F374785

General Info

Members Datasets Scaffolds Average Seq Length
267 191 534 267

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1032925|Ga0182005_10329252
Length 304
Sequence VSGNASASTGIVHQGATAWRFTAEDTSPRRVRTTATDIEATGGSVLTRDGLRRVLDDGFTVVRGLFGRDEIDRLCGEFAALHAAGRVPGHFEPRPGGDPLAAYPRVMHPHEINEVARGVLLDARLRGVLEVLLGEEVLAAQSMFYFKPPGARGQALHQDNFYLRVEPGTCVAAWVACDVTDRDNGGLEVVPGTHLMDLFCPEEADAAASFAREYVAPPPGPATVPVDMAPGDVLFFNGSLVHGSQPNRTADRFRRSFIGHYVGRSAERIGHYYRTLSMNGERVTLAESEGAGPCGTEFAPHGLH

Samples

Sample ID Description Type Environment
1 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
19 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
20 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
21 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
22 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
23 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
24 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
25 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
28 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
33 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
34 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
35 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
36 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
43 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
137 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
138 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
139 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
140 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
143 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
144 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
145 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
146 2643221647 Streptomyces sp. Root369 Isolate Unclassified
147 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
148 2643221714 Streptomyces sp. Root264 Isolate Unclassified
149 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
150 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
151 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
152 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
153 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
154 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
155 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
156 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
157 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
158 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
159 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
160 2862574272 Streptomyces sp. AcE210 Isolate Nodule
161 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
162 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
163 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
164 2867369537 Streptomyces sp. Z26 Isolate Unclassified
165 2867428634 Streptomyces sp. RP5T Isolate Unclassified
166 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
167 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
168 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
169 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
170 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
171 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
172 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
173 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
174 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
