F374793

General Info

Members Datasets Scaffolds Average Seq Length
267 155 534 89

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10303150|Ga0213876_103031502
Length 103
Sequence MGSGYRVVDERPVFVTPEFAIQLVRESMMMMFWLSAPFLIAGFVTGIVTSLIQIVTSIQDAAFSTVPRLAVFLLVATITMPWVLQKAMGYAASILGNLSRYAG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 17.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10303150 3300021384 Bacteria 849
2 Ga0070683_100027286 3300005329 Bacteria 5148
3 Ga0070680_100300212 3300005336 Bacteria 1362
4 Ga0070680_100969949 3300005336 Unclassified 734
5 Ga0070682_100455038 3300005337 Unclassified 981
6 Ga0070660_100987745 3300005339 Bacteria 711
7 Ga0070661_101477756 3300005344 Bacteria 573
8 Ga0070675_100955679 3300005354 Bacteria 786
9 Ga0070667_100970951 3300005367 Bacteria 792
10 Ga0070709_10415045 3300005434 Bacteria 1008
11 Ga0070709_10918844 3300005434 Bacteria 693
12 Ga0070714_100002480 3300005435 Bacteria 13610
13 Ga0070714_100290920 3300005435 Unclassified 1520
14 Ga0070714_100658029 3300005435 Bacteria 1009
15 Ga0070714_102348670 3300005435 Bacteria 518
16 Ga0070713_100003653 3300005436 Bacteria 10184
17 Ga0070713_100122032 3300005436 Bacteria 2287
18 Ga0070713_100233928 3300005436 Bacteria 1671
19 Ga0070713_100659347 3300005436 Bacteria 997
20 Ga0070713_101113255 3300005436 Bacteria 763
21 Ga0070713_101605229 3300005436 Unclassified 631
22 Ga0070713_101639707 3300005436 Bacteria 624
23 Ga0070711_100015993 3300005439 Bacteria 4755
24 Ga0070711_100512659 3300005439 Bacteria 990
25 Ga0070678_101219194 3300005456 Bacteria 698
26 Ga0070681_10211386 3300005458 Bacteria 1856
27 Ga0070681_10330171 3300005458 Unclassified 1435
28 Ga0070706_100673061 3300005467 Bacteria 960
29 Ga0070679_100054838 3300005530 Bacteria 3969
30 Ga0070679_100091741 3300005530 Bacteria 3025
31 Ga0070679_100280109 3300005530 Bacteria 1620
32 Ga0070684_100160377 3300005535 Bacteria 2040
33 Ga0068853_100061743 3300005539 Bacteria 3242
34 Ga0070665_100610184 3300005548 Bacteria 1104
35 Ga0068855_100021634 3300005563 Bacteria 7714
36 Ga0068857_100526618 3300005577 Unclassified 1111
37 Ga0068856_100480805 3300005614 Bacteria 1263
38 Ga0068852_100127477 3300005616 Bacteria 2339
39 Ga0068852_100981756 3300005616 Unclassified 863
40 Ga0068859_100227707 3300005617 Bacteria 1952
41 Ga0068859_100624607 3300005617 Bacteria 1170
42 Ga0068863_100042788 3300005841 Bacteria 4303
43 Ga0068863_101325061 3300005841 Bacteria 727
44 Ga0068858_100091294 3300005842 Bacteria 2834
45 Ga0068858_100546749 3300005842 Bacteria 1121
46 Ga0068860_100944281 3300005843 Bacteria 879
47 Ga0070717_10007862 3300006028 Bacteria 7939
48 Ga0070717_10110312 3300006028 Bacteria 2346
49 Ga0070717_10475330 3300006028 Bacteria 1128
50 Ga0070717_10489237 3300006028 Unclassified 1111
51 Ga0070717_11009206 3300006028 Unclassified 758
52 Ga0070712_100029258 3300006175 Unclassified 3692
53 Ga0070712_100297914 3300006175 Unclassified 1304
54 Ga0097621_100338908 3300006237 Bacteria 1335
