F374617

General Info

Members Datasets Scaffolds Average Seq Length
267 191 261 119

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100296827|Ga0070684_1002968272
Length 131
Sequence VAVVTVPPDVLVHLCGTEQWATARRGGGIAPADGADFVHLSRPEQVHLPANRLYRGRNDLVLLHVDPARLGAPVHWESGVTTDPESMLFPHLYGPLPVSAIIRVTAYPPAADGSFPPIAPVVAQDPPGPST

Samples

Sample ID Description Type Environment
1 2643221692 Nocardia sp. Root136 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
6 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
102 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
103 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
189 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 13.48
Rhizosphere 62.17
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1046216 3300002070 Bacteria 671
2 Ga0055540_1000029 3300003792 Bacteria 179894
3 Ga0070683_100326002 3300005329 Bacteria 1462
4 Ga0068869_101491573 3300005334 Bacteria 600
5 Ga0070666_10018497 3300005335 Bacteria 4482
6 Ga0070680_100955060 3300005336 Bacteria 740
7 Ga0070682_100010155 3300005337 Bacteria 5338
8 Ga0070682_100042224 3300005337 Bacteria 2813
9 Ga0070682_101144063 3300005337 Bacteria 654
10 Ga0068868_100484824 3300005338 Bacteria 1081
11 Ga0070660_100893212 3300005339 Bacteria 749
12 Ga0070691_10444878 3300005341 Bacteria 739
13 Ga0070675_100778392 3300005354 Bacteria 874
14 Ga0070674_100300379 3300005356 Bacteria 1280
15 Ga0070667_100759709 3300005367 Bacteria 899
16 Ga0070703_10359972 3300005406 Bacteria 623
17 Ga0070710_11319265 3300005437 Bacteria 537
18 Ga0070701_10703774 3300005438 Bacteria 680
19 Ga0070700_100251740 3300005441 Bacteria 1267
20 Ga0070685_10959677 3300005466 Bacteria 639
21 Ga0070684_100296827 3300005535 Bacteria 1482
22 Ga0070684_100870470 3300005535 Bacteria 844
23 Ga0068853_100405126 3300005539 Bacteria 1277
24 Ga0070696_101575269 3300005546 Bacteria 564
25 Ga0070693_101193411 3300005547 Bacteria 584
26 Ga0070665_100451176 3300005548 Bacteria 1295
27 Ga0070665_101260509 3300005548 Bacteria 749
28 Ga0068855_100937563 3300005563 Bacteria 913
29 Ga0068857_100872294 3300005577 Bacteria 862
30 Ga0068854_100038611 3300005578 Bacteria 3359
31 Ga0068854_100602522 3300005578 Bacteria 938
32 Ga0068854_101849550 3300005578 Bacteria 554
33 Ga0070702_100280421 3300005615 Bacteria 1144
34 Ga0068852_100221192 3300005616 Bacteria 1801
35 Ga0068852_100958111 3300005616 Bacteria 874
36 Ga0068859_100659949 3300005617 Bacteria 1138
37 Ga0068870_10498932 3300005840 Bacteria 811
38 Ga0075365_10061634 3300006038 Bacteria 2506
39 Ga0075363_100010356 3300006048 Bacteria 4424
40 Ga0075364_10011725 3300006051 Bacteria 5334
41 Ga0075364_10152254 3300006051 Bacteria 1559
42 Ga0075432_10312826 3300006058 Unclassified 655
43 Ga0070716_100162577 3300006173 Bacteria 1448
44 Ga0075370_10067181 3300006353 Bacteria 2046
45 Ga0075370_10104216 3300006353 Bacteria 1644
46 Ga0075428_100670424 3300006844 Bacteria 1105
47 Ga0075428_100783841 3300006844 Bacteria 1013
48 Ga0075430_100212365 3300006846 Bacteria 1605
49 Ga0075431_100363426 3300006847 Bacteria 1453
50 Ga0075436_100527983 3300006914 Bacteria 865
51 Ga0097620_100659934 3300006931 Bacteria 1138
52 Ga0111539_10679326 3300009094 Bacteria 1199
53 Ga0105245_10382084 3300009098 Bacteria 1403
54 Ga0114129_10761935 3300009147 Bacteria 1238
55 Ga0105243_10294212 3300009148 Bacteria 1468
56 Ga0105243_10645800 3300009148 Bacteria 1025
57 Ga0105241_11764625 3300009174 Bacteria 603
58 Ga0105242_10390965 3300009176 Bacteria 1295
59 Ga0105242_11813605 3300009176 Bacteria 649
60 Ga0105248_11094791 3300009177 Bacteria 900
61 Ga0105237_10107831 3300009545 Bacteria 2777
62 Ga0105238_10223245 3300009551 Bacteria 1860
63 Ga0105249_10410727 3300009553 Bacteria 1386
64 Ga0105239_10131778 3300010375 Bacteria 2781
65 Ga0105239_10161877 3300010375 Bacteria 2500
66 Ga0105246_10076455 3300011119 Bacteria 2372
67 Ga0105246_10238153 3300011119 Bacteria 1437
