmdc:mga00v17_11172_c1 | nmdc:mga00v17_11172_c1_2121_2843 | 180 |
| 66 | 3300005338 | Ga0068868_100002347 | Ga0068868_10000234713 | 181 |
| 67 | 3300046681 | Ga0495647_0000049 | Ga0495647_0000049_17007_17762 | 181 |
| 68 | 3300005344 | Ga0070661_100000004 | Ga0070661_10000000416 | 182 |
| 69 | 3300005365 | Ga0070688_100000251 | Ga0070688_10000025115 | 182 |
| 70 | 3300005466 | Ga0070685_10000053 | Ga0070685_1000005359 | 182 |
| 71 | 3300005539 | Ga0068853_100058058 | Ga0068853_1000580582 | 182 |
| 72 | 3300005616 | Ga0068852_100000539 | Ga0068852_1000005399 | 182 |
| 73 | 3300005834 | Ga0068851_10001243 | Ga0068851_1000124313 | 182 |
| 74 | 3300013102 | Ga0157371_10036470 | Ga0157371_100364703 | 182 |
| 75 | 3300013104 | Ga0157370_10013746 | Ga0157370_100137465 | 182 |
| 76 | 3300013297 | Ga0157378_10056089 | Ga0157378_100560892 | 182 |
| 77 | 3300025909 | Ga0207705_10031788 | Ga0207705_100317883 | 182 |
| 78 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003242 | 182 |
| 79 | 3300026023 | Ga0207677_10000361 | Ga0207677_1000036123 | 182 |
| 80 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004292 | 182 |
| 81 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_261111_261860 | 182 |
| 82 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_3527_4276 | 182 |
| 83 | 3300046809 | Ga0495600_0021782 | Ga0495600_0021782_1611_2339 | 182 |
| 84 | 3300047321 | Ga0495676_0341536 | Ga0495676_0341536_50_799 | 182 |
| 85 | 3300048914 | Ga0496111_0008958 | Ga0496111_0008958_3434_4183 | 182 |
| 86 | 3300048927 | Ga0496124_0173317 | Ga0496124_0173317_852_1601 | 182 |
| 87 | 3300046615 | Ga0495656_0000222 | Ga0495656_0000222_603_1331 | 183 |
| 88 | 3300005543 | Ga0070672_100000567 | Ga0070672_10000056718 | 184 |
| 89 | 3300025940 | Ga0207691_10000002 | Ga0207691_10000002124 | 184 |
| 90 | 3300048913 | Ga0496110_0176756 | Ga0496110_0176756_1000_1728 | 184 |
| 91 | 3300005345 | Ga0070692_10187238 | Ga0070692_101872382 | 185 |
| 92 | 3300005535 | Ga0070684_100017638 | Ga0070684_1000176386 | 185 |
| 93 | 3300005549 | Ga0070704_100617756 | Ga0070704_1006177561 | 185 |
| 94 | 3300009177 | Ga0105248_10371632 | Ga0105248_103716323 | 185 |
| 95 | 3300025927 | Ga0207687_10214828 | Ga0207687_102148281 | 185 |
| 96 | 3300025944 | Ga0207661_10000774 | Ga0207661_100007748 | 185 |
| 97 | 3300038443 | Ga0395901_0588755 | Ga0395901_0588755_70_798 | 185 |
| 98 | 3300005329 | Ga0070683_100002781 | Ga0070683_10000278116 | 186 |
| 99 | 3300005365 | Ga0070688_100196095 | Ga0070688_1001960952 | 186 |
| 100 | 3300005456 | Ga0070678_100008208 | Ga0070678_1000082086 | 186 |
| 101 | 3300013297 | Ga0157378_10005783 | Ga0157378_1000578310 | 186 |
| 102 | 3300013308 | Ga0157375_10734883 | Ga0157375_107348832 | 186 |