175 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
176 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
177 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
178 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
179 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
180 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
181 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
182 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
183 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
184 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
185 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
186 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
187 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
188 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
189 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
190 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
191 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.27
Metatranscriptomes 0
Isolates 18.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 1.12
Rhizoplane 0.37
Rhizosphere 71.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182005_1032925 3300015265 Bacteria 1410
2 JGI24738J21930_10019481 3300002075 Bacteria 1414
3 rootL2_10019369 3300003322 Bacteria 3384
4 rootL2_10083558 3300003322 Bacteria 1226
5 Ga0068853_100043780 3300005539 Bacteria 3830
6 Ga0068854_100414751 3300005578 Bacteria 1117
7 Ga0081455_10096100 3300005937 Bacteria 2390
8 Ga0075365_10069808 3300006038 Bacteria 2362
9 Ga0075363_100009341 3300006048 Bacteria 4608
10 Ga0075370_10032544 3300006353 Bacteria 2916
11 Ga0105246_10030134 3300011119 Bacteria 3580
12 Ga0157369_10614972 3300013105 Bacteria 1121
13 Ga0182008_10000517 3300014497 Bacteria 28996
14 Ga0183367_1016 3300015688 Bacteria 290198
15 Ga0207647_10040834 3300025904 Bacteria 2920
16 Ga0207646_10662835 3300025922 Bacteria 934
17 Ga0207640_10271468 3300025981 Bacteria 1327
18 Ga0209371_1012979 3300027312 Bacteria 2375
19 Ga0307517_10004242 3300028786 Bacteria 22110
20 Ga0307517_10022034 3300028786 Bacteria 8008
21 Ga0307515_10000475 3300028794 Bacteria 96024
22 Ga0307515_10130035 3300028794 Bacteria 2781
23 Ga0307515_10175870 3300028794 Bacteria 2112
24 Ga0307511_10000376 3300030521 Bacteria 47587
25 Ga0307511_10033224 3300030521 Bacteria 4559
26 Ga0307511_10075304 3300030521 Bacteria 2424
27 Ga0307512_10010100 3300030522 Bacteria 9035
28 Ga0307512_10013567 3300030522 Bacteria 7630
29 Ga0307512_10084059 3300030522 Bacteria 2265
30 Ga0307513_10006848 3300031456 Bacteria 14843
31 Ga0307509_10009368 3300031507 Bacteria 12267
32 Ga0307509_10085999 3300031507 Bacteria 3234
33 Ga0307508_10009013 3300031616 Bacteria 9193
34 Ga0307508_10128339 3300031616 Bacteria 2139
35 Ga0307514_10008253 3300031649 Bacteria 8887
36 Ga0307514_10171258 3300031649 Bacteria 1417
37 Ga0307516_10001403 3300031730 Bacteria 33329
38 Ga0307516_10010222 3300031730 Bacteria 10346
39 Ga0307516_10302800 3300031730 Bacteria 1274
40 Ga0307518_10094048 3300031838 Bacteria 2153
41 Ga0307518_10155515 3300031838 Bacteria 1577
42 Ga0307518_10222975 3300031838 Bacteria 1228
43 Ga0307507_10013285 3300033179 Bacteria 10018
44 Ga0307507_10033449 3300033179 Bacteria 5338
45 Ga0307510_10054704 3300033180 Bacteria 4177
46 Ga0307510_10139122 3300033180 Bacteria 2076
47 Ga0395900_0349918 3300037418 Bacteria 1451
48 Ga0395898_0023248 3300037466 Bacteria 6264