68 Ga0157373_10928975 3300013100 Unclassified 646
69 Ga0157370_10050611 3300013104 Bacteria 3971
70 Ga0157369_10007026 3300013105 Bacteria 12981
71 Ga0157374_10818347 3300013296 Bacteria 948
72 Ga0157378_10517037 3300013297 Bacteria 1195
73 Ga0157372_11054906 3300013307 Bacteria 941
74 Ga0163163_10836272 3300014325 Bacteria 984
75 Ga0213874_10061026 3300021377 Bacteria 1181
76 Ga0213876_10000331 3300021384 Bacteria 41254
77 Ga0213875_10030457 3300021388 Bacteria 2554
78 Ga0209051_1000042 3300025303 Bacteria 308486
79 Ga0209051_1000905 3300025303 Bacteria 29540
80 Ga0207688_10084076 3300025901 Bacteria 1821
81 Ga0207688_10152510 3300025901 Bacteria 1365
82 Ga0207688_10365913 3300025901 Bacteria 890
83 Ga0207671_10015867 3300025914 Bacteria 5876
84 Ga0207663_11024582 3300025916 Bacteria 662
85 Ga0207657_10741635 3300025919 Bacteria 761
86 Ga0207650_11262311 3300025925 Bacteria 629
87 Ga0207687_10312739 3300025927 Bacteria 1269
88 Ga0207700_10591461 3300025928 Bacteria 987
89 Ga0207664_10056454 3300025929 Bacteria 3119
90 Ga0207690_10252279 3300025932 Bacteria 1363
91 Ga0207686_10516284 3300025934 Bacteria 929
92 Ga0207661_10243129 3300025944 Bacteria 1598
93 Ga0207667_10191068 3300025949 Bacteria 2101
94 Ga0207640_10103569 3300025981 Bacteria 2001
95 Ga0207640_10246464 3300025981 Bacteria 1384
96 Ga0207677_10228563 3300026023 Bacteria 1497
97 Ga0207677_10795321 3300026023 Bacteria 846
98 Ga0207678_10037488 3300026067 Bacteria 4216
99 Ga0207675_100808241 3300026118 Bacteria 951
100 Ga0207683_10585280 3300026121 Bacteria 1032
101 Ga0207698_12067260 3300026142 Bacteria 583
102 Ga0207698_12672904 3300026142 Bacteria 508
103 Ga0207428_10793145 3300027907 Unclassified 673
104 Ga0268266_10197704 3300028379 Bacteria 1839
105 Ga0265338_10182664 3300028800 Unclassified 1597
106 Ga0265324_10124935 3300029957 Archaea 873
107 Ga0265327_10121323 3300031251 Bacteria 1238
108 Ga0307407_11051679 3300031903 Bacteria 631
109 Ga0373931_0280517 3300035691 Bacteria 1023
110 Ga0395900_0165065 3300037418 Bacteria 2257
111 Ga0436364_0982160 3300037853 Bacteria 4657
112 Ga0436365_0217626 3300039437 Bacteria 2085
113 Ga0436365_0863130 3300039437 Bacteria 48169
114 Ga0436363_0815124 3300039450 Bacteria 3753
115 Ga0439461_0000559 3300041410 Bacteria 5407
116 Ga0439466_0008883 3300041411 Bacteria 3778
117 Ga0451800_0716418 3300041459 Bacteria 1353
118 Ga0451855_1741089 3300041511 Bacteria 836
119 Ga0439431_0001087 3300041997 Bacteria 5887
120 Ga0439445_0003089 3300042004 Bacteria 3730
121 Ga0439434_0002048 3300042435 Bacteria 5830
122 Ga0466972_0085773 3300044658 Bacteria 1496
123 Ga0466972_0226957 3300044658 Bacteria 874
124 Ga0466972_0231553 3300044658 Bacteria 864
125 Ga0466965_0008936 3300044683 Bacteria 4646
126 Ga0466966_0056542 3300044684 Bacteria 2482
127 Ga0466966_0437698 3300044684 Bacteria 786
128 Ga0466961_0041397 3300044693 Bacteria 2953
129 Ga0466963_0029384 3300044694 Bacteria 3538
130 Ga0466963_0107497 3300044694 Bacteria 1913
131 Ga0466971_0014189 3300044719 Bacteria 3503
132 Ga0466968_0003967 3300044735 Bacteria 5494
133 Ga0466970_0029351 3300044765 Bacteria 2895
134 Ga0466970_0072485 3300044765 Bacteria 1853
135 Ga0466957_0002255 3300044842 Bacteria 10331
136 Ga0466957_0033935 3300044842 Bacteria 3062
137 Ga0466960_0006221 3300044901 Bacteria 4780
138 Ga0466959_0008196 3300045049 Bacteria 7374
139 Ga0466959_0027641 3300045049 Bacteria 4206
140 Ga0466959_0135903 3300045049 Bacteria 1740
141 Ga0466958_0015291 3300045836 Bacteria 4395
142 Ga0466967_0008389 3300045976 Bacteria 7563
143 Ga0466967_0116059 3300045976 Bacteria 2466
144 Ga0466967_0455604 3300045976 Bacteria 1251
145 Ga0466967_1184723 3300045976 Bacteria 761
146 Ga0495645_0369448 3300046543 Unclassified 920
147 Ga0495656_0064945 3300046615 Bacteria 1604
148 Ga0495599_0345682 3300046678 Unclassified 892
149 Ga0495671_0183261 3300046692 Bacteria 1017
150 Ga0495581_0024842 3300047315 Bacteria 3472
151 Ga0495672_0003273 3300047320 Bacteria 14020
152 Ga0495683_0472616 3300047323 Bacteria 512
153 Ga0495673_0000721 3300047469 Bacteria 31896
154 Ga0496100_0000025 3300048903 Bacteria 115919
155 Ga0496100_0000721 3300048903 Bacteria 15819
156 Ga0496101_0000068 3300048904 Bacteria 120985
157 Ga0496101_0000078 3300048904 Bacteria 108113
158 Ga0496102_0000056 3300048905 Bacteria 172707
159 Ga0496102_0005518 3300048905 Bacteria 10740
160 Ga0496102_0083892 3300048905 Bacteria 2940
161 Ga0496102_0188648 3300048905 Bacteria 1943
162 Ga0496103_0000040 3300048906 Bacteria 172148
163 Ga0496103_0000809 3300048906 Bacteria 22964
164 Ga0496103_0440561 3300048906 Bacteria 836
165 Ga0496104_0269506 3300048907 Bacteria 1615
166 Ga0496104_0658558 3300048907 Bacteria 956
167 Ga0496104_1108363 3300048907 Bacteria 695
168 Ga0496105_0159974 3300048908 Bacteria 1849
169 Ga0496105_0566735 3300048908 Bacteria 885
170 Ga0496106_0015016 3300048909 Bacteria 5732
171 Ga0496106_0029408 3300048909 Bacteria 4094
172 Ga0496107_0027450 3300048910 Bacteria 4042
173 Ga0496107_0434368 3300048910 Bacteria 976
174 Ga0496108_0025995 3300048911 Bacteria 4828
175 Ga0496108_0093369 3300048911 Bacteria 2560
176 Ga0496108_1160462 3300048911 Bacteria 654
177 Ga0496109_0000175 3300048912 Bacteria 63767
178 Ga0496109_0013404 3300048912 Bacteria 7110
179 Ga0496110_0007992 3300048913 Bacteria 8476
180 Ga0496111_0055129 3300048914 Bacteria 2875
181 Ga0496112_0053680 3300048915 Bacteria 3959
182 Ga0496112_0173413 3300048915 Bacteria 2122
183 Ga0496112_0191538 3300048915 Bacteria 2007
184 Ga0496112_0270592 3300048915 Bacteria 1647
185 Ga0496114_0001037 3300048917 Bacteria 20905
186 Ga0496114_0290027 3300048917 Bacteria 1444
187 Ga0496114_1332061 3300048917 Bacteria 605
188 Ga0496115_0029874 3300048918 Bacteria 4284
189 Ga0496116_0000056 3300048919 Bacteria 282554
190 Ga0496116_0014239 3300048919 Bacteria 6362
191 Ga0496117_0000003 3300048920 Bacteria 1881097
192 Ga0496117_0012890 3300048920 Bacteria 7329
193 Ga0496117_0186479 3300048920 Bacteria 1186
194 Ga0496118_0000001 3300048921 Bacteria 1881100
195 Ga0496118_0001040 3300048921 Bacteria 43213
196 Ga0496118_0007434 3300048921 Bacteria 11612
197 Ga0496119_0000263 3300048922 Bacteria 74497
198 Ga0496119_0004090 3300048922 Bacteria 14706
199 Ga0496120_0000318 3300048923 Bacteria 79637
200 Ga0496120_0010818 3300048923 Bacteria 6322
201 Ga0496120_0060875 3300048923 Bacteria 2110
202 Ga0496121_0000023 3300048924 Bacteria 463448
203 Ga0496121_0000121 3300048924 Bacteria 172480
204 Ga0496122_0000038 3300048925 Bacteria 295624
205 Ga0496123_0014185 3300048926 Bacteria 6623
206 Ga0496123_0015738 3300048926 Bacteria 6186
207 Ga0496124_0000014 3300048927 Bacteria 463448
208 Ga0496125_0000020 3300048928 Bacteria 463448
209 Ga0496125_0240213 3300048928 Bacteria 1151
210 Ga0496126_0000023 3300048929 Bacteria 463448
211 Ga0496126_0000837 3300048929 Bacteria 54604
212 Ga0496126_0047214 3300048929 Bacteria 3943
213 Ga0501033_0097690 3300049570 Bacteria 2145
214 Ga0501033_0599581 3300049570 Bacteria 755
215 Ga0501034_0005133 3300049571 Bacteria 14366
216 Ga0501036_0053656 3300049572 Bacteria 3414
217 Ga0501037_0000204 3300049573 Bacteria 53465
218 Ga0501038_0002909 3300049574 Bacteria 15962
219 Ga0501039_0040072 3300049575 Bacteria 3616
220 Ga0501043_0001111 3300049579 Bacteria 23667
221 Ga0501046_0374083 3300049580 Bacteria 1032
222 Ga0501047_0119027 3300049581 Bacteria 2523
223 Ga0501047_0364322 3300049581 Bacteria 1281
224 Ga0501067_0215510 3300049583 Bacteria 1069
225 Ga0501069_0585107 3300049585 Bacteria 669
226 Ga0501070_0000679 3300049586 Bacteria 31214
227 Ga0501070_0032550 3300049586 Bacteria 4364
228 Ga0501070_0046600 3300049586 Bacteria 3605
229 Ga0501071_0160104 3300049587 Bacteria 1682
230 Ga0501073_0335066 3300049589 Bacteria 1044
231 Ga0501074_0341080 3300049590 Bacteria 1064
232 Ga0501079_0474346 3300049741 Bacteria 983
233 Ga0501080_0441130 3300049742 Bacteria 1168
234 Ga0501035_0850282 3300049822 Bacteria 726
235 Ga0501044_0704693 3300049823 Bacteria 895
236 Ga0501044_1089191 3300049823 Bacteria 668
237 nmdc:mga03n38_184_c2 3300050490 Bacteria 5215
238 nmdc:mga00v17_32588_c1 3300050491 Bacteria 3081
239 nmdc:mga00v17_6285_c1 3300050491 Bacteria 6297
240 nmdc:mga0yw44_1113708_c1 3300050492 Bacteria 533
241 nmdc:mga0yw44_725332_c1 3300050492 Bacteria 675
242 nmdc:mga07m45_22876_c2 3300050496 Bacteria 2987
243 nmdc:mga07m45_293074_c2 3300050496 Bacteria 623
244 nmdc:mga07m45_78524_c1 3300050496 Bacteria 1883
245 nmdc:mga05p37_451915_c1 3300050507 Bacteria 1487
246 nmdc:mga0qj67_486631_c1 3300050509 Bacteria 992
247 nmdc:mga06r32_445276_c1 3300050510 Bacteria 1275
248 nmdc:mga08y16_492583_c1 3300050511 Bacteria 1246
249 nmdc:mga08y16_549888_c1 3300050511 Bacteria 1168
250 nmdc:mga0n895_1027654_c1 3300050512 Bacteria 804
251 nmdc:mga0sz30_136189_c1 3300050516 Bacteria 705
252 nmdc:mga0sz30_205830_c1 3300050516 Bacteria 874
253 Ga0495601_0437507 3300053077 Unclassified 846
254 Ga0500635_0025814 3300053080 Bacteria 1854
255 Ga0500578_0499915 3300053086 Bacteria 684
256 Ga0500643_014299 3300053087 Bacteria 2765
257 Ga0500650_0168165 3300053098 Bacteria 1009
258 Ga0500621_179372 3300053126 Bacteria 769
259 Ga0500628_010055 3300053129 Bacteria 1684
260 Ga0500652_000368 3300053131 Bacteria 16224
261 Ga0500620_014851 3300053155 Bacteria 2187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0345682 Ga0495599_0345682_173_490 95
2 3300053077 Ga0495601_0437507 Ga0495601_0437507_137_454 95
3 3300006844 Ga0075428_100783841 Ga0075428_1007838412 104
4 3300050509 nmdc:mga0qj67_486631_c1 nmdc:mga0qj67_486631_c1_587_910 104
5 3300005337 Ga0070682_101144063 Ga0070682_1011440631 105
6 3300005338 Ga0068868_100484824 Ga0068868_1004848242 105
7 3300005356 Ga0070674_100300379 Ga0070674_1003003792 105
8 3300005367 Ga0070667_100759709 Ga0070667_1007597092 105
9 3300005535 Ga0070684_100870470 Ga0070684_1008704702 105
10 3300005548 Ga0070665_101260509 Ga0070665_1012605091 105
11 3300005578 Ga0068854_100602522 Ga0068854_1006025221 105
12 3300005615 Ga0070702_100280421 Ga0070702_1002804212 105
13 3300009098 Ga0105245_10382084 Ga0105245_103820842 105
14 3300009148 Ga0105243_10645800 Ga0105243_106458001 105
15 3300013296 Ga0157374_10818347 Ga0157374_108183472 105
16 3300025901 Ga0207688_10365913 Ga0207688_103659132 105
17 3300026023 Ga0207677_10795321 Ga0207677_107953212 105
18 3300026121 Ga0207683_10585280 Ga0207683_105852802 105
19 3300028379 Ga0268266_10197704 Ga0268266_101977044 105
20 3300050511 nmdc:mga08y16_492583_c1 nmdc:mga08y16_492583_c1_81_410 105
21 3300005334 Ga0068869_101491573 Ga0068869_1014915731 107
22 3300005337 Ga0070682_100042224 Ga0070682_1000422243 107
23 3300005577 Ga0068857_100872294 Ga0068857_1008722941 107
24 3300005617 Ga0068859_100659949 Ga0068859_1006599492 107
25 3300006931 Ga0097620_100659934 Ga0097620_1006599343 107
26 3300026023 Ga0207677_10228563 Ga0207677_102285631 107
27 3300005466 Ga0070685_10959677 Ga0070685_109596771 108
28 3300005548 Ga0070665_100451176 Ga0070665_1004511764 108
29 3300005578 Ga0068854_101849550 Ga0068854_1018495501 108
30 3300009553 Ga0105249_10410727 Ga0105249_104107273 108
31 3300026118 Ga0207675_100808241 Ga0207675_1008082412 108
32 3300041511 Ga0451855_1741089 Ga0451855_1741089_148_495 108
33 3300006058 Ga0075432_10312826 Ga0075432_103128261 109
34 3300009094 Ga0111539_10679326 Ga0111539_106793262 109
35 3300027907 Ga0207428_10793145 Ga0207428_107931452 109
36 3300035691 Ga0373931_0280517 Ga0373931_0280517_601_942 109
37 3300037418 Ga0395900_0165065 Ga0395900_0165065_1888_2238 109
38 3300047323 Ga0495683_0472616 Ga0495683_0472616_12_365 109
39 3300050511 nmdc:mga08y16_549888_c1 nmdc:mga08y16_549888_c1_280_621 109
40 3300050516 nmdc:mga0sz30_205830_c1 nmdc:mga0sz30_205830_c1_405_734 109
41 3300005329 Ga0070683_100326002 Ga0070683_1003260023 111
42 3300005336 Ga0070680_100955060 Ga0070680_1009550601 111
43 3300005337 Ga0070682_100010155 Ga0070682_1000101552 111
44 3300005339 Ga0070660_100893212 Ga0070660_1008932122 111
45 3300005341 Ga0070691_10444878 Ga0070691_104448781 111
46 3300005354 Ga0070675_100778392 Ga0070675_1007783921 111
47 3300005438 Ga0070701_10703774 Ga0070701_107037742 111
48 3300005441 Ga0070700_100251740 Ga0070700_1002517402 111
49 3300005539 Ga0068853_100405126 Ga0068853_1004051262 111
50 3300005546 Ga0070696_101575269 Ga0070696_1015752691 111
51 3300005547 Ga0070693_101193411 Ga0070693_1011934111 111
52 3300005563 Ga0068855_100937563 Ga0068855_1009375632 111
53 3300005578 Ga0068854_100038611 Ga0068854_1000386113 111
54 3300005616 Ga0068852_100221192 Ga0068852_1002211922 111
55 3300005616 Ga0068852_100958111 Ga0068852_1009581112 111
56 3300005840 Ga0068870_10498932 Ga0068870_104989322 111
57 3300006048 Ga0075363_100010356 Ga0075363_1000103563 111
58 3300006353 Ga0075370_10104216 Ga0075370_101042162 111
59 3300013100 Ga0157373_10928975 Ga0157373_109289751 111
60 3300013104 Ga0157370_10050611 Ga0157370_100506116 111
61 3300013105 Ga0157369_10007026 Ga0157369_100070263 111
62 3300025901 Ga0207688_10152510 Ga0207688_101525103 111
63 3300025919 Ga0207657_10741635 Ga0207657_107416351 111
64 3300025927 Ga0207687_10312739 Ga0207687_103127393 111
65 3300025932 Ga0207690_10252279 Ga0207690_102522792 111
66 3300025934 Ga0207686_10516284 Ga0207686_105162842 111
67 3300025944 Ga0207661_10243129 Ga0207661_102431292 111
68 3300025949 Ga0207667_10191068 Ga0207667_101910683 111
69 3300025981 Ga0207640_10103569 Ga0207640_101035692 111
70 3300026067 Ga0207678_10037488 Ga0207678_100374883 111
71 3300026142 Ga0207698_12067260 Ga0207698_120672602 111
72 3300026142 Ga0207698_12672904 Ga0207698_126729041 111
73 3300028800 Ga0265338_10182664 Ga0265338_101826642 111
74 3300029957 Ga0265324_10124935 Ga0265324_101249352 111
75 3300045976 Ga0466967_0455604 Ga0466967_0455604_267_602 111
76 3300046543 Ga0495645_0369448 Ga0495645_0369448_494_847 111
77 3300048915 Ga0496112_0173413 Ga0496112_0173413_1291_1638 111
78 3300049570 Ga0501033_0097690 Ga0501033_0097690_1206_1577 111
79 3300049822 Ga0501035_0850282 Ga0501035_0850282_150_521 111
80 3300053086 Ga0500578_0499915 Ga0500578_0499915_235_594 111
81 iso_pu_bacteria 2974315732 2974317431 111
82 iso_pu_bacteria 2984523437 2984525641 111
83 3300006914 Ga0075436_100527983 Ga0075436_1005279833 112
84 3300013297 Ga0157378_10517037 Ga0157378_105170371 112
85 3300048915 Ga0496112_0191538 Ga0496112_0191538_1370_1708 112
86 3300050512 nmdc:mga0n895_1027654_c1 nmdc:mga0n895_1027654_c1_64_402 112
87 3300009176 Ga0105242_10390965 Ga0105242_103909651 113
88 3300009177 Ga0105248_11094791 Ga0105248_110947912 113
89 3300009551 Ga0105238_10223245 Ga0105238_102232453 113
90 3300010375 Ga0105239_10131778 Ga0105239_101317783 113
91 3300011119 Ga0105246_10076455 Ga0105246_100764552 113
92 3300013307 Ga0157372_11054906 Ga0157372_110549062 113
93 3300014325 Ga0163163_10836272 Ga0163163_108362721 113
94 3300021377 Ga0213874_10061026 Ga0213874_100610263 113
95 3300039450 Ga0436363_0815124 Ga0436363_0815124_796_1143 113
96 3300041459 Ga0451800_0716418 Ga0451800_0716418_835_1179 113
97 3300048910 Ga0496107_0434368 Ga0496107_0434368_498_842 113
98 3300048911 Ga0496108_0025995 Ga0496108_0025995_1814_2158 113
99 3300048912 Ga0496109_0013404 Ga0496109_0013404_1105_1449 113
100 3300048915 Ga0496112_0053680 Ga0496112_0053680_2733_3077 113
101 3300050490 nmdc:mga03n38_184_c2 nmdc:mga03n38_184_c2_3356_3700 113
102 3300050496 nmdc:mga07m45_293074_c2 nmdc:mga07m45_293074_c2_223_567 113
103 3300050496 nmdc:mga07m45_78524_c1 nmdc:mga07m45_78524_c1_276_620 113
104 3300053129 Ga0500628_010055 Ga0500628_010055_687_1031 113
105 iso_pu_bacteria 2738541264 2738666745 113
106 iso_pu_bacteria 2738541356 2739145589 113
107 iso_pu_bacteria 2902792274 2902796447 113
108 3300025901 Ga0207688_10084076 Ga0207688_100840764 114
109 3300025925 Ga0207650_11262311 Ga0207650_112623112 114
110 3300021384 Ga0213876_10000331 Ga0213876_1000033141 115
111 3300021388 Ga0213875_10030457 Ga0213875_100304574 115
112 3300037853 Ga0436364_0982160 Ga0436364_0982160_3568_3933 115
113 3300039437 Ga0436365_0217626 Ga0436365_0217626_89_457 115
114 3300039437 Ga0436365_0863130 Ga0436365_0863130_31565_31930 115
115 3300044842 Ga0466957_0033935 Ga0466957_0033935_1500_1862 115
116 iso_pu_bacteria 2643221692 2644512760 115
117 3300045976 Ga0466967_1184723 Ga0466967_1184723_46_399 116
118 3300003792 Ga0055540_1000029 Ga0055540_10000292 117
119 3300005335 Ga0070666_10018497 Ga0070666_100184976 117
120 3300005535 Ga0070684_100296827 Ga0070684_1002968272 117
121 3300006353 Ga0075370_10067181 Ga0075370_100671813 117
122 3300006844 Ga0075428_100670424 Ga0075428_1006704242 117
123 3300006846 Ga0075430_100212365 Ga0075430_1002123652 117
124 3300006847 Ga0075431_100363426 Ga0075431_1003634262 117
125 3300009147 Ga0114129_10761935 Ga0114129_107619352 117
126 3300009545 Ga0105237_10107831 Ga0105237_101078312 117
127 3300010375 Ga0105239_10161877 Ga0105239_101618773 117
128 3300011119 Ga0105246_10238153 Ga0105246_102381532 117
129 3300025303 Ga0209051_1000042 Ga0209051_1000042148 117
130 3300025914 Ga0207671_10015867 Ga0207671_100158673 117
131 3300031251 Ga0265327_10121323 Ga0265327_101213232 117
132 3300041410 Ga0439461_0000559 Ga0439461_0000559_4445_4849 117
133 3300041411 Ga0439466_0008883 Ga0439466_0008883_3134_3538 117
134 3300041997 Ga0439431_0001087 Ga0439431_0001087_1817_2221 117
135 3300042004 Ga0439445_0003089 Ga0439445_0003089_2282_2686 117
136 3300042435 Ga0439434_0002048 Ga0439434_0002048_1195_1599 117
137 3300044658 Ga0466972_0226957 Ga0466972_0226957_17_400 117
138 3300044719 Ga0466971_0014189 Ga0466971_0014189_1332_1685 117
139 3300045976 Ga0466967_0116059 Ga0466967_0116059_578_961 117
140 3300046615 Ga0495656_0064945 Ga0495656_0064945_532_885 117
141 3300046692 Ga0495671_0183261 Ga0495671_0183261_384_761 117
142 3300047320 Ga0495672_0003273 Ga0495672_0003273_11971_12348 117
143 3300047469 Ga0495673_0000721 Ga0495673_0000721_19421_19798 117
144 3300048903 Ga0496100_0000025 Ga0496100_0000025_60089_60472 117
145 3300048903 Ga0496100_0000721 Ga0496100_0000721_1385_1762 117
146 3300048904 Ga0496101_0000068 Ga0496101_0000068_12545_12928 117
147 3300048904 Ga0496101_0000078 Ga0496101_0000078_88102_88479 117
148 3300048905 Ga0496102_0000056 Ga0496102_0000056_87065_87442 117
149 3300048905 Ga0496102_0005518 Ga0496102_0005518_4863_5246 117
150 3300048906 Ga0496103_0000040 Ga0496103_0000040_85249_85626 117
151 3300048906 Ga0496103_0000809 Ga0496103_0000809_17384_17767 117
152 3300048907 Ga0496104_0269506 Ga0496104_0269506_230_583 117
153 3300048907 Ga0496104_0658558 Ga0496104_0658558_351_728 117
154 3300048908 Ga0496105_0159974 Ga0496105_0159974_1233_1616 117
155 3300048909 Ga0496106_0015016 Ga0496106_0015016_3123_3500 117
156 3300048909 Ga0496106_0029408 Ga0496106_0029408_1938_2321 117
157 3300048910 Ga0496107_0027450 Ga0496107_0027450_97_474 117
158 3300048911 Ga0496108_0093369 Ga0496108_0093369_846_1229 117
159 3300048912 Ga0496109_0000175 Ga0496109_0000175_15995_16378 117
160 3300048913 Ga0496110_0007992 Ga0496110_0007992_3139_3522 117
161 3300048914 Ga0496111_0055129 Ga0496111_0055129_2472_2855 117
162 3300048915 Ga0496112_0270592 Ga0496112_0270592_447_809 117
163 3300048917 Ga0496114_0001037 Ga0496114_0001037_1479_1862 117
164 3300048917 Ga0496114_0290027 Ga0496114_0290027_710_1087 117
165 3300048918 Ga0496115_0029874 Ga0496115_0029874_374_757 117
166 3300048919 Ga0496116_0000056 Ga0496116_0000056_85266_85643 117
167 3300048919 Ga0496116_0014239 Ga0496116_0014239_4955_5338 117
168 3300048920 Ga0496117_0000003 Ga0496117_0000003_1795455_1795832 117
169 3300048920 Ga0496117_0012890 Ga0496117_0012890_4137_4520 117
170 3300048921 Ga0496118_0000001 Ga0496118_0000001_1795458_1795835 117
171 3300048921 Ga0496118_0007434 Ga0496118_0007434_4265_4648 117
172 3300048922 Ga0496119_0000263 Ga0496119_0000263_66974_67351 117
173 3300048922 Ga0496119_0004090 Ga0496119_0004090_11934_12317 117
174 3300048923 Ga0496120_0000318 Ga0496120_0000318_12415_12792 117
175 3300048923 Ga0496120_0010818 Ga0496120_0010818_3843_4226 117
176 3300048923 Ga0496120_0060875 Ga0496120_0060875_70_432 117
177 3300048924 Ga0496121_0000023 Ga0496121_0000023_55158_55541 117
178 3300048924 Ga0496121_0000121 Ga0496121_0000121_85232_85609 117
179 3300048925 Ga0496122_0000038 Ga0496122_0000038_55158_55541 117
180 3300048926 Ga0496123_0014185 Ga0496123_0014185_5351_5734 117
181 3300048926 Ga0496123_0015738 Ga0496123_0015738_2080_2442 117
182 3300048927 Ga0496124_0000014 Ga0496124_0000014_55158_55541 117
183 3300048928 Ga0496125_0000020 Ga0496125_0000020_407908_408291 117
184 3300048928 Ga0496125_0240213 Ga0496125_0240213_126_488 117
185 3300048929 Ga0496126_0000023 Ga0496126_0000023_55158_55541 117
186 3300048929 Ga0496126_0000837 Ga0496126_0000837_27338_27715 117
187 3300048929 Ga0496126_0047214 Ga0496126_0047214_2927_3289 117
188 3300049570 Ga0501033_0599581 Ga0501033_0599581_374_736 117
189 3300049571 Ga0501034_0005133 Ga0501034_0005133_5672_6034 117
190 3300049572 Ga0501036_0053656 Ga0501036_0053656_905_1267 117
191 3300049573 Ga0501037_0000204 Ga0501037_0000204_15705_16067 117
192 3300049574 Ga0501038_0002909 Ga0501038_0002909_4063_4425 117
193 3300049575 Ga0501039_0040072 Ga0501039_0040072_118_480 117
194 3300049579 Ga0501043_0001111 Ga0501043_0001111_10570_10932 117
195 3300049580 Ga0501046_0374083 Ga0501046_0374083_591_968 117
196 3300049581 Ga0501047_0364322 Ga0501047_0364322_11_373 117
197 3300049583 Ga0501067_0215510 Ga0501067_0215510_232_594 117
198 3300049586 Ga0501070_0000679 Ga0501070_0000679_28947_29309 117
199 3300049587 Ga0501071_0160104 Ga0501071_0160104_1160_1522 117
200 3300049589 Ga0501073_0335066 Ga0501073_0335066_232_594 117
201 3300049741 Ga0501079_0474346 Ga0501079_0474346_391_753 117
202 3300049823 Ga0501044_1089191 Ga0501044_1089191_233_595 117
203 3300050492 nmdc:mga0yw44_725332_c1 nmdc:mga0yw44_725332_c1_83_451 117
204 3300050496 nmdc:mga07m45_22876_c2 nmdc:mga07m45_22876_c2_1926_2279 117
205 3300050507 nmdc:mga05p37_451915_c1 nmdc:mga05p37_451915_c1_948_1301 117
206 3300050510 nmdc:mga06r32_445276_c1 nmdc:mga06r32_445276_c1_670_1023 117
207 3300050516 nmdc:mga0sz30_136189_c1 nmdc:mga0sz30_136189_c1_97_465 117
208 3300053087 Ga0500643_014299 Ga0500643_014299_1847_2224 117
209 3300053098 Ga0500650_0168165 Ga0500650_0168165_259_636 117
210 3300053126 Ga0500621_179372 Ga0500621_179372_112_474 117
211 3300053155 Ga0500620_014851 Ga0500620_014851_1086_1448 117
212 3300006173 Ga0070716_100162577 Ga0070716_1001625772 118
213 3300009148 Ga0105243_10294212 Ga0105243_102942123 118
214 3300009174 Ga0105241_11764625 Ga0105241_117646251 118
215 3300009176 Ga0105242_11813605 Ga0105242_118136052 118
216 3300044694 Ga0466963_0107497 Ga0466963_0107497_12_401 118
217 3300047315 Ga0495581_0024842 Ga0495581_0024842_2251_2625 118
218 3300048905 Ga0496102_0188648 Ga0496102_0188648_270_626 118
219 3300048906 Ga0496103_0440561 Ga0496103_0440561_408_764 118
220 3300048907 Ga0496104_1108363 Ga0496104_1108363_83_439 118
221 3300048908 Ga0496105_0566735 Ga0496105_0566735_172_528 118
222 3300048911 Ga0496108_1160462 Ga0496108_1160462_147_503 118
223 3300048917 Ga0496114_1332061 Ga0496114_1332061_75_431 118
224 3300049581 Ga0501047_0119027 Ga0501047_0119027_1566_1922 118
225 3300049586 Ga0501070_0032550 Ga0501070_0032550_752_1108 118
226 3300049823 Ga0501044_0704693 Ga0501044_0704693_375_731 118
227 3300002070 JGI24750J21931_1046216 JGI24750J21931_10462162 119
228 3300005406 Ga0070703_10359972 Ga0070703_103599721 119
229 3300005437 Ga0070710_11319265 Ga0070710_113192651 119
230 3300006038 Ga0075365_10061634 Ga0075365_100616343 119
231 3300006051 Ga0075364_10011725 Ga0075364_100117253 119
232 3300006051 Ga0075364_10152254 Ga0075364_101522543 119
233 3300025303 Ga0209051_1000905 Ga0209051_100090524 119
234 3300025916 Ga0207663_11024582 Ga0207663_110245822 119
235 3300025928 Ga0207700_10591461 Ga0207700_105914612 119
236 3300025929 Ga0207664_10056454 Ga0207664_100564541 119
237 3300025981 Ga0207640_10246464 Ga0207640_102464642 119
238 3300031903 Ga0307407_11051679 Ga0307407_110516791 119
239 3300044658 Ga0466972_0085773 Ga0466972_0085773_69_440 119
240 3300044658 Ga0466972_0231553 Ga0466972_0231553_156_515 119
241 3300044683 Ga0466965_0008936 Ga0466965_0008936_2604_2975 119
242 3300044684 Ga0466966_0056542 Ga0466966_0056542_753_1214 119
243 3300044684 Ga0466966_0437698 Ga0466966_0437698_99_458 119
244 3300044693 Ga0466961_0041397 Ga0466961_0041397_1002_1367 119
245 3300044694 Ga0466963_0029384 Ga0466963_0029384_1506_1871 119
246 3300044735 Ga0466968_0003967 Ga0466968_0003967_4970_5341 119
247 3300044765 Ga0466970_0029351 Ga0466970_0029351_1374_1739 119
248 3300044765 Ga0466970_0072485 Ga0466970_0072485_911_1270 119
249 3300044842 Ga0466957_0002255 Ga0466957_0002255_7224_7589 119
250 3300044901 Ga0466960_0006221 Ga0466960_0006221_4246_4617 119
251 3300045049 Ga0466959_0008196 Ga0466959_0008196_4645_5010 119
252 3300045049 Ga0466959_0027641 Ga0466959_0027641_2402_2773 119
253 3300045049 Ga0466959_0135903 Ga0466959_0135903_318_677 119
254 3300045836 Ga0466958_0015291 Ga0466958_0015291_2193_2558 119
255 3300045976 Ga0466967_0008389 Ga0466967_0008389_3514_3885 119
256 3300048905 Ga0496102_0083892 Ga0496102_0083892_1033_1413 119
257 3300048920 Ga0496117_0186479 Ga0496117_0186479_383_763 119
258 3300048921 Ga0496118_0001040 Ga0496118_0001040_20383_20763 119
259 3300049585 Ga0501069_0585107 Ga0501069_0585107_88_447 119
260 3300049586 Ga0501070_0046600 Ga0501070_0046600_2378_2737 119
261 3300049590 Ga0501074_0341080 Ga0501074_0341080_506_865 119
262 3300049742 Ga0501080_0441130 Ga0501080_0441130_44_403 119
263 3300050491 nmdc:mga00v17_32588_c1 nmdc:mga00v17_32588_c1_2110_2490 119
264 3300050491 nmdc:mga00v17_6285_c1 nmdc:mga00v17_6285_c1_511_870 119
265 3300050492 nmdc:mga0yw44_1113708_c1 nmdc:mga0yw44_1113708_c1_106_486 119
266 3300053080 Ga0500635_0025814 Ga0500635_0025814_304_678 119
267 3300053131 Ga0500652_000368 Ga0500652_000368_14206_14580 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06108

DUF952

Protein of unknown function (DUF952)

14

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.8909 7 115
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.887 7 115
2jqn-assembly1.cif.gz_A solution nmr structure of cc0527 from caulobacter crescentus. northeast structural genomics target ccr55 0.8411 5 113
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.8252 7 115
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.8219 7 115
ID Description Score Start End Superfamily
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.9604 7 118 3.20.170.20
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.9438 7 118 3.20.170.20
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8897 7 115 3.20.170.20
af_Q0DQS8_1_107_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8779 13 112 3.20.170.20
2jqnA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.8411 5 113 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A842GU30-F1-model_v4 deleted 1.004 6 117
AF-A0A1A2LXH0-F1-model_v4 deleted 1.001 1 119
AF-A0A0J6WMI6-F1-model_v4 Glutathione S-transferase domain protein 0.9895 3 118
AF-A0A2S8ND34-F1-model_v4 deleted 0.9893 16 100
AF-A0A2S8KAK6-F1-model_v4 deleted 0.9881 8 118

Feature Viewer

pLDDT pTM Quality
93.56 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map