| 103 | 3300025944 | Ga0207661_10000693 | Ga0207661_1000069316 | 186 |
| 104 | 3300026121 | Ga0207683_10006424 | Ga0207683_100064243 | 186 |
| 105 | 3300046461 | Ga0495641_0049376 | Ga0495641_0049376_848_1597 | 186 |
| 106 | 3300014968 | Ga0157379_10003275 | Ga0157379_1000327510 | 187 |
| 107 | 3300046459 | Ga0495629_0165014 | Ga0495629_0165014_138_866 | 187 |
| 108 | 3300005439 | Ga0070711_100003931 | Ga0070711_1000039316 | 188 |
| 109 | 3300025916 | Ga0207663_10001792 | Ga0207663_100017923 | 188 |
| 110 | 3300005367 | Ga0070667_100049975 | Ga0070667_1000499752 | 189 |
| 111 | 3300005564 | Ga0070664_100010607 | Ga0070664_1000106079 | 189 |
| 112 | 3300005937 | Ga0081455_10017593 | Ga0081455_100175937 | 189 |
| 113 | 3300014326 | Ga0157380_10389234 | Ga0157380_103892342 | 189 |
| 114 | 3300025945 | Ga0207679_10017833 | Ga0207679_100178333 | 189 |
| 115 | 3300025986 | Ga0207658_10024833 | Ga0207658_100248333 | 189 |
| 116 | 3300048910 | Ga0496107_0185528 | Ga0496107_0185528_712_1440 | 189 |
| 117 | 3300048911 | Ga0496108_0000039 | Ga0496108_0000039_42591_43325 | 190 |
| 118 | 3300048912 | Ga0496109_0000038 | Ga0496109_0000038_106345_107079 | 190 |
| 119 | 3300002239 | JGI24034J26672_10000180 | JGI24034J26672_100001809 | 191 |
| 120 | 3300002244 | JGI24742J22300_10003380 | JGI24742J22300_100033803 | 191 |
| 121 | 3300005333 | Ga0070677_10000002 | Ga0070677_1000000250 | 191 |
| 122 | 3300005981 | Ga0081538_10001744 | Ga0081538_1000174424 | 191 |
| 123 | 3300005981 | Ga0081538_10006163 | Ga0081538_1000616310 | 191 |
| 124 | 3300009098 | Ga0105245_10000040 | Ga0105245_10000040135 | 191 |
| 125 | 3300025893 | Ga0207682_10000012 | Ga0207682_1000001218 | 191 |
| 126 | 3300025927 | Ga0207687_10000142 | Ga0207687_100001424 | 191 |
| 127 | 3300003373 | JGI25407J50210_10032757 | JGI25407J50210_100327572 | 192 |
| 128 | 3300005327 | Ga0070658_10287317 | Ga0070658_102873172 | 192 |
| 129 | 3300005338 | Ga0068868_100000095 | Ga0068868_10000009540 | 192 |
| 130 | 3300005345 | Ga0070692_10001832 | Ga0070692_100018327 | 192 |
| 131 | 3300005548 | Ga0070665_100007281 | Ga0070665_1000072813 | 192 |
| 132 | 3300005981 | Ga0081538_10000999 | Ga0081538_1000099910 | 192 |
| 133 | 3300026023 | Ga0207677_10000246 | Ga0207677_100002468 | 192 |
| 134 | 3300028379 | Ga0268266_10063771 | Ga0268266_100637713 | 192 |
| 135 | 3300046663 | Ga0495635_0464127 | Ga0495635_0464127_37_765 | 192 |
| 136 | 3300048907 | Ga0496104_0241256 | Ga0496104_0241256_587_1327 | 192 |
| 137 | 3300006051 | Ga0075364_10100336 | Ga0075364_101003362 | 194 |
| 138 | 3300046518 | Ga0495631_0150730 | Ga0495631_0150730_260_958 | 194 |
| 139 | 3300005356 | Ga0070674_100374157 | Ga0070674_1003741571 | 195 |
| 140 | 3300005456 | Ga0070678_100466907 | Ga0070678_1004669071 | 195 |
