F374440

General Info

Members Datasets Scaffolds Average Seq Length
266 194 532 285

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954002825|2954006886
Length 314
Sequence VRCIAHNDGLTELGDHMDQAPGSPQGPQDAQSLPTCYRHPDRDTGIRCTRCERPICPECMVSASVGFQCPECVRNGSGTGHAPSATTPRTLAGGTITADPRLLTKILIGLNVALYVLQLSIGDHFTQRFELVGRAYYQEFGPLEGVAEGQWYRLLTSMFLHGSPMHIIFNMLSLWWIGGPLEAALGRARYLALYLVSGLAGSALTYLIAAPTSPSLGASGAIFGLFGATAVLMRRLKYDMRPILALLVINLLFTFGPLNIAWQAHIGGLVGGVVIGYAMVHAPRERRSLIQYGVCAVVLVAVVVMTLIRTSQLI

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
32 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
39 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
40 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
41 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
42 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
51 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
52 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
53 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
54 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
146 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
149 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
150 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
151 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
152 2643221647 Streptomyces sp. Root369 Isolate Unclassified
153 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
154 2643221714 Streptomyces sp. Root264 Isolate Unclassified
155 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
156 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
157 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
158 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
159 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
160 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
161 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
162 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
163 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
164 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
165 2862574272 Streptomyces sp. AcE210 Isolate Nodule
166 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
167 2867369537 Streptomyces sp. Z26 Isolate Unclassified
168 2867428634 Streptomyces sp. RP5T Isolate Unclassified
169 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
170 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
171 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
172 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
173 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
174 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
175 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
176 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
177 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
178 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
179 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
180 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
181 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
182 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
183 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
184 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
185 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
186 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