49 Ga0439436_0028386 3300041404 Bacteria 1633
50 Ga0439439_0022280 3300041406 Bacteria 1582
51 Ga0451807_2764247 3300041486 Bacteria 1262
52 Ga0451845_0959541 3300041501 Bacteria 982
53 Ga0451853_0126529 3300041512 Bacteria 12358
54 Ga0451853_1155382 3300041512 Bacteria 1264
55 Ga0451853_1748371 3300041512 Bacteria 3512
56 Ga0439448_0048312 3300042005 Bacteria 1389
57 Ga0439432_051440 3300042006 Bacteria 1284
58 Ga0439449_0006297 3300042007 Bacteria 4537
59 Ga0439457_001397 3300042014 Bacteria 7268
60 Ga0439457_007820 3300042014 Bacteria 2550
61 Ga0450894_000400 3300042131 Bacteria 7436
62 Ga0450903_000097 3300042138 Bacteria 18334
63 Ga0450906_020658 3300042145 Bacteria 1177
64 Ga0439458_0001039 3300042157 Bacteria 7089
65 Ga0439458_0016552 3300042157 Bacteria 1678
66 Ga0466969_0010991 3300044656 Bacteria 4793
67 Ga0466969_0024677 3300044656 Bacteria 3093
68 Ga0466972_0010185 3300044658 Bacteria 4724
69 Ga0466972_0010535 3300044658 Bacteria 4639
70 Ga0466972_0013599 3300044658 Bacteria 4084
71 Ga0466972_0014028 3300044658 Bacteria 4017
72 Ga0466965_0004280 3300044683 Bacteria 6346
73 Ga0466965_0037161 3300044683 Bacteria 2391
74 Ga0466966_0005950 3300044684 Bacteria 8048
75 Ga0466966_0008906 3300044684 Bacteria 6649
76 Ga0466961_0000403 3300044693 Bacteria 27800
77 Ga0466963_0051875 3300044694 Bacteria 2720
78 Ga0466963_0068864 3300044694 Bacteria 2377
79 Ga0466964_0000909 3300044706 Bacteria 9712
80 Ga0466971_0004038 3300044719 Bacteria 6317
81 Ga0466968_0035515 3300044735 Bacteria 2086
82 Ga0466970_0000470 3300044765 Bacteria 19986
83 Ga0466957_0000355 3300044842 Bacteria 22485
84 Ga0466959_0002377 3300045049 Bacteria 11999
85 Ga0466959_0028322 3300045049 Bacteria 4155
86 Ga0466958_0001104 3300045836 Bacteria 12428
87 Ga0466967_0048838 3300045976 Bacteria 3698
88 Ga0466967_0238634 3300045976 Bacteria 1733
89 Ga0495617_018401 3300046452 Bacteria 2362
90 Ga0495627_021778 3300046453 Bacteria 2119
91 Ga0495592_0004950 3300046454 Bacteria 9803
92 Ga0495603_0018538 3300046455 Bacteria 4209
93 Ga0495629_0014151 3300046459 Bacteria 5746
94 Ga0495629_0027668 3300046459 Bacteria 4025
95 Ga0495629_0032348 3300046459 Bacteria 3703
96 Ga0495651_0008789 3300046462 Bacteria 7745
97 Ga0495580_0227581 3300046472 Bacteria 1281
98 Ga0495662_0000967 3300046476 Bacteria 14077
99 Ga0495664_0002187 3300046477 Bacteria 10473
100 Ga0495585_0031218 3300046492 Bacteria 3025
101 Ga0495594_0188011 3300046499 Bacteria 1176
102 Ga0495596_0035178 3300046500 Bacteria 1987
103 Ga0495607_0017664 3300046501 Bacteria 4571
104 Ga0495607_0095611 3300046501 Bacteria 1601
105 Ga0495606_0007291 3300046507 Bacteria 9962
106 Ga0495608_0062724 3300046511 Bacteria 2441
107 Ga0495608_0179940 3300046511 Bacteria 1338
108 Ga0495610_0053296 3300046512 Bacteria 1960
109 Ga0495616_0026319 3300046513 Bacteria 3098
110 Ga0495618_0019205 3300046514 Bacteria 4203
111 Ga0495620_0009634 3300046515 Bacteria 5127
112 Ga0495620_0017154 3300046515 Bacteria 3616
113 Ga0495628_0043305 3300046516 Bacteria 3587
114 Ga0495628_0067103 3300046516 Bacteria 2802
115 Ga0495630_0061204 3300046517 Bacteria 2827
116 Ga0495631_0003995 3300046518 Bacteria 7948
117 Ga0495643_0005782 3300046522 Bacteria 8276
118 Ga0495643_0015093 3300046522 Bacteria 4576
119 Ga0495648_0030065 3300046524 Bacteria 3598
120 Ga0495652_0017705 3300046529 Bacteria 6359
121 Ga0495640_0036790 3300046533 Bacteria 3456
122 Ga0495640_0117898 3300046533 Bacteria 1728
