F374629

General Info

Members Datasets Scaffolds Average Seq Length
267 177 534 129

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100026262|Ga0070665_1000262626
Length 136
Sequence MTKILTPTAEHDVALGAVDRAQRDGLWMSPADAEKVTGWTLKPEGMCRAEACVPLPAAAVGTNEVDVAAFWKKLGGPVIASEKRDVWALGAPADERNAALEGLEAPDFTLPDVNGVPRSLSQLRGKKVFVATWASW

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
177 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.1
Nodule 0
Rhizoplane 0
Rhizosphere 76.78
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100026262 3300005548 Bacteria 5865
2 Ga0070658_10014161 3300005327 Bacteria 6401
3 Ga0070658_10049114 3300005327 Bacteria 3418
4 Ga0070683_100106195 3300005329 Bacteria 2647
5 Ga0070680_100005638 3300005336 Bacteria 9484
6 Ga0070689_100835742 3300005340 Bacteria 812
7 Ga0070687_100725156 3300005343 Bacteria 697
8 Ga0070687_101423690 3300005343 Bacteria 519
9 Ga0070661_100235349 3300005344 Bacteria 1409
10 Ga0070692_10260111 3300005345 Bacteria 1043
11 Ga0070669_100068378 3300005353 Bacteria 2622
12 Ga0070671_100885172 3300005355 Bacteria 780
13 Ga0070673_100977109 3300005364 Bacteria 788
14 Ga0070659_100289962 3300005366 Bacteria 1363
15 Ga0070709_10180598 3300005434 Bacteria 1481
16 Ga0070714_100700925 3300005435 Bacteria 977
17 Ga0070713_100048329 3300005436 Bacteria 3503
18 Ga0070710_10391077 3300005437 Bacteria 930
19 Ga0070711_101271604 3300005439 Bacteria 638
20 Ga0070700_101932559 3300005441 Bacteria 511
21 Ga0070708_100057151 3300005445 Bacteria 3472
22 Ga0070678_100010429 3300005456 Bacteria 5676
23 Ga0070681_10047004 3300005458 Bacteria 4315
24 Ga0070681_11599868 3300005458 Bacteria 577
25 Ga0070685_10820904 3300005466 Bacteria 687
26 Ga0070706_100139181 3300005467 Bacteria 2265
27 Ga0070707_100229884 3300005468 Bacteria 1805
28 Ga0070707_100422400 3300005468 Bacteria 1293
29 Ga0070698_100005532 3300005471 Bacteria 13804
30 Ga0070699_100095433 3300005518 Bacteria 2604
31 Ga0070679_100362636 3300005530 Bacteria 1396
32 Ga0070679_101760608 3300005530 Bacteria 568
33 Ga0070684_100059566 3300005535 Bacteria 3338
34 Ga0070697_100043684 3300005536 Bacteria 3630
35 Ga0070672_100614256 3300005543 Bacteria 948
36 Ga0070695_100398415 3300005545 Bacteria 1043
37 Ga0070665_100009318 3300005548 Bacteria 9937
38 Ga0070665_100242789 3300005548 Bacteria 1801
39 Ga0070665_101384699 3300005548 Bacteria 713
40 Ga0068855_100164677 3300005563 Bacteria 2514
41 Ga0068855_100612112 3300005563 Bacteria 1173
42 Ga0070664_100014830 3300005564 Bacteria 6362
43 Ga0068857_100493401 3300005577 Bacteria 1148
44 Ga0068856_100187271 3300005614 Bacteria 2084
45 Ga0068856_100333885 3300005614 Bacteria 1534
46 Ga0068852_100333998 3300005616 Bacteria 1475
47 Ga0068859_100168037 3300005617 Bacteria 2273
48 Ga0068864_101980299 3300005618 Bacteria 589
49 Ga0068851_10376627 3300005834 Unclassified 831
50 Ga0068863_100677863 3300005841 Bacteria 1024
51 Ga0068858_100922003 3300005842 Bacteria 855
52 Ga0068860_100164006 3300005843 Bacteria 2144
53 Ga0068860_102853035 3300005843 Bacteria 501