187 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
188 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
189 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
190 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
191 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
192 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
193 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
194 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.58
Metatranscriptomes 0.75
Isolates 17.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0.75
Rhizoplane 1.13
Rhizosphere 76.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007676 3300001989 Bacteria 4035
2 rootH1_10033155 3300003316 Bacteria 1395
3 Ga0006562J51391_1100324 3300003578 Bacteria 2797
4 Ga0006562J51391_1100326 3300003578 Bacteria 1270
5 Ga0068853_100502759 3300005539 Bacteria 1144
6 Ga0075368_10034110 3300006042 Bacteria 1982
7 Ga0075367_10001177 3300006178 Bacteria 10965
8 Ga0075370_10008194 3300006353 Bacteria 5363
9 Ga0105251_10104272 3300009011 Bacteria 1295
10 Ga0105245_10132419 3300009098 Bacteria 2340
11 Ga0105248_10209115 3300009177 Bacteria 2198
12 Ga0105246_10001055 3300011119 Bacteria 15889
13 Ga0157372_10012866 3300013307 Bacteria 8920
14 Ga0157375_10188279 3300013308 Bacteria 2218
15 Ga0182008_10001329 3300014497 Bacteria 16860
16 Ga0157376_10061157 3300014969 Bacteria 3165
17 Ga0182007_10005111 3300015262 Bacteria 5821
18 Ga0209758_1024197 3300025297 Bacteria 2714
19 Ga0207713_1034171 3300025735 Bacteria 2211
20 Ga0207647_10004704 3300025904 Bacteria 10106
21 Ga0207650_10139219 3300025925 Bacteria 1907
22 Ga0207687_10230149 3300025927 Bacteria 1464
23 Ga0207709_10049027 3300025935 Bacteria 2576
24 Ga0207639_10011131 3300026041 Bacteria 6240
25 Ga0209371_1006484 3300027312 Bacteria 4322
26 Ga0307517_10032187 3300028786 Bacteria 6070
27 Ga0307515_10013647 3300028794 Bacteria 15141
28 Ga0307515_10038760 3300028794 Bacteria 7607
29 Ga0268256_1007938 3300030500 Bacteria 3703
30 Ga0307511_10007827 3300030521 Bacteria 10730
31 Ga0307511_10037537 3300030521 Bacteria 4181
32 Ga0307511_10072906 3300030521 Bacteria 2489
33 Ga0307512_10003822 3300030522 Bacteria 16980
34 Ga0307512_10021730 3300030522 Bacteria 5780
35 Ga0307513_10010601 3300031456 Bacteria 11530
36 Ga0307513_10070794 3300031456 Bacteria 3643
37 Ga0307509_10084847 3300031507 Bacteria 3261
38 Ga0307509_10110387 3300031507 Bacteria 2756
39 Ga0307509_10205391 3300031507 Bacteria 1801
40 Ga0307508_10120855 3300031616 Bacteria 2222
41 Ga0307516_10202473 3300031730 Bacteria 1704
42 Ga0307518_10089284 3300031838 Bacteria 2219
43 Ga0307507_10008549 3300033179 Bacteria 14085
44 Ga0307507_10179590 3300033179 Bacteria 1516
45 Ga0307510_10037537 3300033180 Bacteria 5373
46 Ga0307510_10066073 3300033180 Bacteria 3655
47 Ga0307510_10079294 3300033180 Bacteria 3203
48 Ga0395898_0002467 3300037466 Bacteria 21817
49 Ga0439439_0037653 3300041406 Bacteria 1247
50 Ga0451797_1131988 3300041453 Bacteria 1445
51 Ga0451800_0619234 3300041459 Bacteria 1172
52 Ga0451802_2123982 3300041460 Bacteria 1275
53 Ga0451837_0633705 3300041494 Bacteria 2578
54 Ga0451853_0394180 3300041512 Bacteria 2934
55 Ga0451853_1767329 3300041512 Bacteria 9334
56 Ga0451853_2904788 3300041512 Bacteria 1857
57 Ga0439433_0006987 3300041999 Bacteria 2437
58 Ga0439442_010200 3300042002 Bacteria 1903
