F374563

General Info

Members Datasets Scaffolds Average Seq Length
267 216 242 269

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100162981|Ga0070671_1001629813
Length 296
Sequence VSSVLAAEQEQASKPLPFQAICDSPKTLQSIGAMTAAPSILVFDSGLGGLTVFREVVKARPDAYFVYVADDAFFPYGRQDEAKLVVRVLDVMAGLIAAHRPDLVVIACNTASTIVLPALREKFAGPFVGTVPAIKPACASSASKLVTVFGTEATIKREYTRALIRDYAQGCAVTLVGSPRLAELAEAELKGELVSDDDVAAELVPCFVAIDGKRTDTIVLACTHYPLLLKRFEKVAPWPVNFIDPAPAIARRVLDLLGAPTPVASAAPVRFIFTSGMAPSAALQAALGRFGAALAV

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
4 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
5 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
6 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
7 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
8 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
9 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
10 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
11 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
12 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
13 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
14 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
15 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
16 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
17 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
18 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
19 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
20 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
21 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
22 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
215 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
216 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0
Isolates 9.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 8.61
Rhizoplane 5.99
Rhizosphere 74.91
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10015875 3300002244 Bacteria 1268
2 JGI25153J46596_10002574 3300003215 Bacteria 10393
3 Ga0070676_10111861 3300005328 Bacteria 1701
4 Ga0070676_10112596 3300005328 Bacteria 1696
5 Ga0070683_100213135 3300005329 Bacteria 1835
6 Ga0070690_100114068 3300005330 Bacteria 1807
7 Ga0070666_10094037 3300005335 Bacteria 2061
8 Ga0070680_100132564 3300005336 Bacteria 2085
9 Ga0070682_100163989 3300005337 Bacteria 1538
10 Ga0070660_100199482 3300005339 Bacteria 1623
11 Ga0070689_100175590 3300005340 Bacteria 1737
12 Ga0070687_100037033 3300005343 Bacteria 2436
13 Ga0070669_100099800 3300005353 Bacteria 2188
14 Ga0070675_100176972 3300005354 Bacteria 1843
15 Ga0070675_100266472 3300005354 Bacteria 1502
16 Ga0070671_100035476 3300005355 Bacteria 4132
17 Ga0070671_100162981 3300005355 Bacteria 1885
18 Ga0070674_100023667 3300005356 Bacteria 3979
19 Ga0070673_100002712 3300005364 Bacteria 10854
20 Ga0070673_100179313 3300005364 Bacteria 1813
21 Ga0070688_100353218 3300005365 Bacteria 1077
22 Ga0070713_100132503 3300005436 Bacteria 2199
23 Ga0070713_100263847 3300005436 Bacteria 1575
24 Ga0070711_100357744 3300005439 Bacteria 1175
25 Ga0070678_100467122 3300005456 Bacteria 1108
26 Ga0070681_10390514 3300005458 Bacteria 1302
27 Ga0070706_100247673 3300005467 Bacteria 1664
28 Ga0070707_100359730 3300005468 Bacteria 1414
29 Ga0070679_100021073 3300005530 Bacteria 6360
30 Ga0070697_100341186 3300005536 Bacteria 1293
31 Ga0068853_100136803 3300005539 Bacteria 2197
32 Ga0070686_100174804 3300005544 Bacteria 1521
33 Ga0070693_100050828 3300005547 Bacteria 2371
34 Ga0070664_100280844 3300005564 Bacteria 1501
35 Ga0068852_100434044 3300005616 Bacteria 1298
36 Ga0068859_100275915 3300005617 Bacteria 1773
37 Ga0068859_100301401 3300005617 Bacteria 1696
38 Ga0068864_100034810 3300005618 Bacteria 4285
39 Ga0068864_100129780 3300005618 Bacteria 2263
40 Ga0068866_10198568 3300005718 Bacteria 1197
41 Ga0068870_10173121 3300005840 Bacteria 1290
42 Ga0075365_10026310 3300006038 Bacteria 3692
43 Ga0075363_100129725 3300006048 Bacteria 1413
44 Ga0075364_10192367 3300006051 Bacteria 1382
45 Ga0070716_100047795 3300006173 Bacteria 2415
46 Ga0070712_100020310 3300006175 Bacteria 4346
47 Ga0075362_10137929 3300006177 Bacteria 1164
48 Ga0075367_10031401 3300006178 Bacteria 3050
49 Ga0075367_10039511 3300006178 Bacteria 2751
50 Ga0075367_10051766 3300006178 Bacteria 2428
51 Ga0075369_10011801 3300006186 Bacteria 3441
52 Ga0075370_10023085 3300006353 Bacteria 3423
53 Ga0075430_100044019 3300006846 Bacteria 3775
54 Ga0075431_100181584 3300006847 Bacteria 2159
55 Ga0097620_100275914 3300006931 Bacteria 1773
56 Ga0097620_100301376 3300006931 Bacteria 1696
57 Ga0105240_10027333 3300009093 Bacteria 7470
58 Ga0114129_10054638 3300009147 Bacteria 5599
59 Ga0105243_10152120 3300009148 Bacteria 1986
60 Ga0105248_10031820 3300009177 Bacteria 5895
61 Ga0163162_10162917 3300013306 Bacteria 2353
62 Ga0157375_10524894 3300013308 Bacteria 1347
63 Ga0157375_10617201 3300013308 Bacteria 1243
64 Ga0209758_1000158 3300025297 Bacteria 156129
65 Ga0207642_10188977 3300025899 Bacteria 1128
66 Ga0207699_10181113 3300025906 Bacteria 1416
67 Ga0207699_10378479 3300025906 Bacteria 1004
68 Ga0207645_10155093 3300025907 Bacteria 1496
69 Ga0207684_10170842 3300025910 Bacteria 1874
70 Ga0207695_10267668 3300025913 Bacteria 1605
71 Ga0207693_10013691 3300025915 Bacteria 6534
72 Ga0207663_10238566 3300025916 Bacteria 1332
73 Ga0207660_10077884 3300025917 Bacteria 2428
74 Ga0207652_10109763 3300025921 Bacteria 2446
75 Ga0207646_10302312 3300025922 Bacteria 1445
76 Ga0207681_10104272 3300025923 Bacteria 2051
77 Ga0207650_10003487 3300025925 Bacteria 10807
78 Ga0207700_10522783 3300025928 Bacteria 1051
79 Ga0207644_10036581 3300025931 Bacteria 3447
80 Ga0207644_10261294 3300025931 Bacteria 1384
81 Ga0207709_10087185 3300025935 Bacteria 2029
82 Ga0207670_10050980 3300025936 Bacteria 2777
83 Ga0207711_10077384 3300025941 Bacteria 2899
84 Ga0207651_10061702 3300025960 Bacteria 2609
85 Ga0207651_10683804 3300025960 Bacteria 903
86 Ga0207658_10329457 3300025986 Bacteria 1324
87 Ga0207676_10037916 3300026095 Bacteria 3677
88 Ga0209813_10008926 3300027866 Bacteria 2547
89 Ga0265325_10001191 3300031241 Bacteria 18540
90 Ga0265340_10039317 3300031247 Bacteria 2335
91 Ga0373929_0033021 3300035085 Bacteria 1116
92 Ga0373940_0017830 3300035088 Bacteria 1774
93 Ga0373952_0003651 3300035092 Bacteria 2776
94 Ga0373936_0000563 3300035113 Bacteria 12720
95 Ga0373953_0004303 3300035117 Bacteria 4527
96 Ga0373953_0027265 3300035117 Bacteria 2195
97 Ga0373954_0012163 3300035118 Bacteria 3826
98 Ga0373956_0048727 3300035119 Bacteria 1898
99 Ga0373960_0054583 3300035121 Bacteria 1195
100 Ga0373946_0012652 3300035171 Bacteria 3162
101 Ga0373955_0000595 3300035172 Bacteria 15398
102 Ga0373961_0020673 3300035241 Bacteria 1743
103 Ga0373924_0010093 3300035410 Bacteria 3476
104 Ga0373924_0103951 3300035410 Bacteria 1224
105 Ga0373931_0001311 3300035691 Bacteria 10650
106 Ga0373931_0030765 3300035691 Bacteria 2766
107 Ga0373931_0117114 3300035691 Bacteria 1519
108 Ga0373935_0000012 3300035692 Bacteria 81961
109 Ga0373927_0015412 3300035695 Bacteria 5052
110 Ga0373927_0024382 3300035695 Bacteria 3957
111 Ga0373933_0037383 3300035724 Bacteria 2847
112 Ga0373947_0001331 3300035725 Bacteria 15201
113 Ga0373947_0023685 3300035725 Bacteria 3574
114 Ga0373947_0086897 3300035725 Bacteria 1944
115 Ga0373937_0000054 3300036401 Bacteria 102542
116 Ga0373937_0316856 3300036401 Bacteria 1475
117 Ga0373937_0594462 3300036401 Bacteria 1051
118 Ga0373925_0000018 3300037068 Bacteria 174213
119 Ga0373925_0036801 3300037068 Bacteria 3612
120 Ga0373925_0073836 3300037068 Bacteria 2582
121 Ga0436364_1543354 3300037853 Bacteria 959
122 Ga0436365_0494590 3300039437 Bacteria 3520
123 Ga0436365_1793210 3300039437 Bacteria 936
124 Ga0439453_0003411 3300041408 Bacteria 2286
125 Ga0466963_0356194 3300044694 Bacteria 1031
126 Ga0495592_0000001 3300046454 Bacteria 305819
127 Ga0495603_0014448 3300046455 Bacteria 4775
128 Ga0495629_0017573 3300046459 Bacteria 5126
129 Ga0495629_0348914 3300046459 Bacteria 1010
130 Ga0495629_0362038 3300046459 Bacteria 988
131 Ga0495651_0011346 3300046462 Bacteria 6847
132 Ga0495653_0000015 3300046463 Bacteria 213697
133 Ga0495653_0118556 3300046463 Bacteria 1890
134 Ga0495580_0208159 3300046472 Bacteria 1346
135 Ga0495580_0274521 3300046472 Bacteria 1151
136 Ga0495662_0003607 3300046476 Bacteria 7810
137 Ga0495664_0000001 3300046477 Bacteria 757730
138 Ga0495664_0093059 3300046477 Bacteria 1814
139 Ga0495594_0104355 3300046499 Bacteria 1596
140 Ga0495594_0154426 3300046499 Bacteria 1303
141 Ga0495608_0000050 3300046511 Bacteria 96603
142 Ga0495618_0000045 3300046514 Bacteria 94654
143 Ga0495618_0173584 3300046514 Bacteria 1371
144 Ga0495628_0000003 3300046516 Bacteria 470339
145 Ga0495630_0147769 3300046517 Bacteria 1788
146 Ga0495652_0000001 3300046529 Bacteria 1045081
147 Ga0495652_0193422 3300046529 Bacteria 1550
148 Ga0495665_0016372 3300046531 Bacteria 3996
149 Ga0495640_0000006 3300046533 Bacteria 285419
150 Ga0495640_0291602 3300046533 Bacteria 1015
151 Ga0495587_0000536 3300046536 Bacteria 26278
152 Ga0495587_0062748 3300046536 Bacteria 2175
153 Ga0495645_0000004 3300046543 Bacteria 532661
154 Ga0495667_0000001 3300046559 Bacteria 834831
155 Ga0495667_0062407 3300046559 Bacteria 2442
156 Ga0495634_0000751 3300046642 Bacteria 31392
157 Ga0495635_0000007 3300046663 Bacteria 278786
158 Ga0495657_0000136 3300046675 Bacteria 65707
159 Ga0495599_0000002 3300046678 Bacteria 348168
160 Ga0495599_0020631 3300046678 Bacteria 4105
161 Ga0495623_0000052 3300046679 Bacteria 71268
162 Ga0495646_0000036 3300046680 Bacteria 81182
163 Ga0495647_0049951 3300046681 Bacteria 1622
164 Ga0495658_0154050 3300046683 Bacteria 1413
165 Ga0495613_0064796 3300046689 Bacteria 2672
166 Ga0495613_0197358 3300046689 Bacteria 1420
167 Ga0495624_0101732 3300046690 Bacteria 1769
168 Ga0495600_0000037 3300046809 Bacteria 78434
169 Ga0495581_0002053 3300047315 Bacteria 11333
170 Ga0495604_0000007 3300047317 Bacteria 412174
171 Ga0495674_0000001 3300047319 Bacteria 778665
172 Ga0495680_0003271 3300047322 Bacteria 16067
173 Ga0495675_0000049 3300047444 Bacteria 80913
174 Ga0495684_0000046 3300047471 Bacteria 92658
175 Ga0495593_0003282 3300047673 Bacteria 9699
176 Ga0495602_0000102 3300048088 Bacteria 81094
177 Ga0495602_0120772 3300048088 Bacteria 2108
178 Ga0495602_0310821 3300048088 Bacteria 1150
179 Ga0495614_0151027 3300048089 Bacteria 1036
180 Ga0496101_0147316 3300048904 Bacteria 1798
181 Ga0496101_0242497 3300048904 Bacteria 1403
182 Ga0496102_0039594 3300048905 Bacteria 4260
183 Ga0496104_0019267 3300048907 Bacteria 6240
184 Ga0496104_0392161 3300048907 Bacteria 1301
185 Ga0496107_0174566 3300048910 Bacteria 1595
186 Ga0496108_0220635 3300048911 Bacteria 1647
187 Ga0496109_0177449 3300048912 Bacteria 2000
188 Ga0496110_0041729 3300048913 Bacteria 4004
189 Ga0496110_0326936 3300048913 Bacteria 1397
190 Ga0496112_0028852 3300048915 Bacteria 5361
191 Ga0496113_0374886 3300048916 Bacteria 1142
192 Ga0496113_0545528 3300048916 Bacteria 930
193 Ga0496114_0250705 3300048917 Bacteria 1558
194 Ga0496114_0312272 3300048917 Bacteria 1388
195 Ga0496114_0383665 3300048917 Bacteria 1244
196 Ga0496121_0001006 3300048924 Bacteria 50348
197 Ga0496125_0000063 3300048928 Bacteria 250260
198 Ga0496126_0273182 3300048929 Bacteria 1402
199 Ga0501031_0066240 3300049568 Bacteria 2353
200 Ga0501032_0029317 3300049569 Bacteria 3776
201 Ga0501033_0068053 3300049570 Bacteria 2618
202 Ga0501034_0071044 3300049571 Bacteria 3491
203 Ga0501034_0074074 3300049571 Bacteria 3414
204 Ga0501037_0001340 3300049573 Bacteria 18079
205 Ga0501038_0001023 3300049574 Bacteria 25193
206 Ga0501039_0015388 3300049575 Bacteria 5856
207 Ga0501043_0025349 3300049579 Bacteria 4652
208 Ga0501046_0008699 3300049580 Bacteria 8822
209 Ga0501047_0175597 3300049581 Bacteria 2009
210 Ga0501048_0002666 3300049582 Bacteria 13620
211 Ga0501067_0009926 3300049583 Bacteria 5272
212 Ga0501068_0040935 3300049584 Bacteria 2783
213 Ga0501069_0005453 3300049585 Bacteria 6615
214 Ga0501070_0025730 3300049586 Bacteria 4936
215 Ga0501070_0530862 3300049586 Bacteria 943
216 Ga0501073_0017253 3300049589 Bacteria 5229
217 Ga0501074_0028651 3300049590 Bacteria 4036
218 Ga0501076_0077266 3300049592 Bacteria 2671
219 Ga0501079_0211050 3300049741 Bacteria 1516
220 Ga0501080_0167453 3300049742 Bacteria 2027
221 Ga0501081_0541950 3300049743 Bacteria 869
222 Ga0501035_0037796 3300049822 Bacteria 4369
223 Ga0501044_0000260 3300049823 Bacteria 67087
224 Ga0501044_0008573 3300049823 Bacteria 11199
225 Ga0501045_0052887 3300049824 Bacteria 2966
226 nmdc:mga03n38_116238_c1 3300050490 Bacteria 1309
227 nmdc:mga0k408_14575_c1 3300050493 Bacteria 4335
228 nmdc:mga06z11_30264_c1 3300050494 Bacteria 2618
229 nmdc:mga04h51_6484_c1 3300050495 Bacteria 3038
230 nmdc:mga07m45_69269_c2 3300050496 Bacteria 1309
231 nmdc:mga08y16_768707_c1 3300050511 Bacteria 958
232 Ga0495601_0000006 3300053077 Bacteria 373770
233 Ga0495612_0000004 3300053078 Bacteria 286946
234 Ga0495612_0025445 3300053078 Bacteria 2376
235 Ga0495595_0000006 3300053084 Bacteria 231295
236 Ga0495619_0000027 3300053085 Bacteria 165001
237 Ga0500595_023125 3300053119 Bacteria 2189
238 Ga0500568_0018056 3300053139 Bacteria 3098
239 Ga0500616_0025592 3300053153 Bacteria 3272
240 Ga0500636_0143356 3300053177 Bacteria 1320
241 Ga0501084_0022734 3300054114 Bacteria 5234
242 Ga0501082_0007563 3300060353 Bacteria 9373

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0356194 Ga0466963_0356194_242_1015 245
2 3300041408 Ga0439453_0003411 Ga0439453_0003411_1213_2037 246
3 3300048088 Ga0495602_0310821 Ga0495602_0310821_107_919 249
4 3300005840 Ga0068870_10173121 Ga0068870_101731211 250
5 3300046689 Ga0495613_0197358 Ga0495613_0197358_16_786 251
6 3300035695 Ga0373927_0015412 Ga0373927_0015412_4175_4948 252
7 3300035725 Ga0373947_0086897 Ga0373947_0086897_1059_1832 252
8 3300037068 Ga0373925_0073836 Ga0373925_0073836_1258_2031 252
9 3300046455 Ga0495603_0014448 Ga0495603_0014448_2574_3347 252
10 3300046472 Ga0495580_0208159 Ga0495580_0208159_196_969 252
11 3300046681 Ga0495647_0049951 Ga0495647_0049951_716_1489 252
12 3300046683 Ga0495658_0154050 Ga0495658_0154050_505_1278 252
13 3300048907 Ga0496104_0392161 Ga0496104_0392161_404_1177 252
14 3300036401 Ga0373937_0594462 Ga0373937_0594462_84_893 255
15 3300050490 nmdc:mga03n38_116238_c1 nmdc:mga03n38_116238_c1_362_1177 256
16 3300050511 nmdc:mga08y16_768707_c1 nmdc:mga08y16_768707_c1_89_904 256
17 iso_pu_bacteria 2508501042 2508697986 256
18 iso_pu_bacteria 2508501128 2509153766 256
19 iso_pu_bacteria 2881364244 2881365718 256
20 iso_pu_bacteria 2935608549 2935611021 256
21 iso_pu_bacteria 2935648319 2935648452 256
22 iso_pu_bacteria 2935656913 2935657560 256
23 iso_pu_bacteria 2935819856 2935820506 256
24 iso_pu_bacteria 2935847175 2935849485 256
25 iso_pu_bacteria 2935908558 2935911741 256
26 iso_pu_bacteria 2935916978 2935919396 256
27 iso_pu_bacteria 2935926038 2935928770 256
28 iso_pu_bacteria 2935934488 2935938415 256
29 iso_pu_bacteria 2935942939 2935945693 256
30 iso_pu_bacteria 2935951376 2935954700 256
31 iso_pu_bacteria 2935967501 2935970587 256
32 iso_pu_bacteria 2935984226 2935987811 256
33 iso_pu_bacteria 2936011229 2936011362 256
34 iso_pu_bacteria 2936019824 2936019957 256
35 iso_pu_bacteria 2936028420 2936028553 256
36 iso_pu_bacteria 2936046547 2936046680 256
37 iso_pu_bacteria 2936055302 2936062373 256
38 iso_pu_bacteria 8016583857 8016590790 256
39 iso_pu_bacteria 8016630954 8016632633 256
40 iso_pu_bacteria 8019687851 8019688388 256
41 3300006186 Ga0075369_10011801 Ga0075369_100118012 259
42 3300048904 Ga0496101_0242497 Ga0496101_0242497_599_1378 259
43 3300048905 Ga0496102_0039594 Ga0496102_0039594_1560_2339 259
44 3300048912 Ga0496109_0177449 Ga0496109_0177449_1027_1806 259
45 3300005354 Ga0070675_100176972 Ga0070675_1001769721 260
46 3300005467 Ga0070706_100247673 Ga0070706_1002476732 260
47 3300005468 Ga0070707_100359730 Ga0070707_1003597302 260
48 3300005536 Ga0070697_100341186 Ga0070697_1003411862 260
49 3300005539 Ga0068853_100136803 Ga0068853_1001368032 260
50 3300005616 Ga0068852_100434044 Ga0068852_1004340442 260
51 3300006173 Ga0070716_100047795 Ga0070716_1000477952 260
52 3300009093 Ga0105240_10027333 Ga0105240_100273335 260
53 3300025906 Ga0207699_10181113 Ga0207699_101811132 260
54 3300025910 Ga0207684_10170842 Ga0207684_101708422 260
55 3300025913 Ga0207695_10267668 Ga0207695_102676681 260
56 3300025922 Ga0207646_10302312 Ga0207646_103023122 260
57 3300035241 Ga0373961_0020673 Ga0373961_0020673_479_1291 260
58 3300035691 Ga0373931_0117114 Ga0373931_0117114_82_879 260
59 3300048907 Ga0496104_0019267 Ga0496104_0019267_2321_3148 260
60 3300048911 Ga0496108_0220635 Ga0496108_0220635_566_1363 260
61 3300048924 Ga0496121_0001006 Ga0496121_0001006_14836_15627 260
62 3300048928 Ga0496125_0000063 Ga0496125_0000063_840_1634 260
63 3300048929 Ga0496126_0273182 Ga0496126_0273182_98_889 260
64 3300053177 Ga0500636_0143356 Ga0500636_0143356_308_1105 260
65 3300005335 Ga0070666_10094037 Ga0070666_100940373 261
66 3300005355 Ga0070671_100035476 Ga0070671_1000354764 261
67 3300005364 Ga0070673_100002712 Ga0070673_1000027129 261
68 3300005436 Ga0070713_100132503 Ga0070713_1001325033 261
69 3300005436 Ga0070713_100263847 Ga0070713_1002638472 261
70 3300005564 Ga0070664_100280844 Ga0070664_1002808441 261
71 3300005617 Ga0068859_100301401 Ga0068859_1003014011 261
72 3300006175 Ga0070712_100020310 Ga0070712_1000203104 261
73 3300006846 Ga0075430_100044019 Ga0075430_1000440194 261
74 3300006847 Ga0075431_100181584 Ga0075431_1001815843 261
75 3300006931 Ga0097620_100301376 Ga0097620_1003013763 261
76 3300009147 Ga0114129_10054638 Ga0114129_100546385 261
77 3300025906 Ga0207699_10378479 Ga0207699_103784791 261
78 3300025915 Ga0207693_10013691 Ga0207693_100136915 261
79 3300025916 Ga0207663_10238566 Ga0207663_102385661 261
80 3300025925 Ga0207650_10003487 Ga0207650_100034872 261
81 3300025928 Ga0207700_10522783 Ga0207700_105227831 261
82 3300025931 Ga0207644_10036581 Ga0207644_100365815 261
83 3300037853 Ga0436364_1543354 Ga0436364_1543354_156_944 261
84 3300039437 Ga0436365_0494590 Ga0436365_0494590_2559_3344 261
85 3300039437 Ga0436365_1793210 Ga0436365_1793210_94_882 261
86 3300048913 Ga0496110_0326936 Ga0496110_0326936_168_977 261
87 3300048915 Ga0496112_0028852 Ga0496112_0028852_675_1484 261
88 3300048917 Ga0496114_0250705 Ga0496114_0250705_255_1043 261
89 3300035117 Ga0373953_0027265 Ga0373953_0027265_56_862 262
90 3300035410 Ga0373924_0103951 Ga0373924_0103951_67_873 262
91 3300036401 Ga0373937_0316856 Ga0373937_0316856_108_914 262
92 3300046459 Ga0495629_0362038 Ga0495629_0362038_140_946 262
93 3300046463 Ga0495653_0118556 Ga0495653_0118556_945_1751 262
94 3300046472 Ga0495580_0274521 Ga0495580_0274521_90_896 262
95 3300046477 Ga0495664_0093059 Ga0495664_0093059_260_1066 262
96 3300046499 Ga0495594_0104355 Ga0495594_0104355_265_1071 262
97 3300046514 Ga0495618_0173584 Ga0495618_0173584_260_1066 262
98 3300046517 Ga0495630_0147769 Ga0495630_0147769_924_1730 262
99 3300046529 Ga0495652_0193422 Ga0495652_0193422_167_973 262
100 3300046536 Ga0495587_0062748 Ga0495587_0062748_1342_2148 262
101 3300046559 Ga0495667_0062407 Ga0495667_0062407_871_1677 262
102 3300046678 Ga0495599_0020631 Ga0495599_0020631_2693_3499 262
103 3300048088 Ga0495602_0120772 Ga0495602_0120772_945_1751 262
104 3300053078 Ga0495612_0025445 Ga0495612_0025445_656_1462 262
105 3300005328 Ga0070676_10111861 Ga0070676_101118613 263
106 3300005330 Ga0070690_100114068 Ga0070690_1001140682 263
107 3300005339 Ga0070660_100199482 Ga0070660_1001994822 263
108 3300005340 Ga0070689_100175590 Ga0070689_1001755901 263
109 3300005343 Ga0070687_100037033 Ga0070687_1000370332 263
110 3300005353 Ga0070669_100099800 Ga0070669_1000998003 263
111 3300005355 Ga0070671_100162981 Ga0070671_1001629813 263
112 3300005364 Ga0070673_100179313 Ga0070673_1001793132 263
113 3300005544 Ga0070686_100174804 Ga0070686_1001748042 263
114 3300005617 Ga0068859_100275915 Ga0068859_1002759152 263
115 3300005618 Ga0068864_100034810 Ga0068864_1000348104 263
116 3300006178 Ga0075367_10051766 Ga0075367_100517664 263
117 3300006931 Ga0097620_100275914 Ga0097620_1002759142 263
118 3300009148 Ga0105243_10152120 Ga0105243_101521203 263
119 3300009177 Ga0105248_10031820 Ga0105248_100318202 263
120 3300013306 Ga0163162_10162917 Ga0163162_101629174 263
121 3300013308 Ga0157375_10617201 Ga0157375_106172012 263
122 3300025899 Ga0207642_10188977 Ga0207642_101889771 263
123 3300025907 Ga0207645_10155093 Ga0207645_101550932 263
124 3300025923 Ga0207681_10104272 Ga0207681_101042722 263
125 3300025931 Ga0207644_10261294 Ga0207644_102612942 263
126 3300025935 Ga0207709_10087185 Ga0207709_100871853 263
127 3300025936 Ga0207670_10050980 Ga0207670_100509802 263
128 3300025941 Ga0207711_10077384 Ga0207711_100773842 263
129 3300025960 Ga0207651_10061702 Ga0207651_100617025 263
130 3300025986 Ga0207658_10329457 Ga0207658_103294571 263
131 3300026095 Ga0207676_10037916 Ga0207676_100379166 263
132 3300035085 Ga0373929_0033021 Ga0373929_0033021_202_1062 263
133 3300035088 Ga0373940_0017830 Ga0373940_0017830_773_1663 263
134 3300035092 Ga0373952_0003651 Ga0373952_0003651_1832_2722 263
135 3300035121 Ga0373960_0054583 Ga0373960_0054583_43_933 263
136 3300035691 Ga0373931_0001311 Ga0373931_0001311_2087_2977 263
137 3300035691 Ga0373931_0030765 Ga0373931_0030765_1932_2732 263
138 3300046533 Ga0495640_0291602 Ga0495640_0291602_70_882 263
139 3300048904 Ga0496101_0147316 Ga0496101_0147316_226_1116 263
140 3300048910 Ga0496107_0174566 Ga0496107_0174566_224_1114 263
141 3300048913 Ga0496110_0041729 Ga0496110_0041729_787_1671 263
142 3300048916 Ga0496113_0374886 Ga0496113_0374886_209_1099 263
143 3300048917 Ga0496114_0312272 Ga0496114_0312272_189_989 263
144 3300050494 nmdc:mga06z11_30264_c1 nmdc:mga06z11_30264_c1_1083_1874 263
145 3300006038 Ga0075365_10026310 Ga0075365_100263104 264
146 3300006048 Ga0075363_100129725 Ga0075363_1001297252 264
147 3300006051 Ga0075364_10192367 Ga0075364_101923672 264
148 3300006178 Ga0075367_10039511 Ga0075367_100395111 264
149 3300006353 Ga0075370_10023085 Ga0075370_100230854 264
150 3300027866 Ga0209813_10008926 Ga0209813_100089263 264
151 3300046459 Ga0495629_0348914 Ga0495629_0348914_30_827 264
152 3300050495 nmdc:mga04h51_6484_c1 nmdc:mga04h51_6484_c1_676_1470 264
153 3300006177 Ga0075362_10137929 Ga0075362_101379291 265
154 3300005354 Ga0070675_100266472 Ga0070675_1002664721 266
155 3300005439 Ga0070711_100357744 Ga0070711_1003577441 266
156 3300025960 Ga0207651_10683804 Ga0207651_106838041 266
157 3300005328 Ga0070676_10112596 Ga0070676_101125962 267
158 3300005336 Ga0070680_100132564 Ga0070680_1001325642 267
159 3300005337 Ga0070682_100163989 Ga0070682_1001639891 267
160 3300005365 Ga0070688_100353218 Ga0070688_1003532181 267
161 3300005458 Ga0070681_10390514 Ga0070681_103905142 267
162 3300005530 Ga0070679_100021073 Ga0070679_1000210737 267
163 3300005547 Ga0070693_100050828 Ga0070693_1000508283 267
164 3300013308 Ga0157375_10524894 Ga0157375_105248943 267
165 3300025917 Ga0207660_10077884 Ga0207660_100778842 267
166 3300025921 Ga0207652_10109763 Ga0207652_101097632 267
167 3300031247 Ga0265340_10039317 Ga0265340_100393172 267
168 3300035113 Ga0373936_0000563 Ga0373936_0000563_2750_3565 267
169 3300035117 Ga0373953_0004303 Ga0373953_0004303_1315_2130 267
170 3300035118 Ga0373954_0012163 Ga0373954_0012163_1997_2812 267
171 3300035119 Ga0373956_0048727 Ga0373956_0048727_1014_1829 267
172 3300035171 Ga0373946_0012652 Ga0373946_0012652_1930_2745 267
173 3300035172 Ga0373955_0000595 Ga0373955_0000595_4648_5463 267
174 3300035410 Ga0373924_0010093 Ga0373924_0010093_2460_3275 267
175 3300035692 Ga0373935_0000012 Ga0373935_0000012_8109_8924 267
176 3300035695 Ga0373927_0024382 Ga0373927_0024382_2793_3608 267
177 3300035724 Ga0373933_0037383 Ga0373933_0037383_294_1109 267
178 3300035725 Ga0373947_0001331 Ga0373947_0001331_651_1466 267
179 3300035725 Ga0373947_0023685 Ga0373947_0023685_1595_2407 267
180 3300036401 Ga0373937_0000054 Ga0373937_0000054_58729_59544 267
181 3300037068 Ga0373925_0000018 Ga0373925_0000018_74674_75489 267
182 3300037068 Ga0373925_0036801 Ga0373925_0036801_588_1400 267
183 3300046454 Ga0495592_0000001 Ga0495592_0000001_132909_133724 267
184 3300046459 Ga0495629_0017573 Ga0495629_0017573_22_837 267
185 3300046462 Ga0495651_0011346 Ga0495651_0011346_2539_3354 267
186 3300046463 Ga0495653_0000015 Ga0495653_0000015_186665_187480 267
187 3300046476 Ga0495662_0003607 Ga0495662_0003607_6111_6926 267
188 3300046477 Ga0495664_0000001 Ga0495664_0000001_182637_183452 267
189 3300046499 Ga0495594_0154426 Ga0495594_0154426_132_947 267
190 3300046511 Ga0495608_0000050 Ga0495608_0000050_91214_92029 267
191 3300046514 Ga0495618_0000045 Ga0495618_0000045_20760_21575 267
192 3300046516 Ga0495628_0000003 Ga0495628_0000003_13694_14509 267
193 3300046529 Ga0495652_0000001 Ga0495652_0000001_643713_644528 267
194 3300046531 Ga0495665_0016372 Ga0495665_0016372_758_1573 267
195 3300046533 Ga0495640_0000006 Ga0495640_0000006_91349_92164 267
196 3300046536 Ga0495587_0000536 Ga0495587_0000536_13674_14489 267
197 3300046543 Ga0495645_0000004 Ga0495645_0000004_76143_76958 267
198 3300046559 Ga0495667_0000001 Ga0495667_0000001_483681_484496 267
199 3300046642 Ga0495634_0000751 Ga0495634_0000751_1412_2227 267
200 3300046663 Ga0495635_0000007 Ga0495635_0000007_207171_207986 267
201 3300046675 Ga0495657_0000136 Ga0495657_0000136_13686_14501 267
202 3300046678 Ga0495599_0000002 Ga0495599_0000002_274223_275038 267
203 3300046679 Ga0495623_0000052 Ga0495623_0000052_66711_67526 267
204 3300046680 Ga0495646_0000036 Ga0495646_0000036_13809_14624 267
205 3300046689 Ga0495613_0064796 Ga0495613_0064796_428_1243 267
206 3300046690 Ga0495624_0101732 Ga0495624_0101732_285_1100 267
207 3300046809 Ga0495600_0000037 Ga0495600_0000037_66543_67358 267
208 3300047315 Ga0495581_0002053 Ga0495581_0002053_2348_3163 267
209 3300047317 Ga0495604_0000007 Ga0495604_0000007_10763_11578 267
210 3300047319 Ga0495674_0000001 Ga0495674_0000001_382574_383389 267
211 3300047322 Ga0495680_0003271 Ga0495680_0003271_13788_14603 267
212 3300047444 Ga0495675_0000049 Ga0495675_0000049_13612_14427 267
213 3300047471 Ga0495684_0000046 Ga0495684_0000046_32737_33552 267
214 3300047673 Ga0495593_0003282 Ga0495593_0003282_1421_2236 267
215 3300048088 Ga0495602_0000102 Ga0495602_0000102_13731_14546 267
216 3300048089 Ga0495614_0151027 Ga0495614_0151027_98_913 267
217 3300048916 Ga0496113_0545528 Ga0496113_0545528_20_841 267
218 3300048917 Ga0496114_0383665 Ga0496114_0383665_269_1090 267
219 3300049568 Ga0501031_0066240 Ga0501031_0066240_1027_1830 267
220 3300049569 Ga0501032_0029317 Ga0501032_0029317_1945_2748 267
221 3300049570 Ga0501033_0068053 Ga0501033_0068053_501_1304 267
222 3300049571 Ga0501034_0071044 Ga0501034_0071044_1532_2335 267
223 3300049573 Ga0501037_0001340 Ga0501037_0001340_7666_8469 267
224 3300049574 Ga0501038_0001023 Ga0501038_0001023_22299_23102 267
225 3300049575 Ga0501039_0015388 Ga0501039_0015388_1141_1944 267
226 3300049579 Ga0501043_0025349 Ga0501043_0025349_727_1530 267
227 3300049580 Ga0501046_0008699 Ga0501046_0008699_5857_6660 267
228 3300049581 Ga0501047_0175597 Ga0501047_0175597_706_1509 267
229 3300049582 Ga0501048_0002666 Ga0501048_0002666_2193_2996 267
230 3300049583 Ga0501067_0009926 Ga0501067_0009926_2888_3691 267
231 3300049584 Ga0501068_0040935 Ga0501068_0040935_752_1555 267
232 3300049585 Ga0501069_0005453 Ga0501069_0005453_2191_2994 267
233 3300049586 Ga0501070_0025730 Ga0501070_0025730_513_1316 267
234 3300049586 Ga0501070_0530862 Ga0501070_0530862_32_835 267
235 3300049589 Ga0501073_0017253 Ga0501073_0017253_513_1316 267