54 Ga0081455_10015329 3300005937 Bacteria 7452
55 Ga0081539_10014147 3300005985 Bacteria 5931
56 Ga0081539_10019018 3300005985 Bacteria 4728
57 Ga0070717_11421136 3300006028 Bacteria 630
58 Ga0075365_10018022 3300006038 Bacteria 4334
59 Ga0075365_10300187 3300006038 Bacteria 1130
60 Ga0075365_10638583 3300006038 Bacteria 752
61 Ga0075365_10641957 3300006038 Bacteria 750
62 Ga0075368_10148175 3300006042 Bacteria 980
63 Ga0075363_100337341 3300006048 Bacteria 879
64 Ga0075363_100372900 3300006048 Bacteria 836
65 Ga0075364_10172655 3300006051 Bacteria 1461
66 Ga0075364_10342544 3300006051 Bacteria 1019
67 Ga0075364_10372678 3300006051 Bacteria 974
68 Ga0075364_11023885 3300006051 Bacteria 561
69 Ga0070715_10454576 3300006163 Bacteria 724
70 Ga0070712_100100005 3300006175 Bacteria 2142
71 Ga0075362_10032492 3300006177 Bacteria 2264
72 Ga0075362_10034482 3300006177 Bacteria 2206
73 Ga0075362_10354584 3300006177 Bacteria 735
74 Ga0075362_10659914 3300006177 Bacteria 544
75 Ga0075367_10001630 3300006178 Bacteria 9757
76 Ga0075367_10032771 3300006178 Bacteria 2991
77 Ga0075367_10635724 3300006178 Bacteria 678
78 Ga0075367_10746689 3300006178 Bacteria 623
79 Ga0075369_10006550 3300006186 Bacteria 4406
80 Ga0075366_10008626 3300006195 Bacteria 5675
81 Ga0075366_10061115 3300006195 Bacteria 2239
82 Ga0075370_10041350 3300006353 Bacteria 2603
83 Ga0075370_10076246 3300006353 Bacteria 1923
84 Ga0075370_10472287 3300006353 Bacteria 756
85 Ga0068865_101045992 3300006881 Bacteria 717
86 Ga0075436_100293539 3300006914 Bacteria 1164
87 Ga0097620_100168027 3300006931 Bacteria 2273
88 Ga0099794_10351424 3300007265 Bacteria 767
89 Ga0105240_10132583 3300009093 Bacteria 2987
90 Ga0105240_11750002 3300009093 Bacteria 648
91 Ga0111539_10980097 3300009094 Bacteria 983
92 Ga0111539_11578385 3300009094 Bacteria 761
93 Ga0105245_10976348 3300009098 Bacteria 891
94 Ga0114129_11166477 3300009147 Bacteria 961
95 Ga0105243_10409220 3300009148 Bacteria 1262
96 Ga0105243_12845771 3300009148 Bacteria 524
97 Ga0105248_11035363 3300009177 Bacteria 927
98 Ga0105238_10152465 3300009551 Bacteria 2286
99 Ga0099796_10023013 3300010159 Bacteria 1940
100 Ga0099796_10459004 3300010159 Bacteria 568
101 Ga0105239_11811669 3300010375 Bacteria 707
102 Ga0105246_10797400 3300011119 Bacteria 838
103 Ga0105246_12235538 3300011119 Bacteria 533
104 Ga0157370_10077604 3300013104 Bacteria 3129
105 Ga0157370_11461552 3300013104 Bacteria 615
106 Ga0157370_11467826 3300013104 Bacteria 613
107 Ga0157369_10156746 3300013105 Bacteria 2405
108 Ga0157369_10197614 3300013105 Bacteria 2111
109 Ga0157374_11077786 3300013296 Bacteria 824
110 Ga0157374_12926596 3300013296 Bacteria 505
111 Ga0157378_11372595 3300013297 Bacteria 749
112 Ga0157375_12990495 3300013308 Bacteria 564
113 Ga0157379_10352754 3300014968 Bacteria 1347
114 Ga0157376_10508999 3300014969 Bacteria 1185
115 Ga0157376_10561160 3300014969 Bacteria 1131
116 Ga0182006_1261865 3300015261 Bacteria 567
117 Ga0163161_10429731 3300017792 Bacteria 1064