59 Ga0439448_0006197 3300042005 Bacteria 3433
60 Ga0439448_0052199 3300042005 Bacteria 1340
61 Ga0439432_020984 3300042006 Bacteria 2168
62 Ga0439449_0000236 3300042007 Bacteria 19915
63 Ga0439457_000228 3300042014 Bacteria 15000
64 Ga0450894_000527 3300042131 Bacteria 6490
65 Ga0450895_000918 3300042132 Bacteria 1900
66 Ga0450898_001086 3300042134 Bacteria 3460
67 Ga0450902_010376 3300042137 Bacteria 1472
68 Ga0450903_000558 3300042138 Bacteria 7689
69 Ga0439458_0000579 3300042157 Bacteria 9421
70 Ga0466969_0028557 3300044656 Bacteria 2851
71 Ga0466969_0045098 3300044656 Bacteria 2189
72 Ga0466972_0007379 3300044658 Bacteria 5524
73 Ga0466972_0013044 3300044658 Bacteria 4175
74 Ga0466972_0028615 3300044658 Bacteria 2748
75 Ga0466965_0000523 3300044683 Bacteria 13742
76 Ga0466965_0047877 3300044683 Bacteria 2117
77 Ga0466966_0010882 3300044684 Bacteria 6042
78 Ga0466966_0037261 3300044684 Bacteria 3137
79 Ga0466961_0013675 3300044693 Bacteria 5200
80 Ga0466963_0035510 3300044694 Bacteria 3248
81 Ga0466963_0037610 3300044694 Bacteria 3161
82 Ga0466964_0037571 3300044706 Bacteria 1945
83 Ga0466971_0000467 3300044719 Bacteria 15848
84 Ga0466971_0036377 3300044719 Bacteria 2208
85 Ga0466968_0018261 3300044735 Bacteria 2812
86 Ga0466970_0002390 3300044765 Bacteria 9067
87 Ga0466957_0004536 3300044842 Bacteria 7751
88 Ga0466959_0004853 3300045049 Bacteria 9091
89 Ga0466967_0025576 3300045976 Bacteria 4871
90 Ga0466967_0044256 3300045976 Bacteria 3860
91 Ga0495592_0003299 3300046454 Bacteria 11564
92 Ga0495603_0017048 3300046455 Bacteria 4397
93 Ga0495603_0042252 3300046455 Bacteria 2725
94 Ga0495603_0045948 3300046455 Bacteria 2603
95 Ga0495590_0053213 3300046457 Bacteria 1414
96 Ga0495629_0014731 3300046459 Bacteria 5624
97 Ga0495629_0030829 3300046459 Bacteria 3798
98 Ga0495629_0244721 3300046459 Bacteria 1234
99 Ga0495638_0024482 3300046460 Bacteria 3936
100 Ga0495638_0085741 3300046460 Bacteria 1904
101 Ga0495651_0000900 3300046462 Bacteria 23054
102 Ga0495582_0144650 3300046473 Bacteria 1348
103 Ga0495605_0207759 3300046474 Bacteria 851
104 Ga0495662_0013863 3300046476 Bacteria 3922
105 Ga0495662_0022302 3300046476 Bacteria 3058
106 Ga0495662_0046802 3300046476 Bacteria 2088
107 Ga0495662_0082917 3300046476 Bacteria 1560
108 Ga0495664_0004010 3300046477 Bacteria 8038
109 Ga0495664_0331900 3300046477 Bacteria 917
110 Ga0495585_0107521 3300046492 Bacteria 1486
111 Ga0495594_0048360 3300046499 Bacteria 2337
112 Ga0495594_0060225 3300046499 Bacteria 2099
113 Ga0495607_0100999 3300046501 Bacteria 1545
114 Ga0495583_0067026 3300046506 Bacteria 1586
115 Ga0495606_0056158 3300046507 Bacteria 2542
116 Ga0495610_0066499 3300046512 Bacteria 1697
117 Ga0495616_0084546 3300046513 Bacteria 1512
118 Ga0495620_0010114 3300046515 Bacteria 4987
119 Ga0495628_0081763 3300046516 Bacteria 2509
120 Ga0495628_0117974 3300046516 Bacteria 2037
121 Ga0495630_0242757 3300046517 Bacteria 1376
122 Ga0495631_0033609 3300046518 Bacteria 2302
123 Ga0495637_0037094 3300046520 Bacteria 2119
124 Ga0495643_0003627 3300046522 Bacteria 11219
125 Ga0495652_0006999 3300046529 Bacteria 10425
126 Ga0495665_0283417 3300046531 Bacteria 850
127 Ga0495586_0030689 3300046535 Bacteria 2877
128 Ga0495587_0000405 3300046536 Bacteria 30522
129 Ga0495645_0073288 3300046543 Bacteria 2467
130 Ga0495622_0067077 3300046557 Bacteria 1658