| 141 | 3300005981 | Ga0081538_10145186 | Ga0081538_101451862 | 195 |
| 142 | 3300009148 | Ga0105243_10013964 | Ga0105243_100139645 | 195 |
| 143 | 3300025935 | Ga0207709_10054267 | Ga0207709_100542672 | 195 |
| 144 | 3300026121 | Ga0207683_10391191 | Ga0207683_103911912 | 195 |
| 145 | 3300031824 | Ga0307413_10010396 | Ga0307413_100103962 | 195 |
| 146 | 3300032005 | Ga0307411_10267647 | Ga0307411_102676472 | 195 |
| 147 | 3300048912 | Ga0496109_0697400 | Ga0496109_0697400_97_780 | 195 |
| 148 | 3300053077 | Ga0495601_0088678 | Ga0495601_0088678_46_774 | 195 |
| 149 | 3300005335 | Ga0070666_10011180 | Ga0070666_100111803 | 197 |
| 150 | 3300005548 | Ga0070665_100004723 | Ga0070665_1000047237 | 197 |
| 151 | 3300005616 | Ga0068852_100077754 | Ga0068852_1000777542 | 197 |
| 152 | 3300005981 | Ga0081538_10047903 | Ga0081538_100479035 | 197 |
| 153 | 3300025903 | Ga0207680_10004412 | Ga0207680_100044122 | 197 |
| 154 | 3300026142 | Ga0207698_10010067 | Ga0207698_100100672 | 197 |
| 155 | 3300028379 | Ga0268266_10001210 | Ga0268266_1000121031 | 197 |
| 156 | 3300046690 | Ga0495624_0000831 | Ga0495624_0000831_5417_6166 | 197 |
| 157 | 3300048912 | Ga0496109_0000264 | Ga0496109_0000264_29018_29767 | 197 |
| 158 | 3300005341 | Ga0070691_10109034 | Ga0070691_101090342 | 198 |
| 159 | 3300005456 | Ga0070678_100085923 | Ga0070678_1000859232 | 198 |
| 160 | 3300006048 | Ga0075363_100216082 | Ga0075363_1002160822 | 198 |
| 161 | 3300026121 | Ga0207683_10054449 | Ga0207683_100544492 | 198 |
| 162 | 3300031901 | Ga0307406_10062969 | Ga0307406_100629691 | 198 |
| 163 | 3300049576 | Ga0501040_0355380 | Ga0501040_0355380_213_908 | 198 |
| 164 | 3300049580 | Ga0501046_0386594 | Ga0501046_0386594_294_977 | 198 |
| 165 | 3300049584 | Ga0501068_0400768 | Ga0501068_0400768_149_844 | 198 |
| 166 | 3300049592 | Ga0501076_0094585 | Ga0501076_0094585_165_848 | 198 |
| 167 | 3300049824 | Ga0501045_0121970 | Ga0501045_0121970_160_843 | 198 |
| 168 | 3300050490 | nmdc:mga03n38_109853_c1 | nmdc:mga03n38_109853_c1_486_1181 | 198 |
| 169 | 3300060353 | Ga0501082_0195574 | Ga0501082_0195574_151_846 | 198 |
| 170 | 3300005546 | Ga0070696_100347375 | Ga0070696_1003473752 | 199 |
| 171 | 3300005937 | Ga0081455_10247797 | Ga0081455_102477972 | 199 |
| 172 | 3300006178 | Ga0075367_10052273 | Ga0075367_100522732 | 199 |
| 173 | 3300009147 | Ga0114129_10453034 | Ga0114129_104530343 | 199 |
| 174 | 3300026121 | Ga0207683_10832291 | Ga0207683_108322912 | 199 |
| 175 | 3300049576 | Ga0501040_0014806 | Ga0501040_0014806_1616_2299 | 199 |
| 176 | 3300049577 | Ga0501041_0021762 | Ga0501041_0021762_1072_1755 | 199 |
| 177 | 3300049578 | Ga0501042_0009269 | Ga0501042_0009269_2335_3018 | 199 |
| 178 | 3300049580 | Ga0501046_0033075 | Ga0501046_0033075_2348_3031 | 199 |