123 Ga0495587_0001083 3300046536 Bacteria 17867
124 Ga0495597_0008241 3300046542 Bacteria 5236
125 Ga0495597_0076781 3300046542 Bacteria 1432
126 Ga0495645_0017466 3300046543 Bacteria 5140
127 Ga0495667_0031622 3300046559 Bacteria 3551
128 Ga0495668_0006551 3300046616 Bacteria 7607
129 Ga0495668_0015312 3300046616 Bacteria 4483
130 Ga0495634_0010260 3300046642 Bacteria 6862
131 Ga0495634_0041783 3300046642 Bacteria 3113
132 Ga0495611_0065659 3300046648 Bacteria 1653
133 Ga0495625_0060059 3300046660 Bacteria 2694
134 Ga0495635_0005227 3300046663 Bacteria 9030
135 Ga0495635_0118636 3300046663 Bacteria 1805
136 Ga0495588_0004815 3300046674 Bacteria 5974
137 Ga0495588_0056892 3300046674 Bacteria 2019
138 Ga0495657_0002922 3300046675 Bacteria 14168
139 Ga0495623_0158809 3300046679 Bacteria 1330
140 Ga0495623_0188966 3300046679 Bacteria 1192
141 Ga0495646_0000391 3300046680 Bacteria 22965
142 Ga0495646_0142015 3300046680 Bacteria 1342
143 Ga0495613_0003910 3300046689 Bacteria 11152
144 Ga0495613_0024497 3300046689 Bacteria 4496
145 Ga0495613_0036537 3300046689 Bacteria 3642
146 Ga0495624_0198565 3300046690 Bacteria 1219
147 Ga0495671_0004467 3300046692 Bacteria 8358
148 Ga0495649_0023812 3300046694 Bacteria 3419
149 Ga0495649_0207153 3300046694 Bacteria 1017
150 Ga0495589_0001839 3300046794 Bacteria 12052
151 Ga0495589_0011316 3300046794 Bacteria 4631
152 Ga0495589_0025234 3300046794 Bacteria 3017
153 Ga0495589_0047740 3300046794 Bacteria 2121
154 Ga0495589_0169775 3300046794 Bacteria 1037
155 Ga0495600_0033582 3300046809 Bacteria 3331
156 Ga0495600_0121266 3300046809 Bacteria 1700
157 Ga0495660_0030087 3300046810 Bacteria 3060
158 Ga0495660_0103670 3300046810 Bacteria 1461
159 Ga0495604_0006569 3300047317 Bacteria 9218
160 Ga0495636_0011287 3300047318 Bacteria 3535
161 Ga0495636_0013129 3300047318 Bacteria 3285
162 Ga0495636_0155767 3300047318 Bacteria 1027
163 Ga0495636_0204776 3300047318 Bacteria 902
164 Ga0495676_0014761 3300047321 Bacteria 6976
165 Ga0495676_0065597 3300047321 Bacteria 2817
166 Ga0495680_0007332 3300047322 Bacteria 10143
167 Ga0495687_001299 3300047443 Bacteria 23456
168 Ga0495687_023072 3300047443 Bacteria 2978
169 Ga0495687_031469 3300047443 Bacteria 2434
170 Ga0495687_052611 3300047443 Bacteria 1720
171 Ga0495687_075758 3300047443 Bacteria 1333
172 Ga0495675_0011703 3300047444 Bacteria 5509
173 Ga0495675_0052377 3300047444 Bacteria 2592
174 Ga0495685_001746 3300047447 Bacteria 6702
175 Ga0495685_009156 3300047447 Bacteria 3302
176 Ga0495685_028040 3300047447 Bacteria 1937
177 Ga0495685_034890 3300047447 Bacteria 1728
178 Ga0495685_045590 3300047447 Bacteria 1493
179 Ga0495681_0001708 3300047470 Bacteria 16263
180 Ga0495684_0429762 3300047471 Bacteria 922
181 Ga0495686_0005138 3300047472 Bacteria 10450
182 Ga0495686_0029152 3300047472 Bacteria 3592
183 Ga0495593_0000644 3300047673 Bacteria 20064
184 Ga0495593_0045302 3300047673 Bacteria 2348
185 Ga0495602_0017110 3300048088 Bacteria 7274
186 Ga0495614_0002441 3300048089 Bacteria 8259
187 Ga0495614_0036295 3300048089 Bacteria 2116
188 Ga0495614_0199249 3300048089 Bacteria 905
189 Ga0501033_0007588 3300049570 Bacteria 8436
190 Ga0501034_0019415 3300049571 Bacteria 6952
191 Ga0501036_0073620 3300049572 Bacteria 2888
192 Ga0501037_0169408 3300049573 Bacteria 1553
193 Ga0501038_0004025 3300049574 Bacteria 13662
194 Ga0501047_0011519 3300049581 Bacteria 8371
195 Ga0501047_0050971 3300049581 Bacteria 3998
196 Ga0501048_0403744 3300049582 Bacteria 977
197 Ga0501070_0164881 3300049586 Bacteria 1826
198 Ga0501070_0244405 3300049586 Bacteria 1469
199 Ga0501080_0068814 3300049742 Bacteria 3293
200 Ga0501035_0016262 3300049822 Bacteria 6864
201 Ga0501044_0039428 3300049823 Bacteria 4928
202 Ga0501044_0141397 3300049823 Bacteria 2395
203 nmdc:mga03n38_3316_c1 3300050490 Bacteria 5151
204 nmdc:mga0yw44_75674_c1 3300050492 Bacteria 2099
205 nmdc:mga07m45_21969_c1 3300050496 Bacteria 3480
206 Ga0495612_0036116 3300053078 Bacteria 2005
207 Ga0500578_0029843 3300053086 Bacteria 3503
208 Ga0500640_013371 3300053095 Bacteria 3393
209 Ga0500569_005655 3300053109 Bacteria 2696
210 Ga0500561_0008633 3300053137 Bacteria 2037
211 Ga0500600_0171840 3300053149 Bacteria 1053
212 Ga0500600_0181032 3300053149 Bacteria 1014
213 Ga0500624_012876 3300053157 Bacteria 1243
214 Ga0500656_005459 3300053732 Bacteria 1257
215 Ga0500587_004337 3300053739 Bacteria 1951
216 Ga0466962_0000374 3300061719 Bacteria 19303
217 Ga0466962_0043460 3300061719 Bacteria 2150
218 2515854063 2515154155 Bacteria 7985436
219 2585303287 2582581313 Bacteria 10042643
220 2585315140 2582581314 Bacteria 11452267
221 2616696363 2616644814 Bacteria 11555299
222 2644266765 2643221647 Bacteria 10741251
223 2644440624 2643221678 Bacteria 9540101
224 2644627783 2643221714 Bacteria 9015452
225 2676478018 2675903058 Bacteria 6822861
226 2785339279 2784746763 Bacteria 9783172
227 2785374114 2784746768 Bacteria 10036182
228 2786674361 2786546132 Bacteria 10419719
229 2808845709 2808606359 Bacteria 9866990
230 2808915532 2808606375 Bacteria 9466072
231 2812353900 2811994879 Bacteria 9313447
232 2827629346 2827628540 Bacteria 6858585
233 2852639093 2852635781 Bacteria 8251373
234 2862282716 2862281513 Bacteria 9621493
235 2862389469 2862382967 Bacteria 10317375
236 2862574633 2862574272 Bacteria 10567477
237 2862707776 2862705112 Bacteria 6563286
238 2863410670 2863404153 Bacteria 9672205
239 2867352624 2867346516 Bacteria 7608576
240 2867372918 2867369537 Bacteria 6501581
241 2867436300 2867428634 Bacteria 9590268
242 2877677286 2877676314 Bacteria 9512378
243 2884700847 2884693830 Bacteria 11273186
244 2895439043 2895427314 Bacteria 13147766
245 2895452436 2895442618 Bacteria 11027144
246 2912715598 2912715099 Bacteria 9460473
247 2946079557 2946072368 Bacteria 8999607
248 2947232685 2947224130 Bacteria 9938529
249 2954009294 2954002825 Bacteria 9173742
250 2954382018 2954380949 Bacteria 10050426
251 2954681050 2954673503 Bacteria 9685905
252 2954683107 2954682443 Bacteria 9862841
253 2954692832 2954691527 Bacteria 10720516
254 2954707905 2954701450 Bacteria 10834262
255 2954712469 2954711539 Bacteria 10867210
256 2954722423 2954721474 Bacteria 10456478
257 2954739433 2954731030 Bacteria 10243860
258 2954741302 2954740390 Bacteria 10229294
259 2954758261 2954749733 Bacteria 10366972
260 2954760319 2954759201 Bacteria 9358192
261 2990047113 2990044586 Bacteria 6603797
262 2990064363 2990059506 Bacteria 9321252
263 8008488515 8008485437 Bacteria 7198341
264 8008564709 8008558824 Bacteria 10610750
265 8025527438 8025524527 Bacteria 7197316
266 8048411232 8048406513 Bacteria 8936924
267 8056832359 8056829672 Bacteria 9045328
268 Ga0182005_1032925
269 JGI24738J21930_10019481
270 rootL2_10019369
271 rootL2_10083558
272 Ga0068853_100043780
273 Ga0068854_100414751
274 Ga0081455_10096100
275 Ga0075365_10069808
276 Ga0075363_100009341
277 Ga0075370_10032544
278 Ga0105246_10030134
279 Ga0157369_10614972
280 Ga0182008_10000517
281 Ga0183367_1016
282 Ga0207647_10040834
283 Ga0207646_10662835
284 Ga0207640_10271468
285 Ga0209371_1012979
286 Ga0307517_10004242
287 Ga0307517_10022034
288 Ga0307515_10000475
289 Ga0307515_10130035
290 Ga0307515_10175870
291 Ga0307511_10000376
292 Ga0307511_10033224
293 Ga0307511_10075304
294 Ga0307512_10010100
295 Ga0307512_10013567
296 Ga0307512_10084059
297 Ga0307513_10006848
298 Ga0307509_10009368
299 Ga0307509_10085999
300 Ga0307508_10009013
301 Ga0307508_10128339
302 Ga0307514_10008253
303 Ga0307514_10171258
304 Ga0307516_10001403
305 Ga0307516_10010222
306 Ga0307516_10302800
307 Ga0307518_10094048
308 Ga0307518_10155515
309 Ga0307518_10222975
310 Ga0307507_10013285
311 Ga0307507_10033449
312 Ga0307510_10054704
313 Ga0307510_10139122
314 Ga0395900_0349918
315 Ga0395898_0023248
316 Ga0439436_0028386
317 Ga0439439_0022280
318 Ga0451807_2764247
319 Ga0451845_0959541
320 Ga0451853_0126529
321 Ga0451853_1155382
322 Ga0451853_1748371
323 Ga0439448_0048312
324 Ga0439432_051440
325 Ga0439449_0006297
326 Ga0439457_001397
327 Ga0439457_007820
328 Ga0450894_000400
329 Ga0450903_000097
330 Ga0450906_020658
331 Ga0439458_0001039
332 Ga0439458_0016552
333 Ga0466969_0010991
334 Ga0466969_0024677
335 Ga0466972_0010185
336 Ga0466972_0010535
337 Ga0466972_0013599
338 Ga0466972_0014028
339 Ga0466965_0004280
340 Ga0466965_0037161
341 Ga0466966_0005950
342 Ga0466966_0008906
343 Ga0466961_0000403
344 Ga0466963_0051875
345 Ga0466963_0068864
346 Ga0466964_0000909
347 Ga0466971_0004038
348 Ga0466968_0035515
349 Ga0466970_0000470
350 Ga0466957_0000355
351 Ga0466959_0002377
352 Ga0466959_0028322
353 Ga0466958_0001104
354 Ga0466967_0048838
355 Ga0466967_0238634
356 Ga0495617_018401
357 Ga0495627_021778
358 Ga0495592_0004950
359 Ga0495603_0018538
360 Ga0495629_0014151
361 Ga0495629_0027668
362 Ga0495629_0032348
363 Ga0495651_0008789
364 Ga0495580_0227581
365 Ga0495662_0000967
366 Ga0495664_0002187
367 Ga0495585_0031218
368 Ga0495594_0188011
369 Ga0495596_0035178
370 Ga0495607_0017664
371 Ga0495607_0095611
372 Ga0495606_0007291
373 Ga0495608_0062724
374 Ga0495608_0179940
375 Ga0495610_0053296
376 Ga0495616_0026319
377 Ga0495618_0019205
378 Ga0495620_0009634
379 Ga0495620_0017154
380 Ga0495628_0043305
381 Ga0495628_0067103
382 Ga0495630_0061204
383 Ga0495631_0003995
384 Ga0495643_0005782
385 Ga0495643_0015093
386 Ga0495648_0030065
387 Ga0495652_0017705
388 Ga0495640_0036790
389 Ga0495640_0117898
390 Ga0495587_0001083
391 Ga0495597_0008241
392 Ga0495597_0076781
393 Ga0495645_0017466
394 Ga0495667_0031622
395 Ga0495668_0006551
396 Ga0495668_0015312
397 Ga0495634_0010260
398 Ga0495634_0041783
399 Ga0495611_0065659
400 Ga0495625_0060059
401 Ga0495635_0005227
402 Ga0495635_0118636
403 Ga0495588_0004815
404 Ga0495588_0056892
405 Ga0495657_0002922
406 Ga0495623_0158809
407 Ga0495623_0188966
408 Ga0495646_0000391
409 Ga0495646_0142015
410 Ga0495613_0003910
411 Ga0495613_0024497
412 Ga0495613_0036537
413 Ga0495624_0198565
414 Ga0495671_0004467
415 Ga0495649_0023812
416 Ga0495649_0207153
417 Ga0495589_0001839
418 Ga0495589_0011316
419 Ga0495589_0025234
420 Ga0495589_0047740
421 Ga0495589_0169775
422 Ga0495600_0033582
423 Ga0495600_0121266
424 Ga0495660_0030087
425 Ga0495660_0103670
426 Ga0495604_0006569
427 Ga0495636_0011287
428 Ga0495636_0013129
429 Ga0495636_0155767
430 Ga0495636_0204776
431 Ga0495676_0014761
432 Ga0495676_0065597
433 Ga0495680_0007332
434 Ga0495687_001299
435 Ga0495687_023072
436 Ga0495687_031469
437 Ga0495687_052611
438 Ga0495687_075758
439 Ga0495675_0011703
440 Ga0495675_0052377
441 Ga0495685_001746
442 Ga0495685_009156
443 Ga0495685_028040
444 Ga0495685_034890
445 Ga0495685_045590
446 Ga0495681_0001708
447 Ga0495684_0429762
448 Ga0495686_0005138
449 Ga0495686_0029152
450 Ga0495593_0000644
451 Ga0495593_0045302
452 Ga0495602_0017110
453 Ga0495614_0002441
454 Ga0495614_0036295
455 Ga0495614_0199249
456 Ga0501033_0007588
457 Ga0501034_0019415
458 Ga0501036_0073620
459 Ga0501037_0169408
460 Ga0501038_0004025
461 Ga0501047_0011519
462 Ga0501047_0050971
463 Ga0501048_0403744
464 Ga0501070_0164881
465 Ga0501070_0244405
466 Ga0501080_0068814
467 Ga0501035_0016262
468 Ga0501044_0039428
469 Ga0501044_0141397
470 nmdc:mga03n38_3316_c1
471 nmdc:mga0yw44_75674_c1
472 nmdc:mga07m45_21969_c1
473 Ga0495612_0036116
474 Ga0500578_0029843
475 Ga0500640_013371
476 Ga0500569_005655
477 Ga0500561_0008633
478 Ga0500600_0171840
479 Ga0500600_0181032
480 Ga0500624_012876
481 Ga0500656_005459
482 Ga0500587_004337
483 Ga0466962_0000374
484 Ga0466962_0043460
485 2515854063
486 2585303287
487 2585315140
488 2616696363
489 2644266765
490 2644440624
491 2644627783
492 2676478018
493 2785339279
494 2785374114
495 2786674361
496 2808845709
497 2808915532
498 2812353900
499 2827629346
500 2852639093
501 2862282716
502 2862389469
503 2862574633
504 2862707776
505 2863410670
506 2867352624
507 2867372918
508 2867436300
509 2877677286
510 2884700847
511 2895439043
512 2895452436
513 2912715598
514 2946079557
515 2947232685
516 2954009294
517 2954382018
518 2954681050
519 2954683107
520 2954692832
521 2954707905
522 2954712469
523 2954722423
524 2954739433
525 2954741302
526 2954758261
527 2954760319
528 2990047113
529 2990064363
530 8008488515
531 8008564709
532 8025527438
533 8048411232
534 8056832359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

54

256

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1x-assembly1.cif.gz_A human phytanoyl-coa 2-hydroxylase in complex with iron and 2-oxoglutarate 0.8396 20 234
6ec3-assembly3.cif.gz_C crystal structure of evdmo1 0.807 17 232
6ec3-assembly2.cif.gz_B crystal structure of evdmo1 0.8061 17 232
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7984 17 234
5ep9-assembly2.cif.gz_B crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7948 17 234
ID Description Score Start End Superfamily
2a1xA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8396 20 234 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7984 17 234 2.60.120.620
af_Q54XH6_1_281_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7784 14 232 2.60.120.620
af_P57093_32_338_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7704 9 235 2.60.120.620
af_Q54SF6_10_291_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7576 15 231 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A2E4VH10-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9242 18 246 GO:0005506
GO:0016706
AF-A0A1E4LEE6-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9172 14 257 GO:0005506
GO:0016706
AF-A0A6N8W520-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9156 14 258 GO:0005506
GO:0016706
AF-A0A6B1E1W6-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9124 19 257 GO:0005506
GO:0016706
AF-A0A7W1F497-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9047 6 258 GO:0005506
GO:0016706

Map