131 Ga0495667_0205853 3300046559 Bacteria 1258
132 Ga0495656_0071225 3300046615 Bacteria 1545
133 Ga0495634_0002661 3300046642 Bacteria 14689
134 Ga0495625_0004207 3300046660 Bacteria 13712
135 Ga0495625_0042659 3300046660 Bacteria 3295
136 Ga0495625_0125129 3300046660 Bacteria 1746
137 Ga0495635_0001909 3300046663 Bacteria 14159
138 Ga0495635_0114006 3300046663 Bacteria 1845
139 Ga0495588_0128921 3300046674 Bacteria 1334
140 Ga0495657_0037578 3300046675 Bacteria 3336
141 Ga0495657_0055070 3300046675 Bacteria 2655
142 Ga0495657_0236453 3300046675 Bacteria 1103
143 Ga0495599_0212503 3300046678 Bacteria 1185
144 Ga0495646_0001203 3300046680 Bacteria 15150
145 Ga0495613_0042199 3300046689 Bacteria 3376
146 Ga0495613_0046604 3300046689 Bacteria 3205
147 Ga0495613_0057283 3300046689 Bacteria 2861
148 Ga0495613_0232936 3300046689 Bacteria 1289
149 Ga0495624_0155851 3300046690 Bacteria 1396
150 Ga0495624_0252072 3300046690 Bacteria 1067
151 Ga0495671_0010533 3300046692 Bacteria 5115
152 Ga0495649_0043417 3300046694 Bacteria 2454
153 Ga0495649_0126901 3300046694 Bacteria 1347
154 Ga0495589_0009675 3300046794 Bacteria 5009
155 Ga0495589_0021267 3300046794 Bacteria 3315
156 Ga0495600_0014972 3300046809 Bacteria 4896
157 Ga0495600_0033228 3300046809 Bacteria 3349
158 Ga0495581_0019451 3300047315 Bacteria 3941
159 Ga0495604_0016372 3300047317 Bacteria 5927
160 Ga0495636_0036133 3300047318 Bacteria 2036
161 Ga0495636_0066597 3300047318 Bacteria 1531
162 Ga0495636_0127986 3300047318 Bacteria 1128
163 Ga0495674_0122487 3300047319 Bacteria 2196
164 Ga0495676_0013140 3300047321 Bacteria 7447
165 Ga0495676_0047358 3300047321 Bacteria 3476
166 Ga0495676_0107354 3300047321 Bacteria 2055
167 Ga0495687_031015 3300047443 Bacteria 2456
168 Ga0495687_033509 3300047443 Bacteria 2328
169 Ga0495687_100489 3300047443 Bacteria 1086
170 Ga0495675_0179270 3300047444 Bacteria 1298
171 Ga0495685_001254 3300047447 Bacteria 7766
172 Ga0495685_001565 3300047447 Bacteria 7041
173 Ga0495681_0002779 3300047470 Bacteria 12384
174 Ga0495681_0148271 3300047470 Bacteria 986
175 Ga0495684_0026468 3300047471 Bacteria 4459
176 Ga0495684_0211752 3300047471 Bacteria 1425
177 Ga0495686_0117262 3300047472 Bacteria 1591
178 Ga0495593_0007340 3300047673 Bacteria 6455
179 Ga0495614_0027590 3300048089 Bacteria 2447
180 Ga0495614_0059531 3300048089 Bacteria 1640
181 Ga0501032_0038438 3300049569 Bacteria 3259
182 Ga0501033_0001943 3300049570 Bacteria 17996
183 Ga0501033_0007566 3300049570 Bacteria 8451
184 Ga0501033_0008815 3300049570 Bacteria 7795
185 Ga0501033_0055913 3300049570 Bacteria 2917
186 Ga0501034_0008050 3300049571 Bacteria 11188
187 Ga0501034_0009031 3300049571 Bacteria 10466
188 Ga0501034_0271920 3300049571 Bacteria 1635
189 Ga0501036_0000606 3300049572 Bacteria 26021
190 Ga0501036_0022089 3300049572 Bacteria 5352
191 Ga0501036_0338471 3300049572 Bacteria 1257
192 Ga0501038_0001743 3300049574 Bacteria 20226
193 Ga0501038_0077160 3300049574 Bacteria 2813
194 Ga0501039_0002299 3300049575 Bacteria 14180
195 Ga0501042_0016108 3300049578 Bacteria 5130
196 Ga0501043_0005014 3300049579 Bacteria 10718
197 Ga0501043_0031680 3300049579 Bacteria 4156
198 Ga0501046_0025232 3300049580 Bacteria 4865
199 Ga0501047_0023728 3300049581 Bacteria 5888
200 Ga0501047_0049940 3300049581 Bacteria 4039
201 Ga0501047_0305545 3300049581 Bacteria 1432
202 Ga0501048_0011955 3300049582 Bacteria 6471
203 Ga0501070_0015186 3300049586 Bacteria 6482
204 Ga0501074_0000971 3300049590 Bacteria 18563
205 Ga0501035_0000852 3300049822 Bacteria 32539
206 Ga0501035_0033535 3300049822 Bacteria 4669
207 Ga0501035_0161651 3300049822 Bacteria 1938
208 Ga0501035_0167296 3300049822 Bacteria 1901
209 Ga0501044_0022694 3300049823 Bacteria 6683
210 Ga0501044_0079120 3300049823 Bacteria 3331
211 nmdc:mga03n38_16778_c1 3300050490 Bacteria 2856
212 nmdc:mga03n38_63121_c1 3300050490 Bacteria 1692
213 nmdc:mga06z11_586_c1 3300050494 Bacteria 13318
214 Ga0495619_0104104 3300053085 Bacteria 1934
215 Ga0500644_0035184 3300053088 Bacteria 1621
216 Ga0500640_014614 3300053095 Bacteria 3272
217 Ga0500600_0060047 3300053149 Bacteria 2123
218 Ga0466962_0002527 3300061719 Bacteria 8686
219 Ga0466962_0131312 3300061719 Bacteria 1210
220 2954006886 2954002825 Bacteria 9173742
221 2585305708 2582581313 Bacteria 10042643
222 2585314602 2582581314 Bacteria 11452267
223 2616702100 2616644814 Bacteria 11555299
224 2644262832 2643221647 Bacteria 10741251
225 2644443036 2643221678 Bacteria 9540101
226 2644627152 2643221714 Bacteria 9015452
227 2785342773 2784746763 Bacteria 9783172
228 2785370029 2784746768 Bacteria 10036182
229 2786671102 2786546132 Bacteria 10419719
230 2808842540 2808606359 Bacteria 9866990
231 2808921047 2808606375 Bacteria 9466072
232 2812357576 2811994879 Bacteria 9313447
233 2812480096 2811994917 Bacteria 7761064
234 2852637347 2852635781 Bacteria 8251373
235 2862286131 2862281513 Bacteria 9621493
236 2862389688 2862382967 Bacteria 10317375
237 2862578786 2862574272 Bacteria 10567477
238 2863412664 2863404153 Bacteria 9672205
239 2867372417 2867369537 Bacteria 6501581
240 2867430578 2867428634 Bacteria 9590268
241 2873155276 2873151551 Bacteria 8625867
242 2877680595 2877676314 Bacteria 9512378
243 2912719301 2912715099 Bacteria 9460473
244 2919471804 2919468124 Bacteria 9133025
245 2946068278 2946064051 Bacteria 8957905
246 2946076420 2946072368 Bacteria 8999607
247 2947228643 2947224130 Bacteria 9938529
248 2954385722 2954380949 Bacteria 10050426
249 2954677433 2954673503 Bacteria 9685905
250 2954686721 2954682443 Bacteria 9862841
251 2954696369 2954691527 Bacteria 10720516
252 2954705908 2954701450 Bacteria 10834262
253 2954715726 2954711539 Bacteria 10867210
254 2954725664 2954721474 Bacteria 10456478
255 2954736148 2954731030 Bacteria 10243860
256 2954744603 2954740390 Bacteria 10229294
257 2954754996 2954749733 Bacteria 10366972
258 2954763585 2954759201 Bacteria 9358192
259 2990061576 2990059506 Bacteria 9321252
260 2990091486 2990088156 Bacteria 6657676
261 3006425793 3006425503 Bacteria 6491253
262 3006499457 3006493962 Bacteria 8825450
263 8008578457 8008574985 Bacteria 7815457
264 8033689040 8033684223 Bacteria 6906479
265 8048410275 8048406513 Bacteria 8936924
266 8056837990 8056829672 Bacteria 9045328
267 JGI24739J22299_10007676
268 rootH1_10033155
269 Ga0006562J51391_1100324
270 Ga0006562J51391_1100326
271 Ga0068853_100502759
272 Ga0075368_10034110
273 Ga0075367_10001177
274 Ga0075370_10008194
275 Ga0105251_10104272
276 Ga0105245_10132419
277 Ga0105248_10209115
278 Ga0105246_10001055
279 Ga0157372_10012866
280 Ga0157375_10188279
281 Ga0182008_10001329
282 Ga0157376_10061157
283 Ga0182007_10005111
284 Ga0209758_1024197
285 Ga0207713_1034171
286 Ga0207647_10004704
287 Ga0207650_10139219
288 Ga0207687_10230149
289 Ga0207709_10049027
290 Ga0207639_10011131
291 Ga0209371_1006484
292 Ga0307517_10032187
293 Ga0307515_10013647
294 Ga0307515_10038760
295 Ga0268256_1007938
296 Ga0307511_10007827
297 Ga0307511_10037537
298 Ga0307511_10072906
299 Ga0307512_10003822
300 Ga0307512_10021730
301 Ga0307513_10010601
302 Ga0307513_10070794
303 Ga0307509_10084847
304 Ga0307509_10110387
305 Ga0307509_10205391
306 Ga0307508_10120855
307 Ga0307516_10202473
308 Ga0307518_10089284
309 Ga0307507_10008549
310 Ga0307507_10179590
311 Ga0307510_10037537
312 Ga0307510_10066073
313 Ga0307510_10079294
314 Ga0395898_0002467
315 Ga0439439_0037653
316 Ga0451797_1131988
317 Ga0451800_0619234
318 Ga0451802_2123982
319 Ga0451837_0633705
320 Ga0451853_0394180
321 Ga0451853_1767329
322 Ga0451853_2904788
323 Ga0439433_0006987
324 Ga0439442_010200
325 Ga0439448_0006197
326 Ga0439448_0052199
327 Ga0439432_020984
328 Ga0439449_0000236
329 Ga0439457_000228
330 Ga0450894_000527
331 Ga0450895_000918
332 Ga0450898_001086
333 Ga0450902_010376
334 Ga0450903_000558
335 Ga0439458_0000579
336 Ga0466969_0028557
337 Ga0466969_0045098
338 Ga0466972_0007379
339 Ga0466972_0013044
340 Ga0466972_0028615
341 Ga0466965_0000523
342 Ga0466965_0047877
343 Ga0466966_0010882
344 Ga0466966_0037261
345 Ga0466961_0013675
346 Ga0466963_0035510
347 Ga0466963_0037610
348 Ga0466964_0037571
349 Ga0466971_0000467
350 Ga0466971_0036377
351 Ga0466968_0018261
352 Ga0466970_0002390
353 Ga0466957_0004536
354 Ga0466959_0004853
355 Ga0466967_0025576
356 Ga0466967_0044256
357 Ga0495592_0003299
358 Ga0495603_0017048
359 Ga0495603_0042252
360 Ga0495603_0045948
361 Ga0495590_0053213
362 Ga0495629_0014731
363 Ga0495629_0030829
364 Ga0495629_0244721
365 Ga0495638_0024482
366 Ga0495638_0085741
367 Ga0495651_0000900
368 Ga0495582_0144650
369 Ga0495605_0207759
370 Ga0495662_0013863
371 Ga0495662_0022302
372 Ga0495662_0046802
373 Ga0495662_0082917
374 Ga0495664_0004010
375 Ga0495664_0331900
376 Ga0495585_0107521
377 Ga0495594_0048360
378 Ga0495594_0060225
379 Ga0495607_0100999
380 Ga0495583_0067026
381 Ga0495606_0056158
382 Ga0495610_0066499
383 Ga0495616_0084546
384 Ga0495620_0010114
385 Ga0495628_0081763
386 Ga0495628_0117974
387 Ga0495630_0242757
388 Ga0495631_0033609
389 Ga0495637_0037094
390 Ga0495643_0003627
391 Ga0495652_0006999
392 Ga0495665_0283417
393 Ga0495586_0030689
394 Ga0495587_0000405
395 Ga0495645_0073288
396 Ga0495622_0067077
397 Ga0495667_0205853
398 Ga0495656_0071225
399 Ga0495634_0002661
400 Ga0495625_0004207
401 Ga0495625_0042659
402 Ga0495625_0125129
403 Ga0495635_0001909
404 Ga0495635_0114006
405 Ga0495588_0128921
406 Ga0495657_0037578
407 Ga0495657_0055070
408 Ga0495657_0236453
409 Ga0495599_0212503
410 Ga0495646_0001203
411 Ga0495613_0042199
412 Ga0495613_0046604
413 Ga0495613_0057283
414 Ga0495613_0232936
415 Ga0495624_0155851
416 Ga0495624_0252072
417 Ga0495671_0010533
418 Ga0495649_0043417
419 Ga0495649_0126901
420 Ga0495589_0009675
421 Ga0495589_0021267
422 Ga0495600_0014972
423 Ga0495600_0033228
424 Ga0495581_0019451
425 Ga0495604_0016372
426 Ga0495636_0036133
427 Ga0495636_0066597
428 Ga0495636_0127986
429 Ga0495674_0122487
430 Ga0495676_0013140
431 Ga0495676_0047358
432 Ga0495676_0107354
433 Ga0495687_031015
434 Ga0495687_033509
435 Ga0495687_100489
436 Ga0495675_0179270
437 Ga0495685_001254
438 Ga0495685_001565
439 Ga0495681_0002779
440 Ga0495681_0148271
441 Ga0495684_0026468
442 Ga0495684_0211752
443 Ga0495686_0117262
444 Ga0495593_0007340
445 Ga0495614_0027590
446 Ga0495614_0059531
447 Ga0501032_0038438
448 Ga0501033_0001943
449 Ga0501033_0007566
450 Ga0501033_0008815
451 Ga0501033_0055913
452 Ga0501034_0008050
453 Ga0501034_0009031
454 Ga0501034_0271920
455 Ga0501036_0000606
456 Ga0501036_0022089
457 Ga0501036_0338471
458 Ga0501038_0001743
459 Ga0501038_0077160
460 Ga0501039_0002299
461 Ga0501042_0016108
462 Ga0501043_0005014
463 Ga0501043_0031680
464 Ga0501046_0025232
465 Ga0501047_0023728
466 Ga0501047_0049940
467 Ga0501047_0305545
468 Ga0501048_0011955
469 Ga0501070_0015186
470 Ga0501074_0000971
471 Ga0501035_0000852
472 Ga0501035_0033535
473 Ga0501035_0161651
474 Ga0501035_0167296
475 Ga0501044_0022694
476 Ga0501044_0079120
477 nmdc:mga03n38_16778_c1
478 nmdc:mga03n38_63121_c1
479 nmdc:mga06z11_586_c1
480 Ga0495619_0104104
481 Ga0500644_0035184
482 Ga0500640_014614
483 Ga0500600_0060047
484 Ga0466962_0002527
485 Ga0466962_0131312
486 2954006886
487 2585305708
488 2585314602
489 2616702100
490 2644262832
491 2644443036
492 2644627152
493 2785342773
494 2785370029
495 2786671102
496 2808842540
497 2808921047
498 2812357576
499 2812480096
500 2852637347
501 2862286131
502 2862389688
503 2862578786
504 2863412664
505 2867372417
506 2867430578
507 2873155276
508 2877680595
509 2912719301
510 2919471804
511 2946068278
512 2946076420
513 2947228643
514 2954385722
515 2954677433
516 2954686721
517 2954696369
518 2954705908
519 2954715726
520 2954725664
521 2954736148
522 2954744603
523 2954754996
524 2954763585
525 2990061576
526 2990091486
527 3006425793
528 3006499457
529 8008578457
530 8033689040
531 8048410275
532 8056837990

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

148

282

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3odj-assembly1.cif.gz_A crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 0.8402 92 265
6pja-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.8364 93 265
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.8259 92 265
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.825 93 265
5f5d-assembly1.cif.gz_A crystal structures and inhibition kinetics reveal a two-state catalytic mechanism with drug design implications for rhomboid proteolysis 0.8078 93 271
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.9522 86 269 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.9311 86 269 1.20.1540.10
af_H2KML1_907_1063_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8749 139 264 1.20.1540.10
af_Q67UY4_137_320_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8662 85 271 1.20.1540.10
af_A0A1D8PFE0_278_452_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8649 139 271 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A6J6U758-F1-model_v4 Unannotated protein 0.9442 92 270 GO:0004252
GO:0006508
GO:0016020
AF-A0A6G3D5I1-F1-model_v4 Rhomboid family intramembrane serine protease 0.9437 77 293 GO:0004252
GO:0006508
GO:0016020
AF-A0A6A0BIT8-F1-model_v4 deleted 0.9425 76 293
AF-A0A0R2PBG8-F1-model_v4 Peptidase S54 rhomboid domain-containing protein 0.9411 111 270 GO:0004252
GO:0006508
GO:0016020
AF-A0A6J6VDH4-F1-model_v4 Unannotated protein 0.9335 92 265 GO:0004252
GO:0006508
GO:0016020

Map