55 Ga0097621_101517145 3300006237 Bacteria 636
56 Ga0068871_100210325 3300006358 Bacteria 1682
57 Ga0068871_100408498 3300006358 Bacteria 1210
58 Ga0068871_100571894 3300006358 Bacteria 1025
59 Ga0068865_101624542 3300006881 Unclassified 581
60 Ga0097620_100227713 3300006931 Bacteria 1952
61 Ga0097620_100624650 3300006931 Bacteria 1170
62 Ga0105240_10001460 3300009093 Bacteria 40403
63 Ga0111539_11142698 3300009094 Bacteria 905
64 Ga0105241_11990312 3300009174 Unclassified 572
65 Ga0105241_12028207 3300009174 Unclassified 567
66 Ga0105242_10392837 3300009176 Bacteria 1292
67 Ga0105248_10033894 3300009177 Bacteria 5705
68 Ga0105248_10073623 3300009177 Bacteria 3839
69 Ga0105248_10144736 3300009177 Bacteria 2682
70 Ga0105248_10380688 3300009177 Bacteria 1589
71 Ga0105248_10461930 3300009177 Bacteria 1431
72 Ga0105237_10002228 3300009545 Bacteria 24235
73 Ga0105237_10569063 3300009545 Bacteria 1140
74 Ga0105238_10108739 3300009551 Bacteria 2754
75 Ga0105238_10250525 3300009551 Bacteria 1749
76 Ga0105238_11183486 3300009551 Bacteria 788
77 Ga0105239_10319994 3300010375 Bacteria 1749
78 Ga0105239_10683077 3300010375 Bacteria 1173
79 Ga0105246_11322271 3300011119 Bacteria 669
80 Ga0157371_10859822 3300013102 Unclassified 686
81 Ga0157370_10013007 3300013104 Bacteria 8597
82 Ga0157370_11396451 3300013104 Unclassified 630
83 Ga0157369_10170947 3300013105 Unclassified 2290
84 Ga0157369_12158832 3300013105 Bacteria 565
85 Ga0157374_10935233 3300013296 Bacteria 885
86 Ga0157378_10356117 3300013297 Unclassified 1431
87 Ga0157378_11410765 3300013297 Bacteria 740
88 Ga0157372_10066583 3300013307 Bacteria 4047
89 Ga0157372_10588846 3300013307 Bacteria 1297
90 Ga0157372_11410189 3300013307 Bacteria 803
91 Ga0163163_11295462 3300014325 Unclassified 791
92 Ga0157376_10551553 3300014969 Bacteria 1141
93 Ga0213873_10034480 3300021358 Bacteria 1276
94 Ga0213875_10179765 3300021388 Unclassified 993
95 Ga0213875_10246266 3300021388 Bacteria 843
96 Ga0207699_10312898 3300025906 Bacteria 1099
97 Ga0207699_10390323 3300025906 Bacteria 990
98 Ga0207699_10556655 3300025906 Unclassified 832
99 Ga0207705_10050551 3300025909 Bacteria 2993
100 Ga0207684_10522149 3300025910 Bacteria 1017
101 Ga0207707_10052188 3300025912 Bacteria 3562
102 Ga0207707_10336555 3300025912 Bacteria 1302
103 Ga0207707_10644512 3300025912 Unclassified 893
104 Ga0207695_10039103 3300025913 Bacteria 5101
105 Ga0207671_10016557 3300025914 Bacteria 5725
106 Ga0207671_10679835 3300025914 Bacteria 819
107 Ga0207693_10072620 3300025915 Unclassified 2694
108 Ga0207663_10032019 3300025916 Bacteria 3118
109 Ga0207660_10028952 3300025917 Bacteria 3795
110 Ga0207660_10577010 3300025917 Unclassified 915
111 Ga0207660_11628556 3300025917 Unclassified 520
112 Ga0207657_11368768 3300025919 Bacteria 532
113 Ga0207652_10081326 3300025921 Bacteria 2834
114 Ga0207652_10253300 3300025921 Unclassified 1588
115 Ga0207694_10315635 3300025924 Bacteria 1289
116 Ga0207694_11022357 3300025924 Bacteria 699
117 Ga0207659_10400389 3300025926 Bacteria 1148
118 Ga0207687_11146720 3300025927 Bacteria 668
119 Ga0207700_10001455 3300025928 Bacteria 13439
120 Ga0207700_10214483 3300025928 Bacteria 1629
121 Ga0207700_10677048 3300025928 Bacteria 920
122 Ga0207700_10960909 3300025928 Bacteria 765
123 Ga0207700_11633764 3300025928 Bacteria 570
124 Ga0207664_10012898 3300025929 Bacteria 5988
125 Ga0207664_11705466 3300025929 Bacteria 552
126 Ga0207711_10193729 3300025941 Bacteria 1853
127 Ga0207711_10361452 3300025941 Bacteria 1345
128 Ga0207661_10110848 3300025944 Bacteria 2321
129 Ga0207667_10735389 3300025949 Bacteria 987
130 Ga0207667_11710821 3300025949 Unclassified 595
131 Ga0207668_10776557 3300025972 Bacteria 847
132 Ga0207658_10909914 3300025986 Bacteria 801
133 Ga0207703_10128938 3300026035 Bacteria 2181
134 Ga0207703_11124924 3300026035 Bacteria 755
135 Ga0207639_10132765 3300026041 Bacteria 2063
136 Ga0207641_10014624 3300026088 Bacteria 6434
137 Ga0207641_11826757 3300026088 Bacteria 609
138 Ga0207683_11096487 3300026121 Bacteria 739
139 Ga0207698_10532174 3300026142 Bacteria 1149
140 Ga0268266_11403183 3300028379 Bacteria 674
141 Ga0268264_10873131 3300028381 Bacteria 902
142 Ga0265338_10027112 3300028800 Bacteria 5756
143 Ga0265338_10547585 3300028800 Bacteria 810
144 Ga0265324_10010391 3300029957 Bacteria 3590
145 Ga0265770_1040797 3300030878 Unclassified 811
146 Ga0265330_10027195 3300031235 Bacteria 2585
147 Ga0265332_10198687 3300031238 Bacteria 833
148 Ga0265328_10242770 3300031239 Bacteria 688
149 Ga0265320_10000164 3300031240 Bacteria 55580
150 Ga0265325_10073156 3300031241 Bacteria 1716
151 Ga0265325_10494833 3300031241 Unclassified 530
152 Ga0265340_10005151 3300031247 Bacteria 7270
153 Ga0265331_10000594 3300031250 Bacteria 32157
154 Ga0265331_10207940 3300031250 Unclassified 881
155 Ga0265331_10446092 3300031250 Bacteria 581
156 Ga0265316_10011607 3300031344 Bacteria 7933
157 Ga0265316_10163272 3300031344 Bacteria 1665
158 Ga0265314_10014520 3300031711 Bacteria 6296
159 Ga0265314_10193072 3300031711 Bacteria 1210
160 Ga0265342_10009613 3300031712 Bacteria 6789
161 Ga0265342_10278830 3300031712 Unclassified 885
162 Ga0373934_0007608 3300035086 Bacteria 4023
163 Ga0373934_0422088 3300035086 Bacteria 558
164 Ga0373945_0388154 3300035116 Bacteria 610
165 Ga0373953_0020712 3300035117 Bacteria 2459
166 Ga0373954_0025585 3300035118 Bacteria 2699
167 Ga0373954_0082385 3300035118 Bacteria 1538
168 Ga0373954_0648179 3300035118 Unclassified 523
169 Ga0373956_0007913 3300035119 Bacteria 4291
170 Ga0373943_0093833 3300035170 Bacteria 1558
171 Ga0373935_0129883 3300035692 Bacteria 1692
172 Ga0373935_0398356 3300035692 Bacteria 988
173 Ga0373927_0017626 3300035695 Bacteria 4698
174 Ga0373927_0664811 3300035695 Unclassified 688
175 Ga0373933_0056384 3300035724 Bacteria 2359
176 Ga0373933_0100903 3300035724 Bacteria 1791
177 Ga0373947_0014182 3300035725 Bacteria 4570
178 Ga0373947_0041856 3300035725 Bacteria 2734
179 Ga0373947_0097032 3300035725 Bacteria 1847
180 Ga0373947_0268947 3300035725 Unclassified 1131
181 Ga0373937_0021457 3300036401 Bacteria 5797
182 Ga0373937_0110900 3300036401 Bacteria 2552
183 Ga0373937_0174612 3300036401 Bacteria 2017
184 Ga0373937_0775900 3300036401 Bacteria 906
185 Ga0373925_0023942 3300037068 Bacteria 4455
186 Ga0373925_0460246 3300037068 Bacteria 1042
187 Ga0373925_1268294 3300037068 Unclassified 605
188 Ga0436364_0095316 3300037853 Bacteria 1769
189 Ga0436364_0356128 3300037853 Unclassified 527
190 Ga0436364_0493623 3300037853 Bacteria 532
191 Ga0436364_1282775 3300037853 Bacteria 2249
192 Ga0436364_1295473 3300037853 Bacteria 5335
193 Ga0436365_0214203 3300039437 Bacteria 2231
194 Ga0436365_0223392 3300039437 Bacteria 930
195 Ga0436365_1262724 3300039437 Bacteria 715
196 Ga0436365_1751676 3300039437 Unclassified 512
197 Ga0436361_0517655 3300039447 Unclassified 1247
198 Ga0436363_0618907 3300039450 Unclassified 1145
199 Ga0436363_1625543 3300039450 Unclassified 755
200 Ga0436362_0024091 3300039453 Unclassified 1927
201 Ga0451577_1866375 3300042876 Bacteria 527
202 Ga0466969_0295863 3300044656 Unclassified 733
203 Ga0453683_0985231 3300044673 Unclassified 559
204 Ga0466966_0635150 3300044684 Bacteria 643
205 Ga0466963_0071303 3300044694 Bacteria 2338
206 Ga0466963_0417043 3300044694 Bacteria 947
207 Ga0453684_0838856 3300044712 Bacteria 988
208 Ga0453684_1394717 3300044712 Bacteria 727
209 Ga0466957_1169975 3300044842 Unclassified 556
210 Ga0466959_0616010 3300045049 Bacteria 730
211 Ga0451576_0992110 3300045051 Bacteria 880
212 Ga0466967_0388645 3300045976 Bacteria 1356
213 Ga0466967_1756470 3300045976 Unclassified 618
214 Ga0495592_0012115 3300046454 Bacteria 6542
215 Ga0495651_0007679 3300046462 Bacteria 8246
216 Ga0495651_0374764 3300046462 Bacteria 935
217 Ga0495653_0081389 3300046463 Bacteria 2393
218 Ga0495653_0887827 3300046463 Unclassified 532
219 Ga0495580_0002556 3300046472 Bacteria 15858
220 Ga0495580_0449985 3300046472 Bacteria 864
221 Ga0495580_1009659 3300046472 Bacteria 530
222 Ga0495639_0062939 3300046475 Bacteria 1703
223 Ga0495662_0006722 3300046476 Bacteria 5730
224 Ga0495664_0017294 3300046477 Bacteria 4120
225 Ga0495664_0052651 3300046477 Bacteria 2420
226 Ga0495664_0280499 3300046477 Bacteria 1007
227 Ga0495608_0075859 3300046511 Bacteria 2191
228 Ga0495608_0378836 3300046511 Bacteria 868
229 Ga0495618_0036178 3300046514 Bacteria 3098
230 Ga0495628_0092909 3300046516 Bacteria 2333
231 Ga0495630_0249191 3300046517 Bacteria 1357
232 Ga0495630_0276733 3300046517 Unclassified 1282
233 Ga0495630_0624553 3300046517 Bacteria 825
234 Ga0495652_0089424 3300046529 Bacteria 2521
235 Ga0495652_1149312 3300046529 Bacteria 502
236 Ga0495665_0008922 3300046531 Bacteria 5441
237 Ga0495665_0198168 3300046531 Bacteria 1041
238 Ga0495665_0439216 3300046531 Unclassified 660
239 Ga0495640_0035052 3300046533 Bacteria 3554
240 Ga0495586_0148018 3300046535 Bacteria 1320