| 179 | 3300049582 | Ga0501048_0013604 | Ga0501048_0013604_1751_2434 | 199 |
| 180 | 3300049590 | Ga0501074_0075947 | Ga0501074_0075947_1615_2298 | 199 |
| 181 | 3300049591 | Ga0501075_0026442 | Ga0501075_0026442_2041_2724 | 199 |
| 182 | 3300049592 | Ga0501076_0003463 | Ga0501076_0003463_4909_5592 | 199 |
| 183 | 3300049741 | Ga0501079_0016623 | Ga0501079_0016623_808_1491 | 199 |
| 184 | 3300049743 | Ga0501081_0033730 | Ga0501081_0033730_1036_1719 | 199 |
| 185 | 3300049824 | Ga0501045_0048245 | Ga0501045_0048245_1921_2604 | 199 |
| 186 | 3300050490 | nmdc:mga03n38_121721_c1 | nmdc:mga03n38_121721_c1_411_1106 | 199 |
| 187 | 3300050494 | nmdc:mga06z11_337190_c1 | nmdc:mga06z11_337190_c1_155_850 | 199 |
| 188 | 3300050507 | nmdc:mga05p37_150840_c1 | nmdc:mga05p37_150840_c1_139_825 | 199 |
| 189 | 3300054114 | Ga0501084_0005559 | Ga0501084_0005559_8071_8754 | 199 |
| 190 | 3300005981 | Ga0081538_10035465 | Ga0081538_100354652 | 200 |
| 191 | 3300006880 | Ga0075429_100005232 | Ga0075429_1000052326 | 200 |
| 192 | 3300041451 | Ga0451791_1179843 | Ga0451791_1179843_875_1573 | 200 |
| 193 | 3300041494 | Ga0451837_0601391 | Ga0451837_0601391_728_1426 | 200 |
| 194 | 3300041498 | Ga0451841_0356125 | Ga0451841_0356125_262_960 | 200 |
| 195 | 3300041511 | Ga0451855_0877801 | Ga0451855_0877801_28_720 | 200 |
| 196 | 3300041512 | Ga0451853_2436621 | Ga0451853_2436621_45_743 | 200 |
| 197 | 3300042876 | Ga0451577_0319458 | Ga0451577_0319458_385_1104 | 200 |
| 198 | 3300049590 | Ga0501074_0095826 | Ga0501074_0095826_1199_1927 | 200 |
| 199 | 3300005981 | Ga0081538_10016048 | Ga0081538_100160484 | 201 |
| 200 | 3300026075 | Ga0207708_10008186 | Ga0207708_100081864 | 201 |
| 201 | 3300038443 | Ga0395901_0119855 | Ga0395901_0119855_563_1252 | 201 |
| 202 | 3300042005 | Ga0439448_0014052 | Ga0439448_0014052_66_755 | 201 |
| 203 | 3300042016 | Ga0439463_010259 | Ga0439463_010259_587_1276 | 201 |
| 204 | 3300042993 | Ga0439440_0007333 | Ga0439440_0007333_231_920 | 201 |
| 205 | 3300009094 | Ga0111539_10351476 | Ga0111539_103514762 | 202 |
| 206 | 3300009147 | Ga0114129_10036597 | Ga0114129_100365977 | 202 |
| 207 | 3300046684 | Ga0495669_0003378 | Ga0495669_0003378_5019_5732 | 202 |
| 208 | 3300048913 | Ga0496110_0616296 | Ga0496110_0616296_71_784 | 202 |
| 209 | 3300049588 | Ga0501072_0379158 | Ga0501072_0379158_14_730 | 202 |
| 210 | 3300050507 | nmdc:mga05p37_118739_c1 | nmdc:mga05p37_118739_c1_1924_2619 | 202 |
| 211 | 3300000549 | LJQas_1010408 | LJQas_10104083 | 203 |
| 212 | 3300005615 | Ga0070702_100200351 | Ga0070702_1002003512 | 203 |
| 213 | 3300010375 | Ga0105239_11076420 | Ga0105239_110764201 | 203 |
| 214 | 3300026023 | Ga0207677_11001434 | Ga0207677_110014341 | 203 |