118 Ga0213872_10048443 3300021361 Bacteria 1931
119 Ga0207426_1052653 3300025302 Bacteria 1204
120 Ga0207426_1077583 3300025302 Bacteria 909
121 Ga0207682_10593017 3300025893 Bacteria 522
122 Ga0207688_10735105 3300025901 Bacteria 625
123 Ga0207680_10487736 3300025903 Bacteria 877
124 Ga0207647_10188736 3300025904 Bacteria 1195
125 Ga0207699_10907010 3300025906 Bacteria 650
126 Ga0207705_10070077 3300025909 Bacteria 2540
127 Ga0207684_10324628 3300025910 Bacteria 1326
128 Ga0207707_10009959 3300025912 Bacteria 8243
129 Ga0207663_10523968 3300025916 Bacteria 923
130 Ga0207660_10002736 3300025917 Bacteria 11548
131 Ga0207657_10069624 3300025919 Bacteria 2985
132 Ga0207646_10109610 3300025922 Bacteria 2477
133 Ga0207681_10540483 3300025923 Bacteria 958
134 Ga0207694_10527928 3300025924 Bacteria 989
135 Ga0207659_10192205 3300025926 Bacteria 1625
136 Ga0207700_10026369 3300025928 Bacteria 4050
137 Ga0207664_10882600 3300025929 Bacteria 803
138 Ga0207644_10420303 3300025931 Bacteria 1095
139 Ga0207690_10178912 3300025932 Bacteria 1595
140 Ga0207690_10973107 3300025932 Bacteria 705
141 Ga0207670_10244780 3300025936 Bacteria 1383
142 Ga0207670_10562709 3300025936 Bacteria 933
143 Ga0207669_10377573 3300025937 Bacteria 1103
144 Ga0207669_10488068 3300025937 Bacteria 983
145 Ga0207704_10405943 3300025938 Bacteria 1076
146 Ga0207691_10278012 3300025940 Bacteria 1441
147 Ga0207661_11109286 3300025944 Bacteria 728
148 Ga0207667_10010141 3300025949 Bacteria 11033
149 Ga0207667_10284619 3300025949 Bacteria 1689
150 Ga0207667_10614099 3300025949 Bacteria 1095
151 Ga0207667_11050584 3300025949 Bacteria 800
152 Ga0207651_10740977 3300025960 Bacteria 868
153 Ga0207651_10956018 3300025960 Bacteria 764
154 Ga0207668_11228473 3300025972 Bacteria 674
155 Ga0207702_10851689 3300026078 Bacteria 902
156 Ga0207641_11634360 3300026088 Bacteria 646
157 Ga0207641_11902289 3300026088 Bacteria 596
158 Ga0207648_10190300 3300026089 Bacteria 1818
159 Ga0207676_11587833 3300026095 Bacteria 652
160 Ga0207674_10117761 3300026116 Bacteria 2627
161 Ga0207674_10334142 3300026116 Bacteria 1465
162 Ga0207675_100888656 3300026118 Bacteria 907
163 Ga0207683_10038857 3300026121 Bacteria 4150
164 Ga0207683_11196619 3300026121 Bacteria 704
165 Ga0207698_10299553 3300026142 Bacteria 1496
166 Ga0207428_10655938 3300027907 Bacteria 753
167 Ga0268266_10009549 3300028379 Bacteria 8536
168 Ga0268266_10050650 3300028379 Bacteria 3563
169 Ga0268266_10180387 3300028379 Bacteria 1922
170 Ga0268265_10524564 3300028380 Bacteria 1120
171 Ga0268264_10416678 3300028381 Bacteria 1294
172 Ga0268264_11914294 3300028381 Bacteria 603
173 Ga0265334_10021807 3300028573 Bacteria 2614
174 Ga0265332_10189080 3300031238 Bacteria 857
175 Ga0265340_10049828 3300031247 Bacteria 2033
176 Ga0307416_100826143 3300032002 Bacteria 1024
177 Ga0373934_0253616 3300035086 Bacteria 728
178 Ga0373940_0125778 3300035088 Bacteria 799
179 Ga0373941_0034586 3300035115 Bacteria 1526
180 Ga0373942_0077657 3300035207 Bacteria 980
181 Ga0373931_0088479 3300035691 Bacteria 1721
182 Ga0373927_0176834 3300035695 Bacteria 1400
183 Ga0373927_0597008 3300035695 Bacteria 730
184 Ga0373933_0307466 3300035724 Bacteria 1027
185 Ga0373947_0398551 3300035725 Bacteria 928
186 Ga0373937_0161193 3300036401 Bacteria 2103
187 Ga0373937_0523006 3300036401 Bacteria 1127
188 Ga0373925_0501679 3300037068 Bacteria 996
189 Ga0373925_0524572 3300037068 Bacteria 973
190 Ga0373925_0583924 3300037068 Bacteria 920
191 Ga0395899_0009080 3300037312 Bacteria 7638
192 Ga0395899_0147527 3300037312 Bacteria 1669
193 Ga0395899_0201037 3300037312 Bacteria 1389
194 Ga0395899_0519822 3300037312 Bacteria 769
195 Ga0395900_0018660 3300037418 Bacteria 7074
196 Ga0395900_0020488 3300037418 Bacteria 6750
197 Ga0395900_0119829 3300037418 Bacteria 2700
198 Ga0395898_0072615 3300037466 Bacteria 3324
199 Ga0395898_0505393 3300037466 Bacteria 1149
200 Ga0395898_0625713 3300037466 Bacteria 1019
201 Ga0395901_0014589 3300038443 Bacteria 7987
202 Ga0395901_0037182 3300038443 Bacteria 5035
203 Ga0395901_0488089 3300038443 Bacteria 1255
204 Ga0436365_0601571 3300039437 Bacteria 1054
205 Ga0436360_0238429 3300039438 Bacteria 3860
206 Ga0436361_0518214 3300039447 Unclassified 696
207 Ga0436361_1164677 3300039447 Bacteria 4885
208 Ga0451839_0586453 3300041496 Bacteria 722
209 Ga0439448_0082714 3300042005 Bacteria 1079
210 Ga0439458_0119792 3300042157 Bacteria 692
211 Ga0439459_0030669 3300042438 Bacteria 1092
212 Ga0466961_0192257 3300044693 Bacteria 1265
213 Ga0466963_0789930 3300044694 Bacteria 669
214 Ga0466957_0051832 3300044842 Bacteria 2498
215 Ga0495647_0241707 3300046681 Bacteria 802
216 Ga0495613_0970910 3300046689 Bacteria 547
217 Ga0495672_0409092 3300047320 Bacteria 619
218 Ga0496126_0031307 3300048929 Bacteria 5029
219 Ga0501034_0008067 3300049571 Bacteria 11173
220 Ga0501034_0156539 3300049571 Bacteria 2252
221 Ga0501034_0227960 3300049571 Bacteria 1813
222 Ga0501034_0228847 3300049571 Bacteria 1809
223 Ga0501034_1473932 3300049571 Bacteria 555
224 Ga0501036_0137540 3300049572 Bacteria 2062
225 Ga0501047_0369509 3300049581 Bacteria 1269
226 Ga0501070_1175733 3300049586 Bacteria 589
227 Ga0501071_0528847 3300049587 Bacteria 905
228 Ga0501072_1587586 3300049588 Bacteria 504
229 Ga0501074_1009131 3300049590 Bacteria 585
230 Ga0501080_1300354 3300049742 Bacteria 623
231 Ga0501035_0419603 3300049822 Bacteria 1111
232 Ga0501044_0122405 3300049823 Bacteria 2601
233 Ga0501044_0197862 3300049823 Bacteria 1969
234 nmdc:mga03683_137218_c2 3300050489 Bacteria 776
235 nmdc:mga03683_238179_c1 3300050489 Bacteria 843
236 nmdc:mga03683_50111_c1 3300050489 Bacteria 1740
237 nmdc:mga00v17_104547_c1 3300050491 Bacteria 1790
238 nmdc:mga00v17_248584_c1 3300050491 Bacteria 1153
239 nmdc:mga0yw44_193691_c1 3300050492 Bacteria 1341
240 nmdc:mga0yw44_252663_c1 3300050492 Bacteria 1174
241 nmdc:mga0yw44_279811_c1 3300050492 Bacteria 1115
242 nmdc:mga0yw44_382732_c1 3300050492 Bacteria 950
243 nmdc:mga0yw44_675403_c1 3300050492 Bacteria 702
244 nmdc:mga0yw44_739846_c1 3300050492 Bacteria 668
245 nmdc:mga0k408_103546_c1 3300050493 Bacteria 1679
246 nmdc:mga0k408_145311_c1 3300050493 Bacteria 1412
247 nmdc:mga0k408_5160_c1 3300050493 Bacteria 6924
248 nmdc:mga06z11_123127_c1 3300050494 Bacteria 1449
249 nmdc:mga06z11_363946_c1 3300050494 Bacteria 867
250 nmdc:mga06z11_638759_c1 3300050494 Bacteria 648
251 nmdc:mga06z11_847491_c1 3300050494 Bacteria 557
252 nmdc:mga06z11_97284_c1 3300050494 Bacteria 1609
253 nmdc:mga07m45_197665_c2 3300050496 Bacteria 543
254 nmdc:mga07m45_26097_c1 3300050496 Bacteria 3209
255 nmdc:mga07m45_422103_c1 3300050496 Bacteria 774
256 nmdc:mga07m45_470978_c1 3300050496 Bacteria 728
257 nmdc:mga08y16_1010095_c1 3300050511 Bacteria 811
258 nmdc:mga08y16_1606497_c1 3300050511 Bacteria 608
259 nmdc:mga0sz30_254_c1 3300050516 Bacteria 20523
260 Ga0500583_0320480 3300053092 Bacteria 756
261 Ga0500651_0050680 3300053093 Bacteria 2604
262 Ga0500651_0297890 3300053093 Bacteria 926
263 Ga0500658_0018500 3300053134 Bacteria 2613
264 Ga0500568_0003057 3300053139 Bacteria 9555
265 Ga0500577_0235494 3300053142 Bacteria 794
266 Ga0500620_039448 3300053155 Bacteria 1542
267 Ga0500609_014974 3300053731 Bacteria 1050
268 Ga0070665_100026262
269 Ga0070658_10014161
270 Ga0070658_10049114
271 Ga0070683_100106195
272 Ga0070680_100005638
273 Ga0070689_100835742
274 Ga0070687_100725156
275 Ga0070687_101423690
276 Ga0070661_100235349
277 Ga0070692_10260111
278 Ga0070669_100068378
279 Ga0070671_100885172
280 Ga0070673_100977109
281 Ga0070659_100289962
282 Ga0070709_10180598
283 Ga0070714_100700925
284 Ga0070713_100048329
285 Ga0070710_10391077
286 Ga0070711_101271604
287 Ga0070700_101932559
288 Ga0070708_100057151
289 Ga0070678_100010429
290 Ga0070681_10047004
291 Ga0070681_11599868
292 Ga0070685_10820904
293 Ga0070706_100139181
294 Ga0070707_100229884
295 Ga0070707_100422400
296 Ga0070698_100005532
297 Ga0070699_100095433
298 Ga0070679_100362636
299 Ga0070679_101760608
300 Ga0070684_100059566
301 Ga0070697_100043684
302 Ga0070672_100614256
303 Ga0070695_100398415
304 Ga0070665_100009318
305 Ga0070665_100242789
306 Ga0070665_101384699
307 Ga0068855_100164677
308 Ga0068855_100612112
309 Ga0070664_100014830
310 Ga0068857_100493401
311 Ga0068856_100187271
312 Ga0068856_100333885
313 Ga0068852_100333998
314 Ga0068859_100168037
315 Ga0068864_101980299
316 Ga0068851_10376627
317 Ga0068863_100677863
318 Ga0068858_100922003
319 Ga0068860_100164006
320 Ga0068860_102853035
321 Ga0081455_10015329
322 Ga0081539_10014147
323 Ga0081539_10019018
324 Ga0070717_11421136
325 Ga0075365_10018022
326 Ga0075365_10300187
327 Ga0075365_10638583
328 Ga0075365_10641957
329 Ga0075368_10148175
330 Ga0075363_100337341
331 Ga0075363_100372900
332 Ga0075364_10172655
333 Ga0075364_10342544
334 Ga0075364_10372678
335 Ga0075364_11023885
336 Ga0070715_10454576
337 Ga0070712_100100005
338 Ga0075362_10032492
339 Ga0075362_10034482
340 Ga0075362_10354584
341 Ga0075362_10659914
342 Ga0075367_10001630
343 Ga0075367_10032771
344 Ga0075367_10635724
345 Ga0075367_10746689
346 Ga0075369_10006550
347 Ga0075366_10008626
348 Ga0075366_10061115
349 Ga0075370_10041350
350 Ga0075370_10076246
351 Ga0075370_10472287
352 Ga0068865_101045992
353 Ga0075436_100293539
354 Ga0097620_100168027
355 Ga0099794_10351424
356 Ga0105240_10132583
357 Ga0105240_11750002
358 Ga0111539_10980097
359 Ga0111539_11578385
360 Ga0105245_10976348
361 Ga0114129_11166477
362 Ga0105243_10409220
363 Ga0105243_12845771
364 Ga0105248_11035363
365 Ga0105238_10152465
366 Ga0099796_10023013
367 Ga0099796_10459004
368 Ga0105239_11811669
369 Ga0105246_10797400
370 Ga0105246_12235538
371 Ga0157370_10077604
372 Ga0157370_11461552
373 Ga0157370_11467826
374 Ga0157369_10156746
375 Ga0157369_10197614
376 Ga0157374_11077786
377 Ga0157374_12926596
378 Ga0157378_11372595
379 Ga0157375_12990495
380 Ga0157379_10352754
381 Ga0157376_10508999
382 Ga0157376_10561160
383 Ga0182006_1261865
384 Ga0163161_10429731
385 Ga0213872_10048443
386 Ga0207426_1052653
387 Ga0207426_1077583
388 Ga0207682_10593017
389 Ga0207688_10735105
390 Ga0207680_10487736
391 Ga0207647_10188736
392 Ga0207699_10907010
393 Ga0207705_10070077
394 Ga0207684_10324628
395 Ga0207707_10009959
396 Ga0207663_10523968
397 Ga0207660_10002736
398 Ga0207657_10069624
399 Ga0207646_10109610
400 Ga0207681_10540483
401 Ga0207694_10527928
402 Ga0207659_10192205
403 Ga0207700_10026369
404 Ga0207664_10882600
405 Ga0207644_10420303
406 Ga0207690_10178912
407 Ga0207690_10973107
408 Ga0207670_10244780
409 Ga0207670_10562709
410 Ga0207669_10377573
411 Ga0207669_10488068
412 Ga0207704_10405943
413 Ga0207691_10278012
414 Ga0207661_11109286
415 Ga0207667_10010141
416 Ga0207667_10284619
417 Ga0207667_10614099
418 Ga0207667_11050584
419 Ga0207651_10740977
420 Ga0207651_10956018
421 Ga0207668_11228473
422 Ga0207702_10851689
423 Ga0207641_11634360
424 Ga0207641_11902289
425 Ga0207648_10190300
426 Ga0207676_11587833
427 Ga0207674_10117761
428 Ga0207674_10334142
429 Ga0207675_100888656
430 Ga0207683_10038857
431 Ga0207683_11196619
432 Ga0207698_10299553
433 Ga0207428_10655938
434 Ga0268266_10009549
435 Ga0268266_10050650
436 Ga0268266_10180387
437 Ga0268265_10524564
438 Ga0268264_10416678
439 Ga0268264_11914294
440 Ga0265334_10021807
441 Ga0265332_10189080
442 Ga0265340_10049828
443 Ga0307416_100826143
444 Ga0373934_0253616
445 Ga0373940_0125778
446 Ga0373941_0034586
447 Ga0373942_0077657
448 Ga0373931_0088479
449 Ga0373927_0176834
450 Ga0373927_0597008
451 Ga0373933_0307466
452 Ga0373947_0398551
453 Ga0373937_0161193
454 Ga0373937_0523006
455 Ga0373925_0501679
456 Ga0373925_0524572
457 Ga0373925_0583924
458 Ga0395899_0009080
459 Ga0395899_0147527
460 Ga0395899_0201037
461 Ga0395899_0519822
462 Ga0395900_0018660
463 Ga0395900_0020488
464 Ga0395900_0119829
465 Ga0395898_0072615
466 Ga0395898_0505393
467 Ga0395898_0625713
468 Ga0395901_0014589
469 Ga0395901_0037182
470 Ga0395901_0488089
471 Ga0436365_0601571
472 Ga0436360_0238429
473 Ga0436361_0518214
474 Ga0436361_1164677
475 Ga0451839_0586453
476 Ga0439448_0082714
477 Ga0439458_0119792
478 Ga0439459_0030669
479 Ga0466961_0192257
480 Ga0466963_0789930
481 Ga0466957_0051832
482 Ga0495647_0241707
483 Ga0495613_0970910
484 Ga0495672_0409092
485 Ga0496126_0031307
486 Ga0501034_0008067
487 Ga0501034_0156539
488 Ga0501034_0227960
489 Ga0501034_0228847
490 Ga0501034_1473932
491 Ga0501036_0137540
492 Ga0501047_0369509
493 Ga0501070_1175733
494 Ga0501071_0528847
495 Ga0501072_1587586
496 Ga0501074_1009131
497 Ga0501080_1300354
498 Ga0501035_0419603
499 Ga0501044_0122405
500 Ga0501044_0197862
501 nmdc:mga03683_137218_c2
502 nmdc:mga03683_238179_c1
503 nmdc:mga03683_50111_c1
504 nmdc:mga00v17_104547_c1
505 nmdc:mga00v17_248584_c1
506 nmdc:mga0yw44_193691_c1
507 nmdc:mga0yw44_252663_c1
508 nmdc:mga0yw44_279811_c1
509 nmdc:mga0yw44_382732_c1
510 nmdc:mga0yw44_675403_c1
511 nmdc:mga0yw44_739846_c1
512 nmdc:mga0k408_103546_c1
513 nmdc:mga0k408_145311_c1
514 nmdc:mga0k408_5160_c1
515 nmdc:mga06z11_123127_c1
516 nmdc:mga06z11_363946_c1
517 nmdc:mga06z11_638759_c1
518 nmdc:mga06z11_847491_c1
519 nmdc:mga06z11_97284_c1
520 nmdc:mga07m45_197665_c2
521 nmdc:mga07m45_26097_c1
522 nmdc:mga07m45_422103_c1
523 nmdc:mga07m45_470978_c1
524 nmdc:mga08y16_1010095_c1
525 nmdc:mga08y16_1606497_c1
526 nmdc:mga0sz30_254_c1
527 Ga0500583_0320480
528 Ga0500651_0050680
529 Ga0500651_0297890
530 Ga0500658_0018500
531 Ga0500568_0003057
532 Ga0500577_0235494
533 Ga0500620_039448
534 Ga0500609_014974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cnk-assembly1.cif.gz_A l-aminoacetone oxidase from streptococcus oligofermentans belongs to a new 3-domain family of bacterial flavoproteins 0.5657 59 94
4v5z-assembly1.cif.gz_Bu structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.4798 69 97
3ocf-assembly1.cif.gz_C crystal structure of fumarate lyase:delta crystallin from brucella melitensis in native form 0.4164 3 35
6nkl-assembly1.cif.gz_C 2.2 a resolution structure of vapbc-1 from nontypeable haemophilus influenzae 0.4001 69 104
2jrt-assembly1.cif.gz_A nmr solution structure of the protein coded by gene rhos4_12090 of rhodobacter sphaeroides. northeast structural genomics target rhr5 0.3878 93 123
ID Description Score Start End Superfamily
af_Q10MT2_91_175_1.10.150.190 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Translation initiation factor 2; subunit 1; domain 2 0.5094 87 112 1.10.150.190
af_P22255_1_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.5044 88 112 3.30.540.10
af_A4I3S3_442_510_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.5037 60 96 3.30.70.870
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.5014 86 112 1.10.3300.10
af_Q10675_167_363_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.4948 60 96 3.90.480.10
ID Description Score Start End GO Terms
AF-A0A3A8SER8-F1-model_v4 DUF4902 domain-containing protein 0.8399 3 71
AF-A0A521H810-F1-model_v4 Uncharacterized protein 0.7956 95 127
AF-A0A3N5K5S4-F1-model_v4 TlpA family protein disulfide reductase 0.7796 19 63
AF-A0A1H3P0P6-F1-model_v4 AhpC/TSA family protein 0.7466 95 128
AF-R4Z051-F1-model_v4 Redoxin domain-containing protein 0.7378 2 129

Map