241 Ga0495587_0028243 3300046536 Bacteria 3412
242 Ga0495645_0052691 3300046543 Bacteria 2959
243 Ga0495645_0053271 3300046543 Bacteria 2942
244 Ga0495667_0017131 3300046559 Bacteria 4893
245 Ga0495667_0539271 3300046559 Bacteria 729
246 Ga0495634_0013446 3300046642 Bacteria 5914
247 Ga0495635_0010852 3300046663 Bacteria 6383
248 Ga0495599_0002828 3300046678 Bacteria 10110
249 Ga0495599_0466694 3300046678 Bacteria 746
250 Ga0495623_0048904 3300046679 Bacteria 2680
251 Ga0495623_0295628 3300046679 Bacteria 897
252 Ga0495646_0026430 3300046680 Bacteria 3646
253 Ga0495613_0030300 3300046689 Bacteria 4019
254 Ga0495613_0119410 3300046689 Bacteria 1894
255 Ga0495604_0056945 3300047317 Bacteria 3006
256 Ga0495674_0128892 3300047319 Bacteria 2132
257 Ga0495674_0189418 3300047319 Bacteria 1710
258 Ga0495680_0021789 3300047322 Bacteria 5356
259 Ga0495675_0668749 3300047444 Bacteria 584
260 Ga0495684_0011374 3300047471 Bacteria 6871
261 Ga0495684_0036949 3300047471 Bacteria 3744
262 Ga0495602_0150299 3300048088 Bacteria 1832
263 Ga0501047_1175064 3300049581 Bacteria 581
264 Ga0501048_0596592 3300049582 Bacteria 793
265 Ga0495601_0265957 3300053077 Bacteria 1119
266 Ga0495619_0157495 3300053085 Bacteria 1568
267 Ga0501082_0000117 3300060353 Bacteria 62783
268 Ga0213876_10303150
269 Ga0070683_100027286
270 Ga0070680_100300212
271 Ga0070680_100969949
272 Ga0070682_100455038
273 Ga0070660_100987745
274 Ga0070661_101477756
275 Ga0070675_100955679
276 Ga0070667_100970951
277 Ga0070709_10415045
278 Ga0070709_10918844
279 Ga0070714_100002480
280 Ga0070714_100290920
281 Ga0070714_100658029
282 Ga0070714_102348670
283 Ga0070713_100003653
284 Ga0070713_100122032
285 Ga0070713_100233928
286 Ga0070713_100659347
287 Ga0070713_101113255
288 Ga0070713_101605229
289 Ga0070713_101639707
290 Ga0070711_100015993
291 Ga0070711_100512659
292 Ga0070678_101219194
293 Ga0070681_10211386
294 Ga0070681_10330171
295 Ga0070706_100673061
296 Ga0070679_100054838
297 Ga0070679_100091741
298 Ga0070679_100280109
299 Ga0070684_100160377
300 Ga0068853_100061743
301 Ga0070665_100610184
302 Ga0068855_100021634
303 Ga0068857_100526618
304 Ga0068856_100480805
305 Ga0068852_100127477
306 Ga0068852_100981756
307 Ga0068859_100227707
308 Ga0068859_100624607
309 Ga0068863_100042788
310 Ga0068863_101325061
311 Ga0068858_100091294
312 Ga0068858_100546749
313 Ga0068860_100944281
314 Ga0070717_10007862
315 Ga0070717_10110312
316 Ga0070717_10475330
317 Ga0070717_10489237
318 Ga0070717_11009206
319 Ga0070712_100029258
320 Ga0070712_100297914
321 Ga0097621_100338908
322 Ga0097621_101517145
323 Ga0068871_100210325
324 Ga0068871_100408498
325 Ga0068871_100571894
326 Ga0068865_101624542
327 Ga0097620_100227713
328 Ga0097620_100624650
329 Ga0105240_10001460
330 Ga0111539_11142698
331 Ga0105241_11990312
332 Ga0105241_12028207
333 Ga0105242_10392837
334 Ga0105248_10033894
335 Ga0105248_10073623
336 Ga0105248_10144736
337 Ga0105248_10380688
338 Ga0105248_10461930
339 Ga0105237_10002228
340 Ga0105237_10569063
341 Ga0105238_10108739
342 Ga0105238_10250525
343 Ga0105238_11183486
344 Ga0105239_10319994
345 Ga0105239_10683077
346 Ga0105246_11322271
347 Ga0157371_10859822
348 Ga0157370_10013007
349 Ga0157370_11396451
350 Ga0157369_10170947
351 Ga0157369_12158832
352 Ga0157374_10935233
353 Ga0157378_10356117
354 Ga0157378_11410765
355 Ga0157372_10066583
356 Ga0157372_10588846
357 Ga0157372_11410189
358 Ga0163163_11295462
359 Ga0157376_10551553
360 Ga0213873_10034480
361 Ga0213875_10179765
362 Ga0213875_10246266
363 Ga0207699_10312898
364 Ga0207699_10390323
365 Ga0207699_10556655
366 Ga0207705_10050551
367 Ga0207684_10522149
368 Ga0207707_10052188
369 Ga0207707_10336555
370 Ga0207707_10644512
371 Ga0207695_10039103
372 Ga0207671_10016557
373 Ga0207671_10679835
374 Ga0207693_10072620
375 Ga0207663_10032019
376 Ga0207660_10028952
377 Ga0207660_10577010
378 Ga0207660_11628556
379 Ga0207657_11368768
380 Ga0207652_10081326
381 Ga0207652_10253300
382 Ga0207694_10315635
383 Ga0207694_11022357
384 Ga0207659_10400389
385 Ga0207687_11146720
386 Ga0207700_10001455
387 Ga0207700_10214483
388 Ga0207700_10677048
389 Ga0207700_10960909
390 Ga0207700_11633764
391 Ga0207664_10012898
392 Ga0207664_11705466
393 Ga0207711_10193729
394 Ga0207711_10361452
395 Ga0207661_10110848
396 Ga0207667_10735389
397 Ga0207667_11710821
398 Ga0207668_10776557
399 Ga0207658_10909914
400 Ga0207703_10128938
401 Ga0207703_11124924
402 Ga0207639_10132765
403 Ga0207641_10014624
404 Ga0207641_11826757
405 Ga0207683_11096487
406 Ga0207698_10532174
407 Ga0268266_11403183
408 Ga0268264_10873131
409 Ga0265338_10027112
410 Ga0265338_10547585
411 Ga0265324_10010391
412 Ga0265770_1040797
413 Ga0265330_10027195
414 Ga0265332_10198687
415 Ga0265328_10242770
416 Ga0265320_10000164
417 Ga0265325_10073156
418 Ga0265325_10494833
419 Ga0265340_10005151
420 Ga0265331_10000594
421 Ga0265331_10207940
422 Ga0265331_10446092
423 Ga0265316_10011607
424 Ga0265316_10163272
425 Ga0265314_10014520
426 Ga0265314_10193072
427 Ga0265342_10009613
428 Ga0265342_10278830
429 Ga0373934_0007608
430 Ga0373934_0422088
431 Ga0373945_0388154
432 Ga0373953_0020712
433 Ga0373954_0025585
434 Ga0373954_0082385
435 Ga0373954_0648179
436 Ga0373956_0007913
437 Ga0373943_0093833
438 Ga0373935_0129883
439 Ga0373935_0398356
440 Ga0373927_0017626
441 Ga0373927_0664811
442 Ga0373933_0056384
443 Ga0373933_0100903
444 Ga0373947_0014182
445 Ga0373947_0041856
446 Ga0373947_0097032
447 Ga0373947_0268947
448 Ga0373937_0021457
449 Ga0373937_0110900
450 Ga0373937_0174612
451 Ga0373937_0775900
452 Ga0373925_0023942
453 Ga0373925_0460246
454 Ga0373925_1268294
455 Ga0436364_0095316
456 Ga0436364_0356128
457 Ga0436364_0493623
458 Ga0436364_1282775
459 Ga0436364_1295473
460 Ga0436365_0214203
461 Ga0436365_0223392
462 Ga0436365_1262724
463 Ga0436365_1751676
464 Ga0436361_0517655
465 Ga0436363_0618907
466 Ga0436363_1625543
467 Ga0436362_0024091
468 Ga0451577_1866375
469 Ga0466969_0295863
470 Ga0453683_0985231
471 Ga0466966_0635150
472 Ga0466963_0071303
473 Ga0466963_0417043
474 Ga0453684_0838856
475 Ga0453684_1394717
476 Ga0466957_1169975
477 Ga0466959_0616010
478 Ga0451576_0992110
479 Ga0466967_0388645
480 Ga0466967_1756470
481 Ga0495592_0012115
482 Ga0495651_0007679
483 Ga0495651_0374764
484 Ga0495653_0081389
485 Ga0495653_0887827
486 Ga0495580_0002556
487 Ga0495580_0449985
488 Ga0495580_1009659
489 Ga0495639_0062939
490 Ga0495662_0006722
491 Ga0495664_0017294
492 Ga0495664_0052651
493 Ga0495664_0280499
494 Ga0495608_0075859
495 Ga0495608_0378836
496 Ga0495618_0036178
497 Ga0495628_0092909
498 Ga0495630_0249191
499 Ga0495630_0276733
500 Ga0495630_0624553
501 Ga0495652_0089424
502 Ga0495652_1149312
503 Ga0495665_0008922
504 Ga0495665_0198168
505 Ga0495665_0439216
506 Ga0495640_0035052
507 Ga0495586_0148018
508 Ga0495587_0028243
509 Ga0495645_0052691
510 Ga0495645_0053271
511 Ga0495667_0017131
512 Ga0495667_0539271
513 Ga0495634_0013446
514 Ga0495635_0010852
515 Ga0495599_0002828
516 Ga0495599_0466694
517 Ga0495623_0048904
518 Ga0495623_0295628
519 Ga0495646_0026430
520 Ga0495613_0030300
521 Ga0495613_0119410
522 Ga0495604_0056945
523 Ga0495674_0128892
524 Ga0495674_0189418
525 Ga0495680_0021789
526 Ga0495675_0668749
527 Ga0495684_0011374
528 Ga0495684_0036949
529 Ga0495602_0150299
530 Ga0501047_1175064
531 Ga0501048_0596592
532 Ga0495601_0265957
533 Ga0495619_0157495
534 Ga0501082_0000117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

19

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.9268 4 81
6r6b-assembly1.cif.gz_H structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.9139 4 85
7ah9-assembly1.cif.gz_1J substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 1 0.9041 4 81
8axk-assembly1.cif.gz_G type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri 0.8975 1 85
7bin-assembly1.cif.gz_G salmonella export gate and rod refined in focussed c1 map 0.8936 1 89
ID Description Score Start End Superfamily
af_Q9VJA5_252_399_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6066 9 67 1.50.40.10
af_I1NCY8_1_170_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5784 9 88 1.50.40.10
4v1hC00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.542 6 82 1.20.20.10
3vr8G00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5411 12 75 1.20.1300.10
af_I1NCY8_1_170_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5335 9 88 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A7W8SW73-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9703 10 87 GO:0005886
GO:0009306
AF-A0A2A5DXV4-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9643 1 87 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-A0A653I7H0-F1-model_v4 Surface presentation of antigens protein SpaQ 0.9633 6 84 GO:0005886
GO:0009306
AF-H6SJ43-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9629 1 82 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-D2TZS3-F1-model_v4 Type III secretion protein EscS,SsaS,YscS 0.9627 14 85 GO:0005886
GO:0009306

Map