236 3300049590 Ga0501074_0028651 Ga0501074_0028651_1316_2119 267
237 3300049592 Ga0501076_0077266 Ga0501076_0077266_710_1513 267
238 3300049741 Ga0501079_0211050 Ga0501079_0211050_534_1337 267
239 3300049742 Ga0501080_0167453 Ga0501080_0167453_852_1655 267
240 3300049743 Ga0501081_0541950 Ga0501081_0541950_31_849 267
241 3300049822 Ga0501035_0037796 Ga0501035_0037796_2035_2838 267
242 3300049823 Ga0501044_0008573 Ga0501044_0008573_1315_2118 267
243 3300049824 Ga0501045_0052887 Ga0501045_0052887_836_1639 267
244 3300050493 nmdc:mga0k408_14575_c1 nmdc:mga0k408_14575_c1_972_1775 267
245 3300050496 nmdc:mga07m45_69269_c2 nmdc:mga07m45_69269_c2_238_1041 267
246 3300053077 Ga0495601_0000006 Ga0495601_0000006_222624_223439 267
247 3300053078 Ga0495612_0000004 Ga0495612_0000004_91221_92036 267
248 3300053084 Ga0495595_0000006 Ga0495595_0000006_18667_19482 267
249 3300053085 Ga0495619_0000027 Ga0495619_0000027_13882_14697 267
250 3300053119 Ga0500595_023125 Ga0500595_023125_358_1161 267
251 3300053139 Ga0500568_0018056 Ga0500568_0018056_1549_2364 267
252 3300053153 Ga0500616_0025592 Ga0500616_0025592_2096_2911 267
253 3300054114 Ga0501084_0022734 Ga0501084_0022734_4203_5006 267
254 3300060353 Ga0501082_0007563 Ga0501082_0007563_5733_6536 267
255 3300003215 JGI25153J46596_10002574 JGI25153J46596_100025748 268
256 3300025297 Ga0209758_1000158 Ga0209758_100015821 268
257 3300031241 Ga0265325_10001191 Ga0265325_100011917 268
258 3300049571 Ga0501034_0074074 Ga0501034_0074074_241_1047 268
259 iso_pu_bacteria 2829745981 2829750382 268
260 3300006178 Ga0075367_10031401 Ga0075367_100314013 269
261 3300049823 Ga0501044_0000260 Ga0501044_0000260_49438_50316 273
262 3300002244 JGI24742J22300_10015875 JGI24742J22300_100158751 274
263 3300005329 Ga0070683_100213135 Ga0070683_1002131352 274
264 3300005356 Ga0070674_100023667 Ga0070674_1000236677 274
265 3300005456 Ga0070678_100467122 Ga0070678_1004671221 274
266 3300005618 Ga0068864_100129780 Ga0068864_1001297803 274
267 3300005718 Ga0068866_10198568 Ga0068866_101985681 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

45

253

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jfn-assembly1.cif.gz_A crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala 0.9119 4 265
2jfn-assembly1.cif.gz_A crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala 0.8888 4 265
3isv-assembly2.cif.gz_A crystal structure of glutamate racemase from listeria monocytogenes in complex with acetate ion 0.8476 4 264
3ist-assembly1.cif.gz_A crystal structure of glutamate racemase from listeria monocytogenes in complex with succinic acid 0.8395 3 265
2ohv-assembly1.cif.gz_A-2 structural basis for glutamate racemase inhibition 0.8391 1 267
ID Description Score Start End Superfamily
af_P22634_23_240_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9592 7 224 3.30.479.30
af_P22634_23_240_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9464 7 224 3.30.479.30
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9355 4 95 3.40.50.1860
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9258 4 95 3.40.50.1860
2jfnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9187 98 211 3.40.50.1860
ID Description Score Start End GO Terms
AF-A0A537TCZ6-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9877 4 261 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A537S0V6-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9847 10 260 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A1Q7BVA5-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9837 4 261 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A0Q6Z6Y3-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9818 1 262 GO:0008360
GO:0008881
GO:0009252
GO:0071555
AF-A0A6S6QPS2-F1-model_v4 Glutamate racemase (EC 5.1.1.3) 0.9808 1 266 GO:0008360
GO:0008881
GO:0009252
GO:0071555

Feature Viewer

pLDDT pTM Quality
91.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map