| 215 | 3300026075 | Ga0207708_10489116 | Ga0207708_104891162 | 203 |
| 216 | 3300048909 | Ga0496106_0237878 | Ga0496106_0237878_85_807 | 203 |
| 217 | 3300048910 | Ga0496107_0026065 | Ga0496107_0026065_2890_3612 | 203 |
| 218 | 3300048911 | Ga0496108_0402756 | Ga0496108_0402756_287_1009 | 203 |
| 219 | 3300048912 | Ga0496109_0164035 | Ga0496109_0164035_409_1131 | 203 |
| 220 | 3300048915 | Ga0496112_0017954 | Ga0496112_0017954_5618_6340 | 203 |
| 221 | 3300048916 | Ga0496113_0323336 | Ga0496113_0323336_339_1061 | 203 |
| 222 | 3300048917 | Ga0496114_0403966 | Ga0496114_0403966_32_754 | 203 |
| 223 | 3300006051 | Ga0075364_10069269 | Ga0075364_100692693 | 204 |
| 224 | 3300049824 | Ga0501045_0344744 | Ga0501045_0344744_322_1041 | 204 |
| 225 | 3300050491 | nmdc:mga00v17_24818_c1 | nmdc:mga00v17_24818_c1_773_1492 | 204 |
| 226 | 3300005548 | Ga0070665_100680353 | Ga0070665_1006803532 | 205 |
| 227 | 3300017792 | Ga0163161_10000022 | Ga0163161_10000022205 | 205 |
| 228 | 3300025934 | Ga0207686_10185990 | Ga0207686_101859902 | 205 |
| 229 | 3300025944 | Ga0207661_10466734 | Ga0207661_104667342 | 205 |
| 230 | 3300028379 | Ga0268266_10597116 | Ga0268266_105971162 | 205 |
| 231 | 3300048916 | Ga0496113_0192170 | Ga0496113_0192170_45_770 | 205 |
| 232 | 3300049743 | Ga0501081_0056787 | Ga0501081_0056787_368_1093 | 205 |
| 233 | 3300000549 | LJQas_1000300 | LJQas_10003007 | 206 |
| 234 | 3300005337 | Ga0070682_100000023 | Ga0070682_10000002368 | 206 |
| 235 | 3300005353 | Ga0070669_100004289 | Ga0070669_10000428914 | 206 |
| 236 | 3300005356 | Ga0070674_100000003 | Ga0070674_100000003175 | 206 |
| 237 | 3300005366 | Ga0070659_100000080 | Ga0070659_10000008062 | 206 |
| 238 | 3300005437 | Ga0070710_10000019 | Ga0070710_1000001953 | 206 |
| 239 | 3300005441 | Ga0070700_100011279 | Ga0070700_1000112792 | 206 |
| 240 | 3300005539 | Ga0068853_100000104 | Ga0068853_10000010424 | 206 |
| 241 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002235 | 206 |
| 242 | 3300005719 | Ga0068861_100061108 | Ga0068861_1000611084 | 206 |
| 243 | 3300005841 | Ga0068863_100000021 | Ga0068863_100000021206 | 206 |
| 244 | 3300009148 | Ga0105243_10130739 | Ga0105243_101307392 | 206 |
| 245 | 3300013308 | Ga0157375_10581144 | Ga0157375_105811442 | 206 |
| 246 | 3300025898 | Ga0207692_10000004 | Ga0207692_1000000451 | 206 |
| 247 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001380 | 206 |
| 248 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003380 | 206 |
| 249 | 3300025899 | Ga0207642_10000004 | Ga0207642_10000004380 | 206 |
| 250 | 3300025923 | Ga0207681_10003168 | Ga0207681_1000316814 | 206 |
| 251 | 3300025932 | Ga0207690_10000126 | Ga0207690_1000012611 | 206 |
| 252 | 3300025934 | Ga0207686_10159306 | Ga0207686_101593061 | 206 |
| 253 | 3300025937 | Ga0207669_10000036 | Ga0207669_1000003644 | 206 |
| 254 | 3300026041 | Ga0207639_10000644 | Ga0207639_1000064419 | 206 |
| 255 | 3300026075 | Ga0207708_10052827 | Ga0207708_100528272 | 206 |
| 256 | 3300026088 | Ga0207641_10000151 | Ga0207641_10000151102 | 206 |
| 257 | 3300026118 | Ga0207675_100014252 | Ga0207675_1000142525 | 206 |
| 258 | 3300046461 | Ga0495641_0000040 | Ga0495641_0000040_27682_28410 | 206 |
| 259 | 3300046511 | Ga0495608_0020564 | Ga0495608_0020564_2409_3137 | 206 |
| 260 | 3300046515 | Ga0495620_0057298 | Ga0495620_0057298_593_1321 | 206 |
| 261 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_606024_606752 | 206 |
| 262 | 3300048915 | Ga0496112_0254419 | Ga0496112_0254419_566_1294 | 206 |
| 263 | 3300049580 | Ga0501046_0171880 | Ga0501046_0171880_842_1570 | 206 |
| 264 | 3300049592 | Ga0501076_0179519 | Ga0501076_0179519_400_1128 | 206 |
| 265 | 3300050508 | nmdc:mga09592_7671_c1 | nmdc:mga09592_7671_c1_7447_8175 | 206 |
| 266 | 3300053123 | Ga0500614_000359 | Ga0500614_000359_10761_11489 | 206 |
| 267 | 3300060353 | Ga0501082_0282782 | Ga0501082_0282782_472_1200 | 206 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8czj-assembly1.cif.gz_B | a bacteria zrt/irt-like protein in the apo state | 0.7213 | 4 | 206 |
| 8czj-assembly1.cif.gz_A | a bacteria zrt/irt-like protein in the apo state | 0.72 | 4 | 206 |
| 8czj-assembly1.cif.gz_B | a bacteria zrt/irt-like protein in the apo state | 0.7085 | 4 | 206 |
| 8czj-assembly1.cif.gz_A | a bacteria zrt/irt-like protein in the apo state | 0.7072 | 4 | 206 |
| 7z6n-assembly1.cif.gz_A | crystal structure of zn2+-transporter bbzip in a metal-stripped state | 0.7062 | 4 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4723 | 4 | 198 | 1.20.1250.20 |
| af_Q8I4F6_299_497_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4397 | 6 | 194 | 1.20.1250.20 |
| af_Q94AA1_189_464_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4142 | 6 | 205 | 1.20.1250.20 |
| af_A0A0B4LFF4_625_844_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.41 | 7 | 198 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4043 | 4 | 198 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T8CNJ1-F1-model_v4 | deleted | 0.8376 | 84 | 205 |
|
| AF-A0A165MD40-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.8347 | 85 | 205 |
GO:0003700
GO:0005829 GO:0016020 |
| AF-A0A2U0AEX8-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.8136 | 85 | 205 |
GO:0003700
GO:0005829 GO:0016020 |
| AF-A0A0S7ZTR7-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.8 | 82 | 206 |
GO:0003700
GO:0005829 GO:0016020 |
| AF-A0A7X3W6V8-F1-model_v4 | deleted | 0.7944 | 82 | 206 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar