F374563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 216 | 242 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100162981|Ga0070671_1001629813 |
| Length | 296 |
| Sequence | VSSVLAAEQEQASKPLPFQAICDSPKTLQSIGAMTAAPSILVFDSGLGGLTVFREVVKARPDAYFVYVADDAFFPYGRQDEAKLVVRVLDVMAGLIAAHRPDLVVIACNTASTIVLPALREKFAGPFVGTVPAIKPACASSASKLVTVFGTEATIKREYTRALIRDYAQGCAVTLVGSPRLAELAEAELKGELVSDDDVAAELVPCFVAIDGKRTDTIVLACTHYPLLLKRFEKVAPWPVNFIDPAPAIARRVLDLLGAPTPVASAAPVRFIFTSGMAPSAALQAALGRFGAALAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 4 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 5 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 6 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 7 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 8 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 9 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 10 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 11 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 12 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 13 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 14 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 15 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 16 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 17 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 18 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 19 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 20 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 21 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 22 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 100 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 102 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 103 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 105 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 111 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 113 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 121 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 173 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 174 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 200 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 202 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 209 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 215 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 216 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.64 |
| Metatranscriptomes | 0 |
| Isolates | 9.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.87 |
| Nodule | 8.61 |
| Rhizoplane | 5.99 |
| Rhizosphere | 74.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10015875 | 3300002244 | Bacteria | 1268 |
| 2 | JGI25153J46596_10002574 | 3300003215 | Bacteria | 10393 |
| 3 | Ga0070676_10111861 | 3300005328 | Bacteria | 1701 |
| 4 | Ga0070676_10112596 | 3300005328 | Bacteria | 1696 |
| 5 | Ga0070683_100213135 | 3300005329 | Bacteria | 1835 |
| 6 | Ga0070690_100114068 | 3300005330 | Bacteria | 1807 |
| 7 | Ga0070666_10094037 | 3300005335 | Bacteria | 2061 |
| 8 | Ga0070680_100132564 | 3300005336 | Bacteria | 2085 |
| 9 | Ga0070682_100163989 | 3300005337 | Bacteria | 1538 |
| 10 | Ga0070660_100199482 | 3300005339 | Bacteria | 1623 |
| 11 | Ga0070689_100175590 | 3300005340 | Bacteria | 1737 |
| 12 | Ga0070687_100037033 | 3300005343 | Bacteria | 2436 |
| 13 | Ga0070669_100099800 | 3300005353 | Bacteria | 2188 |
| 14 | Ga0070675_100176972 | 3300005354 | Bacteria | 1843 |
| 15 | Ga0070675_100266472 | 3300005354 | Bacteria | 1502 |
| 16 | Ga0070671_100035476 | 3300005355 | Bacteria | 4132 |
| 17 | Ga0070671_100162981 | 3300005355 | Bacteria | 1885 |
| 18 | Ga0070674_100023667 | 3300005356 | Bacteria | 3979 |
| 19 | Ga0070673_100002712 | 3300005364 | Bacteria | 10854 |
| 20 | Ga0070673_100179313 | 3300005364 | Bacteria | 1813 |
| 21 | Ga0070688_100353218 | 3300005365 | Bacteria | 1077 |
| 22 | Ga0070713_100132503 | 3300005436 | Bacteria | 2199 |
| 23 | Ga0070713_100263847 | 3300005436 | Bacteria | 1575 |
| 24 | Ga0070711_100357744 | 3300005439 | Bacteria | 1175 |
| 25 | Ga0070678_100467122 | 3300005456 | Bacteria | 1108 |
| 26 | Ga0070681_10390514 | 3300005458 | Bacteria | 1302 |
| 27 | Ga0070706_100247673 | 3300005467 | Bacteria | 1664 |
| 28 | Ga0070707_100359730 | 3300005468 | Bacteria | 1414 |
| 29 | Ga0070679_100021073 | 3300005530 | Bacteria | 6360 |
| 30 | Ga0070697_100341186 | 3300005536 | Bacteria | 1293 |
| 31 | Ga0068853_100136803 | 3300005539 | Bacteria | 2197 |
| 32 | Ga0070686_100174804 | 3300005544 | Bacteria | 1521 |
| 33 | Ga0070693_100050828 | 3300005547 | Bacteria | 2371 |
| 34 | Ga0070664_100280844 | 3300005564 | Bacteria | 1501 |
| 35 | Ga0068852_100434044 | 3300005616 | Bacteria | 1298 |
| 36 | Ga0068859_100275915 | 3300005617 | Bacteria | 1773 |
| 37 | Ga0068859_100301401 | 3300005617 | Bacteria | 1696 |
| 38 | Ga0068864_100034810 | 3300005618 | Bacteria | 4285 |
| 39 | Ga0068864_100129780 | 3300005618 | Bacteria | 2263 |
| 40 | Ga0068866_10198568 | 3300005718 | Bacteria | 1197 |
| 41 | Ga0068870_10173121 | 3300005840 | Bacteria | 1290 |
| 42 | Ga0075365_10026310 | 3300006038 | Bacteria | 3692 |
| 43 | Ga0075363_100129725 | 3300006048 | Bacteria | 1413 |
| 44 | Ga0075364_10192367 | 3300006051 | Bacteria | 1382 |
| 45 | Ga0070716_100047795 | 3300006173 | Bacteria | 2415 |
| 46 | Ga0070712_100020310 | 3300006175 | Bacteria | 4346 |
| 47 | Ga0075362_10137929 | 3300006177 | Bacteria | 1164 |
| 48 | Ga0075367_10031401 | 3300006178 | Bacteria | 3050 |
| 49 | Ga0075367_10039511 | 3300006178 | Bacteria | 2751 |
| 50 | Ga0075367_10051766 | 3300006178 | Bacteria | 2428 |
| 51 | Ga0075369_10011801 | 3300006186 | Bacteria | 3441 |
| 52 | Ga0075370_10023085 | 3300006353 | Bacteria | 3423 |
| 53 | Ga0075430_100044019 | 3300006846 | Bacteria | 3775 |
| 54 | Ga0075431_100181584 | 3300006847 | Bacteria | 2159 |
| 55 | Ga0097620_100275914 | 3300006931 | Bacteria | 1773 |
| 56 | Ga0097620_100301376 | 3300006931 | Bacteria | 1696 |
| 57 | Ga0105240_10027333 | 3300009093 | Bacteria | 7470 |
| 58 | Ga0114129_10054638 | 3300009147 | Bacteria | 5599 |
| 59 | Ga0105243_10152120 | 3300009148 | Bacteria | 1986 |
| 60 | Ga0105248_10031820 | 3300009177 | Bacteria | 5895 |
| 61 | Ga0163162_10162917 | 3300013306 | Bacteria | 2353 |
| 62 | Ga0157375_10524894 | 3300013308 | Bacteria | 1347 |
| 63 | Ga0157375_10617201 | 3300013308 | Bacteria | 1243 |
| 64 | Ga0209758_1000158 | 3300025297 | Bacteria | 156129 |
| 65 | Ga0207642_10188977 | 3300025899 | Bacteria | 1128 |
| 66 | Ga0207699_10181113 | 3300025906 | Bacteria | 1416 |
| 67 | Ga0207699_10378479 | 3300025906 | Bacteria | 1004 |
| 68 | Ga0207645_10155093 | 3300025907 | Bacteria | 1496 |
| 69 | Ga0207684_10170842 | 3300025910 | Bacteria | 1874 |
| 70 | Ga0207695_10267668 | 3300025913 | Bacteria | 1605 |
| 71 | Ga0207693_10013691 | 3300025915 | Bacteria | 6534 |
| 72 | Ga0207663_10238566 | 3300025916 | Bacteria | 1332 |
| 73 | Ga0207660_10077884 | 3300025917 | Bacteria | 2428 |
| 74 | Ga0207652_10109763 | 3300025921 | Bacteria | 2446 |
| 75 | Ga0207646_10302312 | 3300025922 | Bacteria | 1445 |
| 76 | Ga0207681_10104272 | 3300025923 | Bacteria | 2051 |
| 77 | Ga0207650_10003487 | 3300025925 | Bacteria | 10807 |
| 78 | Ga0207700_10522783 | 3300025928 | Bacteria | 1051 |
| 79 | Ga0207644_10036581 | 3300025931 | Bacteria | 3447 |
| 80 | Ga0207644_10261294 | 3300025931 | Bacteria | 1384 |
| 81 | Ga0207709_10087185 | 3300025935 | Bacteria | 2029 |
| 82 | Ga0207670_10050980 | 3300025936 | Bacteria | 2777 |
| 83 | Ga0207711_10077384 | 3300025941 | Bacteria | 2899 |
| 84 | Ga0207651_10061702 | 3300025960 | Bacteria | 2609 |
| 85 | Ga0207651_10683804 | 3300025960 | Bacteria | 903 |
| 86 | Ga0207658_10329457 | 3300025986 | Bacteria | 1324 |
| 87 | Ga0207676_10037916 | 3300026095 | Bacteria | 3677 |
| 88 | Ga0209813_10008926 | 3300027866 | Bacteria | 2547 |
| 89 | Ga0265325_10001191 | 3300031241 | Bacteria | 18540 |
| 90 | Ga0265340_10039317 | 3300031247 | Bacteria | 2335 |
| 91 | Ga0373929_0033021 | 3300035085 | Bacteria | 1116 |
| 92 | Ga0373940_0017830 | 3300035088 | Bacteria | 1774 |
| 93 | Ga0373952_0003651 | 3300035092 | Bacteria | 2776 |
| 94 | Ga0373936_0000563 | 3300035113 | Bacteria | 12720 |
| 95 | Ga0373953_0004303 | 3300035117 | Bacteria | 4527 |
| 96 | Ga0373953_0027265 | 3300035117 | Bacteria | 2195 |
| 97 | Ga0373954_0012163 | 3300035118 | Bacteria | 3826 |
| 98 | Ga0373956_0048727 | 3300035119 | Bacteria | 1898 |
| 99 | Ga0373960_0054583 | 3300035121 | Bacteria | 1195 |
| 100 | Ga0373946_0012652 | 3300035171 | Bacteria | 3162 |
| 101 | Ga0373955_0000595 | 3300035172 | Bacteria | 15398 |
| 102 | Ga0373961_0020673 | 3300035241 | Bacteria | 1743 |
| 103 | Ga0373924_0010093 | 3300035410 | Bacteria | 3476 |
| 104 | Ga0373924_0103951 | 3300035410 | Bacteria | 1224 |
| 105 | Ga0373931_0001311 | 3300035691 | Bacteria | 10650 |
| 106 | Ga0373931_0030765 | 3300035691 | Bacteria | 2766 |
| 107 | Ga0373931_0117114 | 3300035691 | Bacteria | 1519 |
| 108 | Ga0373935_0000012 | 3300035692 | Bacteria | 81961 |
| 109 | Ga0373927_0015412 | 3300035695 | Bacteria | 5052 |
| 110 | Ga0373927_0024382 | 3300035695 | Bacteria | 3957 |
| 111 | Ga0373933_0037383 | 3300035724 | Bacteria | 2847 |
| 112 | Ga0373947_0001331 | 3300035725 | Bacteria | 15201 |
| 113 | Ga0373947_0023685 | 3300035725 | Bacteria | 3574 |
| 114 | Ga0373947_0086897 | 3300035725 | Bacteria | 1944 |
| 115 | Ga0373937_0000054 | 3300036401 | Bacteria | 102542 |
| 116 | Ga0373937_0316856 | 3300036401 | Bacteria | 1475 |
| 117 | Ga0373937_0594462 | 3300036401 | Bacteria | 1051 |
| 118 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 119 | Ga0373925_0036801 | 3300037068 | Bacteria | 3612 |
| 120 | Ga0373925_0073836 | 3300037068 | Bacteria | 2582 |
| 121 | Ga0436364_1543354 | 3300037853 | Bacteria | 959 |
| 122 | Ga0436365_0494590 | 3300039437 | Bacteria | 3520 |
| 123 | Ga0436365_1793210 | 3300039437 | Bacteria | 936 |
| 124 | Ga0439453_0003411 | 3300041408 | Bacteria | 2286 |
| 125 | Ga0466963_0356194 | 3300044694 | Bacteria | 1031 |
| 126 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 127 | Ga0495603_0014448 | 3300046455 | Bacteria | 4775 |
| 128 | Ga0495629_0017573 | 3300046459 | Bacteria | 5126 |
| 129 | Ga0495629_0348914 | 3300046459 | Bacteria | 1010 |
| 130 | Ga0495629_0362038 | 3300046459 | Bacteria | 988 |
| 131 | Ga0495651_0011346 | 3300046462 | Bacteria | 6847 |
| 132 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 133 | Ga0495653_0118556 | 3300046463 | Bacteria | 1890 |
| 134 | Ga0495580_0208159 | 3300046472 | Bacteria | 1346 |
| 135 | Ga0495580_0274521 | 3300046472 | Bacteria | 1151 |
| 136 | Ga0495662_0003607 | 3300046476 | Bacteria | 7810 |
| 137 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 138 | Ga0495664_0093059 | 3300046477 | Bacteria | 1814 |
| 139 | Ga0495594_0104355 | 3300046499 | Bacteria | 1596 |
| 140 | Ga0495594_0154426 | 3300046499 | Bacteria | 1303 |
| 141 | Ga0495608_0000050 | 3300046511 | Bacteria | 96603 |
| 142 | Ga0495618_0000045 | 3300046514 | Bacteria | 94654 |
| 143 | Ga0495618_0173584 | 3300046514 | Bacteria | 1371 |
| 144 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 145 | Ga0495630_0147769 | 3300046517 | Bacteria | 1788 |
| 146 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 147 | Ga0495652_0193422 | 3300046529 | Bacteria | 1550 |
| 148 | Ga0495665_0016372 | 3300046531 | Bacteria | 3996 |
| 149 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 150 | Ga0495640_0291602 | 3300046533 | Bacteria | 1015 |
| 151 | Ga0495587_0000536 | 3300046536 | Bacteria | 26278 |
| 152 | Ga0495587_0062748 | 3300046536 | Bacteria | 2175 |
| 153 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 154 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 155 | Ga0495667_0062407 | 3300046559 | Bacteria | 2442 |
| 156 | Ga0495634_0000751 | 3300046642 | Bacteria | 31392 |
| 157 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 158 | Ga0495657_0000136 | 3300046675 | Bacteria | 65707 |
| 159 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 160 | Ga0495599_0020631 | 3300046678 | Bacteria | 4105 |
| 161 | Ga0495623_0000052 | 3300046679 | Bacteria | 71268 |
| 162 | Ga0495646_0000036 | 3300046680 | Bacteria | 81182 |
| 163 | Ga0495647_0049951 | 3300046681 | Bacteria | 1622 |
| 164 | Ga0495658_0154050 | 3300046683 | Bacteria | 1413 |
| 165 | Ga0495613_0064796 | 3300046689 | Bacteria | 2672 |
| 166 | Ga0495613_0197358 | 3300046689 | Bacteria | 1420 |
| 167 | Ga0495624_0101732 | 3300046690 | Bacteria | 1769 |
| 168 | Ga0495600_0000037 | 3300046809 | Bacteria | 78434 |
| 169 | Ga0495581_0002053 | 3300047315 | Bacteria | 11333 |
| 170 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 171 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 172 | Ga0495680_0003271 | 3300047322 | Bacteria | 16067 |
| 173 | Ga0495675_0000049 | 3300047444 | Bacteria | 80913 |
| 174 | Ga0495684_0000046 | 3300047471 | Bacteria | 92658 |
| 175 | Ga0495593_0003282 | 3300047673 | Bacteria | 9699 |
| 176 | Ga0495602_0000102 | 3300048088 | Bacteria | 81094 |
| 177 | Ga0495602_0120772 | 3300048088 | Bacteria | 2108 |
| 178 | Ga0495602_0310821 | 3300048088 | Bacteria | 1150 |
| 179 | Ga0495614_0151027 | 3300048089 | Bacteria | 1036 |
| 180 | Ga0496101_0147316 | 3300048904 | Bacteria | 1798 |
| 181 | Ga0496101_0242497 | 3300048904 | Bacteria | 1403 |
| 182 | Ga0496102_0039594 | 3300048905 | Bacteria | 4260 |
| 183 | Ga0496104_0019267 | 3300048907 | Bacteria | 6240 |
| 184 | Ga0496104_0392161 | 3300048907 | Bacteria | 1301 |
| 185 | Ga0496107_0174566 | 3300048910 | Bacteria | 1595 |
| 186 | Ga0496108_0220635 | 3300048911 | Bacteria | 1647 |
| 187 | Ga0496109_0177449 | 3300048912 | Bacteria | 2000 |
| 188 | Ga0496110_0041729 | 3300048913 | Bacteria | 4004 |
| 189 | Ga0496110_0326936 | 3300048913 | Bacteria | 1397 |
| 190 | Ga0496112_0028852 | 3300048915 | Bacteria | 5361 |
| 191 | Ga0496113_0374886 | 3300048916 | Bacteria | 1142 |
| 192 | Ga0496113_0545528 | 3300048916 | Bacteria | 930 |
| 193 | Ga0496114_0250705 | 3300048917 | Bacteria | 1558 |
| 194 | Ga0496114_0312272 | 3300048917 | Bacteria | 1388 |
| 195 | Ga0496114_0383665 | 3300048917 | Bacteria | 1244 |
| 196 | Ga0496121_0001006 | 3300048924 | Bacteria | 50348 |
| 197 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 198 | Ga0496126_0273182 | 3300048929 | Bacteria | 1402 |
| 199 | Ga0501031_0066240 | 3300049568 | Bacteria | 2353 |
| 200 | Ga0501032_0029317 | 3300049569 | Bacteria | 3776 |
| 201 | Ga0501033_0068053 | 3300049570 | Bacteria | 2618 |
| 202 | Ga0501034_0071044 | 3300049571 | Bacteria | 3491 |
| 203 | Ga0501034_0074074 | 3300049571 | Bacteria | 3414 |
| 204 | Ga0501037_0001340 | 3300049573 | Bacteria | 18079 |
| 205 | Ga0501038_0001023 | 3300049574 | Bacteria | 25193 |
| 206 | Ga0501039_0015388 | 3300049575 | Bacteria | 5856 |
| 207 | Ga0501043_0025349 | 3300049579 | Bacteria | 4652 |
| 208 | Ga0501046_0008699 | 3300049580 | Bacteria | 8822 |
| 209 | Ga0501047_0175597 | 3300049581 | Bacteria | 2009 |
| 210 | Ga0501048_0002666 | 3300049582 | Bacteria | 13620 |
| 211 | Ga0501067_0009926 | 3300049583 | Bacteria | 5272 |
| 212 | Ga0501068_0040935 | 3300049584 | Bacteria | 2783 |
| 213 | Ga0501069_0005453 | 3300049585 | Bacteria | 6615 |
| 214 | Ga0501070_0025730 | 3300049586 | Bacteria | 4936 |
| 215 | Ga0501070_0530862 | 3300049586 | Bacteria | 943 |
| 216 | Ga0501073_0017253 | 3300049589 | Bacteria | 5229 |
| 217 | Ga0501074_0028651 | 3300049590 | Bacteria | 4036 |
| 218 | Ga0501076_0077266 | 3300049592 | Bacteria | 2671 |
| 219 | Ga0501079_0211050 | 3300049741 | Bacteria | 1516 |
| 220 | Ga0501080_0167453 | 3300049742 | Bacteria | 2027 |
| 221 | Ga0501081_0541950 | 3300049743 | Bacteria | 869 |
| 222 | Ga0501035_0037796 | 3300049822 | Bacteria | 4369 |
| 223 | Ga0501044_0000260 | 3300049823 | Bacteria | 67087 |
| 224 | Ga0501044_0008573 | 3300049823 | Bacteria | 11199 |
| 225 | Ga0501045_0052887 | 3300049824 | Bacteria | 2966 |
| 226 | nmdc:mga03n38_116238_c1 | 3300050490 | Bacteria | 1309 |
| 227 | nmdc:mga0k408_14575_c1 | 3300050493 | Bacteria | 4335 |
| 228 | nmdc:mga06z11_30264_c1 | 3300050494 | Bacteria | 2618 |
| 229 | nmdc:mga04h51_6484_c1 | 3300050495 | Bacteria | 3038 |
| 230 | nmdc:mga07m45_69269_c2 | 3300050496 | Bacteria | 1309 |
| 231 | nmdc:mga08y16_768707_c1 | 3300050511 | Bacteria | 958 |
| 232 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 233 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 234 | Ga0495612_0025445 | 3300053078 | Bacteria | 2376 |
| 235 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 236 | Ga0495619_0000027 | 3300053085 | Bacteria | 165001 |
| 237 | Ga0500595_023125 | 3300053119 | Bacteria | 2189 |
| 238 | Ga0500568_0018056 | 3300053139 | Bacteria | 3098 |
| 239 | Ga0500616_0025592 | 3300053153 | Bacteria | 3272 |
| 240 | Ga0500636_0143356 | 3300053177 | Bacteria | 1320 |
| 241 | Ga0501084_0022734 | 3300054114 | Bacteria | 5234 |
| 242 | Ga0501082_0007563 | 3300060353 | Bacteria | 9373 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0356194 | Ga0466963_0356194_242_1015 | 245 |
| 2 | 3300041408 | Ga0439453_0003411 | Ga0439453_0003411_1213_2037 | 246 |
| 3 | 3300048088 | Ga0495602_0310821 | Ga0495602_0310821_107_919 | 249 |
| 4 | 3300005840 | Ga0068870_10173121 | Ga0068870_101731211 | 250 |
| 5 | 3300046689 | Ga0495613_0197358 | Ga0495613_0197358_16_786 | 251 |
| 6 | 3300035695 | Ga0373927_0015412 | Ga0373927_0015412_4175_4948 | 252 |
| 7 | 3300035725 | Ga0373947_0086897 | Ga0373947_0086897_1059_1832 | 252 |
| 8 | 3300037068 | Ga0373925_0073836 | Ga0373925_0073836_1258_2031 | 252 |
| 9 | 3300046455 | Ga0495603_0014448 | Ga0495603_0014448_2574_3347 | 252 |
| 10 | 3300046472 | Ga0495580_0208159 | Ga0495580_0208159_196_969 | 252 |
| 11 | 3300046681 | Ga0495647_0049951 | Ga0495647_0049951_716_1489 | 252 |
| 12 | 3300046683 | Ga0495658_0154050 | Ga0495658_0154050_505_1278 | 252 |
| 13 | 3300048907 | Ga0496104_0392161 | Ga0496104_0392161_404_1177 | 252 |
| 14 | 3300036401 | Ga0373937_0594462 | Ga0373937_0594462_84_893 | 255 |
| 15 | 3300050490 | nmdc:mga03n38_116238_c1 | nmdc:mga03n38_116238_c1_362_1177 | 256 |
| 16 | 3300050511 | nmdc:mga08y16_768707_c1 | nmdc:mga08y16_768707_c1_89_904 | 256 |
| 17 | iso_pu_bacteria | 2508501042 | 2508697986 | 256 |
| 18 | iso_pu_bacteria | 2508501128 | 2509153766 | 256 |
| 19 | iso_pu_bacteria | 2881364244 | 2881365718 | 256 |
| 20 | iso_pu_bacteria | 2935608549 | 2935611021 | 256 |
| 21 | iso_pu_bacteria | 2935648319 | 2935648452 | 256 |
| 22 | iso_pu_bacteria | 2935656913 | 2935657560 | 256 |
| 23 | iso_pu_bacteria | 2935819856 | 2935820506 | 256 |
| 24 | iso_pu_bacteria | 2935847175 | 2935849485 | 256 |
| 25 | iso_pu_bacteria | 2935908558 | 2935911741 | 256 |
| 26 | iso_pu_bacteria | 2935916978 | 2935919396 | 256 |
| 27 | iso_pu_bacteria | 2935926038 | 2935928770 | 256 |
| 28 | iso_pu_bacteria | 2935934488 | 2935938415 | 256 |
| 29 | iso_pu_bacteria | 2935942939 | 2935945693 | 256 |
| 30 | iso_pu_bacteria | 2935951376 | 2935954700 | 256 |
| 31 | iso_pu_bacteria | 2935967501 | 2935970587 | 256 |
| 32 | iso_pu_bacteria | 2935984226 | 2935987811 | 256 |
| 33 | iso_pu_bacteria | 2936011229 | 2936011362 | 256 |
| 34 | iso_pu_bacteria | 2936019824 | 2936019957 | 256 |
| 35 | iso_pu_bacteria | 2936028420 | 2936028553 | 256 |
| 36 | iso_pu_bacteria | 2936046547 | 2936046680 | 256 |
| 37 | iso_pu_bacteria | 2936055302 | 2936062373 | 256 |
| 38 | iso_pu_bacteria | 8016583857 | 8016590790 | 256 |
| 39 | iso_pu_bacteria | 8016630954 | 8016632633 | 256 |
| 40 | iso_pu_bacteria | 8019687851 | 8019688388 | 256 |
| 41 | 3300006186 | Ga0075369_10011801 | Ga0075369_100118012 | 259 |
| 42 | 3300048904 | Ga0496101_0242497 | Ga0496101_0242497_599_1378 | 259 |
| 43 | 3300048905 | Ga0496102_0039594 | Ga0496102_0039594_1560_2339 | 259 |
| 44 | 3300048912 | Ga0496109_0177449 | Ga0496109_0177449_1027_1806 | 259 |
| 45 | 3300005354 | Ga0070675_100176972 | Ga0070675_1001769721 | 260 |
| 46 | 3300005467 | Ga0070706_100247673 | Ga0070706_1002476732 | 260 |
| 47 | 3300005468 | Ga0070707_100359730 | Ga0070707_1003597302 | 260 |
| 48 | 3300005536 | Ga0070697_100341186 | Ga0070697_1003411862 | 260 |
| 49 | 3300005539 | Ga0068853_100136803 | Ga0068853_1001368032 | 260 |
| 50 | 3300005616 | Ga0068852_100434044 | Ga0068852_1004340442 | 260 |
| 51 | 3300006173 | Ga0070716_100047795 | Ga0070716_1000477952 | 260 |
| 52 | 3300009093 | Ga0105240_10027333 | Ga0105240_100273335 | 260 |
| 53 | 3300025906 | Ga0207699_10181113 | Ga0207699_101811132 | 260 |
| 54 | 3300025910 | Ga0207684_10170842 | Ga0207684_101708422 | 260 |
| 55 | 3300025913 | Ga0207695_10267668 | Ga0207695_102676681 | 260 |
| 56 | 3300025922 | Ga0207646_10302312 | Ga0207646_103023122 | 260 |
| 57 | 3300035241 | Ga0373961_0020673 | Ga0373961_0020673_479_1291 | 260 |
| 58 | 3300035691 | Ga0373931_0117114 | Ga0373931_0117114_82_879 | 260 |
| 59 | 3300048907 | Ga0496104_0019267 | Ga0496104_0019267_2321_3148 | 260 |
| 60 | 3300048911 | Ga0496108_0220635 | Ga0496108_0220635_566_1363 | 260 |
| 61 | 3300048924 | Ga0496121_0001006 | Ga0496121_0001006_14836_15627 | 260 |
| 62 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_840_1634 | 260 |
| 63 | 3300048929 | Ga0496126_0273182 | Ga0496126_0273182_98_889 | 260 |
| 64 | 3300053177 | Ga0500636_0143356 | Ga0500636_0143356_308_1105 | 260 |
| 65 | 3300005335 | Ga0070666_10094037 | Ga0070666_100940373 | 261 |
| 66 | 3300005355 | Ga0070671_100035476 | Ga0070671_1000354764 | 261 |
| 67 | 3300005364 | Ga0070673_100002712 | Ga0070673_1000027129 | 261 |
| 68 | 3300005436 | Ga0070713_100132503 | Ga0070713_1001325033 | 261 |
| 69 | 3300005436 | Ga0070713_100263847 | Ga0070713_1002638472 | 261 |
| 70 | 3300005564 | Ga0070664_100280844 | Ga0070664_1002808441 | 261 |
| 71 | 3300005617 | Ga0068859_100301401 | Ga0068859_1003014011 | 261 |
| 72 | 3300006175 | Ga0070712_100020310 | Ga0070712_1000203104 | 261 |
| 73 | 3300006846 | Ga0075430_100044019 | Ga0075430_1000440194 | 261 |
| 74 | 3300006847 | Ga0075431_100181584 | Ga0075431_1001815843 | 261 |
| 75 | 3300006931 | Ga0097620_100301376 | Ga0097620_1003013763 | 261 |
| 76 | 3300009147 | Ga0114129_10054638 | Ga0114129_100546385 | 261 |
| 77 | 3300025906 | Ga0207699_10378479 | Ga0207699_103784791 | 261 |
| 78 | 3300025915 | Ga0207693_10013691 | Ga0207693_100136915 | 261 |
| 79 | 3300025916 | Ga0207663_10238566 | Ga0207663_102385661 | 261 |
| 80 | 3300025925 | Ga0207650_10003487 | Ga0207650_100034872 | 261 |
| 81 | 3300025928 | Ga0207700_10522783 | Ga0207700_105227831 | 261 |
| 82 | 3300025931 | Ga0207644_10036581 | Ga0207644_100365815 | 261 |
| 83 | 3300037853 | Ga0436364_1543354 | Ga0436364_1543354_156_944 | 261 |
| 84 | 3300039437 | Ga0436365_0494590 | Ga0436365_0494590_2559_3344 | 261 |
| 85 | 3300039437 | Ga0436365_1793210 | Ga0436365_1793210_94_882 | 261 |
| 86 | 3300048913 | Ga0496110_0326936 | Ga0496110_0326936_168_977 | 261 |
| 87 | 3300048915 | Ga0496112_0028852 | Ga0496112_0028852_675_1484 | 261 |
| 88 | 3300048917 | Ga0496114_0250705 | Ga0496114_0250705_255_1043 | 261 |
| 89 | 3300035117 | Ga0373953_0027265 | Ga0373953_0027265_56_862 | 262 |
| 90 | 3300035410 | Ga0373924_0103951 | Ga0373924_0103951_67_873 | 262 |
| 91 | 3300036401 | Ga0373937_0316856 | Ga0373937_0316856_108_914 | 262 |
| 92 | 3300046459 | Ga0495629_0362038 | Ga0495629_0362038_140_946 | 262 |
| 93 | 3300046463 | Ga0495653_0118556 | Ga0495653_0118556_945_1751 | 262 |
| 94 | 3300046472 | Ga0495580_0274521 | Ga0495580_0274521_90_896 | 262 |
| 95 | 3300046477 | Ga0495664_0093059 | Ga0495664_0093059_260_1066 | 262 |
| 96 | 3300046499 | Ga0495594_0104355 | Ga0495594_0104355_265_1071 | 262 |
| 97 | 3300046514 | Ga0495618_0173584 | Ga0495618_0173584_260_1066 | 262 |
| 98 | 3300046517 | Ga0495630_0147769 | Ga0495630_0147769_924_1730 | 262 |
| 99 | 3300046529 | Ga0495652_0193422 | Ga0495652_0193422_167_973 | 262 |
| 100 | 3300046536 | Ga0495587_0062748 | Ga0495587_0062748_1342_2148 | 262 |
| 101 | 3300046559 | Ga0495667_0062407 | Ga0495667_0062407_871_1677 | 262 |
| 102 | 3300046678 | Ga0495599_0020631 | Ga0495599_0020631_2693_3499 | 262 |
| 103 | 3300048088 | Ga0495602_0120772 | Ga0495602_0120772_945_1751 | 262 |
| 104 | 3300053078 | Ga0495612_0025445 | Ga0495612_0025445_656_1462 | 262 |
| 105 | 3300005328 | Ga0070676_10111861 | Ga0070676_101118613 | 263 |
| 106 | 3300005330 | Ga0070690_100114068 | Ga0070690_1001140682 | 263 |
| 107 | 3300005339 | Ga0070660_100199482 | Ga0070660_1001994822 | 263 |
| 108 | 3300005340 | Ga0070689_100175590 | Ga0070689_1001755901 | 263 |
| 109 | 3300005343 | Ga0070687_100037033 | Ga0070687_1000370332 | 263 |
| 110 | 3300005353 | Ga0070669_100099800 | Ga0070669_1000998003 | 263 |
| 111 | 3300005355 | Ga0070671_100162981 | Ga0070671_1001629813 | 263 |
| 112 | 3300005364 | Ga0070673_100179313 | Ga0070673_1001793132 | 263 |
| 113 | 3300005544 | Ga0070686_100174804 | Ga0070686_1001748042 | 263 |
| 114 | 3300005617 | Ga0068859_100275915 | Ga0068859_1002759152 | 263 |
| 115 | 3300005618 | Ga0068864_100034810 | Ga0068864_1000348104 | 263 |
| 116 | 3300006178 | Ga0075367_10051766 | Ga0075367_100517664 | 263 |
| 117 | 3300006931 | Ga0097620_100275914 | Ga0097620_1002759142 | 263 |
| 118 | 3300009148 | Ga0105243_10152120 | Ga0105243_101521203 | 263 |
| 119 | 3300009177 | Ga0105248_10031820 | Ga0105248_100318202 | 263 |
| 120 | 3300013306 | Ga0163162_10162917 | Ga0163162_101629174 | 263 |
| 121 | 3300013308 | Ga0157375_10617201 | Ga0157375_106172012 | 263 |
| 122 | 3300025899 | Ga0207642_10188977 | Ga0207642_101889771 | 263 |
| 123 | 3300025907 | Ga0207645_10155093 | Ga0207645_101550932 | 263 |
| 124 | 3300025923 | Ga0207681_10104272 | Ga0207681_101042722 | 263 |
| 125 | 3300025931 | Ga0207644_10261294 | Ga0207644_102612942 | 263 |
| 126 | 3300025935 | Ga0207709_10087185 | Ga0207709_100871853 | 263 |
| 127 | 3300025936 | Ga0207670_10050980 | Ga0207670_100509802 | 263 |
| 128 | 3300025941 | Ga0207711_10077384 | Ga0207711_100773842 | 263 |
| 129 | 3300025960 | Ga0207651_10061702 | Ga0207651_100617025 | 263 |
| 130 | 3300025986 | Ga0207658_10329457 | Ga0207658_103294571 | 263 |
| 131 | 3300026095 | Ga0207676_10037916 | Ga0207676_100379166 | 263 |
| 132 | 3300035085 | Ga0373929_0033021 | Ga0373929_0033021_202_1062 | 263 |
| 133 | 3300035088 | Ga0373940_0017830 | Ga0373940_0017830_773_1663 | 263 |
| 134 | 3300035092 | Ga0373952_0003651 | Ga0373952_0003651_1832_2722 | 263 |
| 135 | 3300035121 | Ga0373960_0054583 | Ga0373960_0054583_43_933 | 263 |
| 136 | 3300035691 | Ga0373931_0001311 | Ga0373931_0001311_2087_2977 | 263 |
| 137 | 3300035691 | Ga0373931_0030765 | Ga0373931_0030765_1932_2732 | 263 |
| 138 | 3300046533 | Ga0495640_0291602 | Ga0495640_0291602_70_882 | 263 |
| 139 | 3300048904 | Ga0496101_0147316 | Ga0496101_0147316_226_1116 | 263 |
| 140 | 3300048910 | Ga0496107_0174566 | Ga0496107_0174566_224_1114 | 263 |
| 141 | 3300048913 | Ga0496110_0041729 | Ga0496110_0041729_787_1671 | 263 |
| 142 | 3300048916 | Ga0496113_0374886 | Ga0496113_0374886_209_1099 | 263 |
| 143 | 3300048917 | Ga0496114_0312272 | Ga0496114_0312272_189_989 | 263 |
| 144 | 3300050494 | nmdc:mga06z11_30264_c1 | nmdc:mga06z11_30264_c1_1083_1874 | 263 |
| 145 | 3300006038 | Ga0075365_10026310 | Ga0075365_100263104 | 264 |
| 146 | 3300006048 | Ga0075363_100129725 | Ga0075363_1001297252 | 264 |
| 147 | 3300006051 | Ga0075364_10192367 | Ga0075364_101923672 | 264 |
| 148 | 3300006178 | Ga0075367_10039511 | Ga0075367_100395111 | 264 |
| 149 | 3300006353 | Ga0075370_10023085 | Ga0075370_100230854 | 264 |
| 150 | 3300027866 | Ga0209813_10008926 | Ga0209813_100089263 | 264 |
| 151 | 3300046459 | Ga0495629_0348914 | Ga0495629_0348914_30_827 | 264 |
| 152 | 3300050495 | nmdc:mga04h51_6484_c1 | nmdc:mga04h51_6484_c1_676_1470 | 264 |
| 153 | 3300006177 | Ga0075362_10137929 | Ga0075362_101379291 | 265 |
| 154 | 3300005354 | Ga0070675_100266472 | Ga0070675_1002664721 | 266 |
| 155 | 3300005439 | Ga0070711_100357744 | Ga0070711_1003577441 | 266 |
| 156 | 3300025960 | Ga0207651_10683804 | Ga0207651_106838041 | 266 |
| 157 | 3300005328 | Ga0070676_10112596 | Ga0070676_101125962 | 267 |
| 158 | 3300005336 | Ga0070680_100132564 | Ga0070680_1001325642 | 267 |
| 159 | 3300005337 | Ga0070682_100163989 | Ga0070682_1001639891 | 267 |
| 160 | 3300005365 | Ga0070688_100353218 | Ga0070688_1003532181 | 267 |
| 161 | 3300005458 | Ga0070681_10390514 | Ga0070681_103905142 | 267 |
| 162 | 3300005530 | Ga0070679_100021073 | Ga0070679_1000210737 | 267 |
| 163 | 3300005547 | Ga0070693_100050828 | Ga0070693_1000508283 | 267 |
| 164 | 3300013308 | Ga0157375_10524894 | Ga0157375_105248943 | 267 |
| 165 | 3300025917 | Ga0207660_10077884 | Ga0207660_100778842 | 267 |
| 166 | 3300025921 | Ga0207652_10109763 | Ga0207652_101097632 | 267 |
| 167 | 3300031247 | Ga0265340_10039317 | Ga0265340_100393172 | 267 |
| 168 | 3300035113 | Ga0373936_0000563 | Ga0373936_0000563_2750_3565 | 267 |
| 169 | 3300035117 | Ga0373953_0004303 | Ga0373953_0004303_1315_2130 | 267 |
| 170 | 3300035118 | Ga0373954_0012163 | Ga0373954_0012163_1997_2812 | 267 |
| 171 | 3300035119 | Ga0373956_0048727 | Ga0373956_0048727_1014_1829 | 267 |
| 172 | 3300035171 | Ga0373946_0012652 | Ga0373946_0012652_1930_2745 | 267 |
| 173 | 3300035172 | Ga0373955_0000595 | Ga0373955_0000595_4648_5463 | 267 |
| 174 | 3300035410 | Ga0373924_0010093 | Ga0373924_0010093_2460_3275 | 267 |
| 175 | 3300035692 | Ga0373935_0000012 | Ga0373935_0000012_8109_8924 | 267 |
| 176 | 3300035695 | Ga0373927_0024382 | Ga0373927_0024382_2793_3608 | 267 |
| 177 | 3300035724 | Ga0373933_0037383 | Ga0373933_0037383_294_1109 | 267 |
| 178 | 3300035725 | Ga0373947_0001331 | Ga0373947_0001331_651_1466 | 267 |
| 179 | 3300035725 | Ga0373947_0023685 | Ga0373947_0023685_1595_2407 | 267 |
| 180 | 3300036401 | Ga0373937_0000054 | Ga0373937_0000054_58729_59544 | 267 |
| 181 | 3300037068 | Ga0373925_0000018 | Ga0373925_0000018_74674_75489 | 267 |
| 182 | 3300037068 | Ga0373925_0036801 | Ga0373925_0036801_588_1400 | 267 |
| 183 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_132909_133724 | 267 |
| 184 | 3300046459 | Ga0495629_0017573 | Ga0495629_0017573_22_837 | 267 |
| 185 | 3300046462 | Ga0495651_0011346 | Ga0495651_0011346_2539_3354 | 267 |
| 186 | 3300046463 | Ga0495653_0000015 | Ga0495653_0000015_186665_187480 | 267 |
| 187 | 3300046476 | Ga0495662_0003607 | Ga0495662_0003607_6111_6926 | 267 |
| 188 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_182637_183452 | 267 |
| 189 | 3300046499 | Ga0495594_0154426 | Ga0495594_0154426_132_947 | 267 |
| 190 | 3300046511 | Ga0495608_0000050 | Ga0495608_0000050_91214_92029 | 267 |
| 191 | 3300046514 | Ga0495618_0000045 | Ga0495618_0000045_20760_21575 | 267 |
| 192 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_13694_14509 | 267 |
| 193 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_643713_644528 | 267 |
| 194 | 3300046531 | Ga0495665_0016372 | Ga0495665_0016372_758_1573 | 267 |
| 195 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_91349_92164 | 267 |
| 196 | 3300046536 | Ga0495587_0000536 | Ga0495587_0000536_13674_14489 | 267 |
| 197 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_76143_76958 | 267 |
| 198 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_483681_484496 | 267 |
| 199 | 3300046642 | Ga0495634_0000751 | Ga0495634_0000751_1412_2227 | 267 |
| 200 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_207171_207986 | 267 |
| 201 | 3300046675 | Ga0495657_0000136 | Ga0495657_0000136_13686_14501 | 267 |
| 202 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_274223_275038 | 267 |
| 203 | 3300046679 | Ga0495623_0000052 | Ga0495623_0000052_66711_67526 | 267 |
| 204 | 3300046680 | Ga0495646_0000036 | Ga0495646_0000036_13809_14624 | 267 |
| 205 | 3300046689 | Ga0495613_0064796 | Ga0495613_0064796_428_1243 | 267 |
| 206 | 3300046690 | Ga0495624_0101732 | Ga0495624_0101732_285_1100 | 267 |
| 207 | 3300046809 | Ga0495600_0000037 | Ga0495600_0000037_66543_67358 | 267 |
| 208 | 3300047315 | Ga0495581_0002053 | Ga0495581_0002053_2348_3163 | 267 |
| 209 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_10763_11578 | 267 |
| 210 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_382574_383389 | 267 |
| 211 | 3300047322 | Ga0495680_0003271 | Ga0495680_0003271_13788_14603 | 267 |
| 212 | 3300047444 | Ga0495675_0000049 | Ga0495675_0000049_13612_14427 | 267 |
| 213 | 3300047471 | Ga0495684_0000046 | Ga0495684_0000046_32737_33552 | 267 |
| 214 | 3300047673 | Ga0495593_0003282 | Ga0495593_0003282_1421_2236 | 267 |
| 215 | 3300048088 | Ga0495602_0000102 | Ga0495602_0000102_13731_14546 | 267 |
| 216 | 3300048089 | Ga0495614_0151027 | Ga0495614_0151027_98_913 | 267 |
| 217 | 3300048916 | Ga0496113_0545528 | Ga0496113_0545528_20_841 | 267 |
| 218 | 3300048917 | Ga0496114_0383665 | Ga0496114_0383665_269_1090 | 267 |
| 219 | 3300049568 | Ga0501031_0066240 | Ga0501031_0066240_1027_1830 | 267 |
| 220 | 3300049569 | Ga0501032_0029317 | Ga0501032_0029317_1945_2748 | 267 |
| 221 | 3300049570 | Ga0501033_0068053 | Ga0501033_0068053_501_1304 | 267 |
| 222 | 3300049571 | Ga0501034_0071044 | Ga0501034_0071044_1532_2335 | 267 |
| 223 | 3300049573 | Ga0501037_0001340 | Ga0501037_0001340_7666_8469 | 267 |
| 224 | 3300049574 | Ga0501038_0001023 | Ga0501038_0001023_22299_23102 | 267 |
| 225 | 3300049575 | Ga0501039_0015388 | Ga0501039_0015388_1141_1944 | 267 |
| 226 | 3300049579 | Ga0501043_0025349 | Ga0501043_0025349_727_1530 | 267 |
| 227 | 3300049580 | Ga0501046_0008699 | Ga0501046_0008699_5857_6660 | 267 |
| 228 | 3300049581 | Ga0501047_0175597 | Ga0501047_0175597_706_1509 | 267 |
| 229 | 3300049582 | Ga0501048_0002666 | Ga0501048_0002666_2193_2996 | 267 |
| 230 | 3300049583 | Ga0501067_0009926 | Ga0501067_0009926_2888_3691 | 267 |
| 231 | 3300049584 | Ga0501068_0040935 | Ga0501068_0040935_752_1555 | 267 |
| 232 | 3300049585 | Ga0501069_0005453 | Ga0501069_0005453_2191_2994 | 267 |
| 233 | 3300049586 | Ga0501070_0025730 | Ga0501070_0025730_513_1316 | 267 |
| 234 | 3300049586 | Ga0501070_0530862 | Ga0501070_0530862_32_835 | 267 |
| 235 | 3300049589 | Ga0501073_0017253 | Ga0501073_0017253_513_1316 | 267 |
| 236 | 3300049590 | Ga0501074_0028651 | Ga0501074_0028651_1316_2119 | 267 |
| 237 | 3300049592 | Ga0501076_0077266 | Ga0501076_0077266_710_1513 | 267 |
| 238 | 3300049741 | Ga0501079_0211050 | Ga0501079_0211050_534_1337 | 267 |
| 239 | 3300049742 | Ga0501080_0167453 | Ga0501080_0167453_852_1655 | 267 |
| 240 | 3300049743 | Ga0501081_0541950 | Ga0501081_0541950_31_849 | 267 |
| 241 | 3300049822 | Ga0501035_0037796 | Ga0501035_0037796_2035_2838 | 267 |
| 242 | 3300049823 | Ga0501044_0008573 | Ga0501044_0008573_1315_2118 | 267 |
| 243 | 3300049824 | Ga0501045_0052887 | Ga0501045_0052887_836_1639 | 267 |
| 244 | 3300050493 | nmdc:mga0k408_14575_c1 | nmdc:mga0k408_14575_c1_972_1775 | 267 |
| 245 | 3300050496 | nmdc:mga07m45_69269_c2 | nmdc:mga07m45_69269_c2_238_1041 | 267 |
| 246 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_222624_223439 | 267 |
| 247 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_91221_92036 | 267 |
| 248 | 3300053084 | Ga0495595_0000006 | Ga0495595_0000006_18667_19482 | 267 |
| 249 | 3300053085 | Ga0495619_0000027 | Ga0495619_0000027_13882_14697 | 267 |
| 250 | 3300053119 | Ga0500595_023125 | Ga0500595_023125_358_1161 | 267 |
| 251 | 3300053139 | Ga0500568_0018056 | Ga0500568_0018056_1549_2364 | 267 |
| 252 | 3300053153 | Ga0500616_0025592 | Ga0500616_0025592_2096_2911 | 267 |
| 253 | 3300054114 | Ga0501084_0022734 | Ga0501084_0022734_4203_5006 | 267 |
| 254 | 3300060353 | Ga0501082_0007563 | Ga0501082_0007563_5733_6536 | 267 |
| 255 | 3300003215 | JGI25153J46596_10002574 | JGI25153J46596_100025748 | 268 |
| 256 | 3300025297 | Ga0209758_1000158 | Ga0209758_100015821 | 268 |
| 257 | 3300031241 | Ga0265325_10001191 | Ga0265325_100011917 | 268 |
| 258 | 3300049571 | Ga0501034_0074074 | Ga0501034_0074074_241_1047 | 268 |
| 259 | iso_pu_bacteria | 2829745981 | 2829750382 | 268 |
| 260 | 3300006178 | Ga0075367_10031401 | Ga0075367_100314013 | 269 |
| 261 | 3300049823 | Ga0501044_0000260 | Ga0501044_0000260_49438_50316 | 273 |
| 262 | 3300002244 | JGI24742J22300_10015875 | JGI24742J22300_100158751 | 274 |
| 263 | 3300005329 | Ga0070683_100213135 | Ga0070683_1002131352 | 274 |
| 264 | 3300005356 | Ga0070674_100023667 | Ga0070674_1000236677 | 274 |
| 265 | 3300005456 | Ga0070678_100467122 | Ga0070678_1004671221 | 274 |
| 266 | 3300005618 | Ga0068864_100129780 | Ga0068864_1001297803 | 274 |
| 267 | 3300005718 | Ga0068866_10198568 | Ga0068866_101985681 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jfn-assembly1.cif.gz_A | crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala | 0.9119 | 4 | 265 |
| 2jfn-assembly1.cif.gz_A | crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala | 0.8888 | 4 | 265 |
| 3isv-assembly2.cif.gz_A | crystal structure of glutamate racemase from listeria monocytogenes in complex with acetate ion | 0.8476 | 4 | 264 |
| 3ist-assembly1.cif.gz_A | crystal structure of glutamate racemase from listeria monocytogenes in complex with succinic acid | 0.8395 | 3 | 265 |
| 2ohv-assembly1.cif.gz_A-2 | structural basis for glutamate racemase inhibition | 0.8391 | 1 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22634_23_240_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9592 | 7 | 224 | 3.30.479.30 |
| af_P22634_23_240_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9464 | 7 | 224 | 3.30.479.30 |
| af_P9WPW9_6_95_3.40.50.1860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9355 | 4 | 95 | 3.40.50.1860 |
| af_P9WPW9_6_95_3.40.50.1860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9258 | 4 | 95 | 3.40.50.1860 |
| 2jfnA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9187 | 98 | 211 | 3.40.50.1860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537TCZ6-F1-model_v4 | Glutamate racemase (EC 5.1.1.3) | 0.9877 | 4 | 261 |
GO:0008360
GO:0008881 GO:0009252 GO:0071555 |
| AF-A0A537S0V6-F1-model_v4 | Glutamate racemase (EC 5.1.1.3) | 0.9847 | 10 | 260 |
GO:0008360
GO:0008881 GO:0009252 GO:0071555 |
| AF-A0A1Q7BVA5-F1-model_v4 | Glutamate racemase (EC 5.1.1.3) | 0.9837 | 4 | 261 |
GO:0008360
GO:0008881 GO:0009252 GO:0071555 |
| AF-A0A0Q6Z6Y3-F1-model_v4 | Glutamate racemase (EC 5.1.1.3) | 0.9818 | 1 | 262 |
GO:0008360
GO:0008881 GO:0009252 GO:0071555 |
| AF-A0A6S6QPS2-F1-model_v4 | Glutamate racemase (EC 5.1.1.3) | 0.9808 | 1 | 266 |
GO:0008360
GO:0008881 GO:0009252 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar