F374440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 194 | 532 | 285 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2954002825|2954006886 |
| Length | 314 |
| Sequence | VRCIAHNDGLTELGDHMDQAPGSPQGPQDAQSLPTCYRHPDRDTGIRCTRCERPICPECMVSASVGFQCPECVRNGSGTGHAPSATTPRTLAGGTITADPRLLTKILIGLNVALYVLQLSIGDHFTQRFELVGRAYYQEFGPLEGVAEGQWYRLLTSMFLHGSPMHIIFNMLSLWWIGGPLEAALGRARYLALYLVSGLAGSALTYLIAAPTSPSLGASGAIFGLFGATAVLMRRLKYDMRPILALLVINLLFTFGPLNIAWQAHIGGLVGGVVIGYAMVHAPRERRSLIQYGVCAVVLVAVVVMTLIRTSQLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 5 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 6 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 7 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 8 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 9 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 10 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 11 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 12 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 13 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 14 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 15 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 16 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 17 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 18 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 26 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 27 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 28 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 29 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 30 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 31 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 32 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 33 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 34 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 35 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 36 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 37 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 38 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 39 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 40 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 41 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 42 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 43 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 44 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 45 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 46 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 47 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 48 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 49 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 50 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 51 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 52 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 53 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 54 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 55 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 56 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 57 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 58 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 59 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 60 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 61 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 62 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 63 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 64 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 65 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 66 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 67 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 68 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 69 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 142 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 143 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 145 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 146 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 147 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 148 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 149 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 150 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 151 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 152 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 153 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 154 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 155 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 156 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 157 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 158 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 159 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 160 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 161 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 162 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 163 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 164 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 165 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 166 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 167 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 168 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 169 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 170 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 171 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 172 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 173 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 174 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 175 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 176 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 177 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 178 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 179 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 180 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 181 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 182 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 183 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 184 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 185 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 186 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 187 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 188 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 189 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 190 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 191 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 192 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 193 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 194 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.58 |
| Metatranscriptomes | 0.75 |
| Isolates | 17.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 0.75 |
| Rhizoplane | 1.13 |
| Rhizosphere | 76.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10007676 | 3300001989 | Bacteria | 4035 |
| 2 | rootH1_10033155 | 3300003316 | Bacteria | 1395 |
| 3 | Ga0006562J51391_1100324 | 3300003578 | Bacteria | 2797 |
| 4 | Ga0006562J51391_1100326 | 3300003578 | Bacteria | 1270 |
| 5 | Ga0068853_100502759 | 3300005539 | Bacteria | 1144 |
| 6 | Ga0075368_10034110 | 3300006042 | Bacteria | 1982 |
| 7 | Ga0075367_10001177 | 3300006178 | Bacteria | 10965 |
| 8 | Ga0075370_10008194 | 3300006353 | Bacteria | 5363 |
| 9 | Ga0105251_10104272 | 3300009011 | Bacteria | 1295 |
| 10 | Ga0105245_10132419 | 3300009098 | Bacteria | 2340 |
| 11 | Ga0105248_10209115 | 3300009177 | Bacteria | 2198 |
| 12 | Ga0105246_10001055 | 3300011119 | Bacteria | 15889 |
| 13 | Ga0157372_10012866 | 3300013307 | Bacteria | 8920 |
| 14 | Ga0157375_10188279 | 3300013308 | Bacteria | 2218 |
| 15 | Ga0182008_10001329 | 3300014497 | Bacteria | 16860 |
| 16 | Ga0157376_10061157 | 3300014969 | Bacteria | 3165 |
| 17 | Ga0182007_10005111 | 3300015262 | Bacteria | 5821 |
| 18 | Ga0209758_1024197 | 3300025297 | Bacteria | 2714 |
| 19 | Ga0207713_1034171 | 3300025735 | Bacteria | 2211 |
| 20 | Ga0207647_10004704 | 3300025904 | Bacteria | 10106 |
| 21 | Ga0207650_10139219 | 3300025925 | Bacteria | 1907 |
| 22 | Ga0207687_10230149 | 3300025927 | Bacteria | 1464 |
| 23 | Ga0207709_10049027 | 3300025935 | Bacteria | 2576 |
| 24 | Ga0207639_10011131 | 3300026041 | Bacteria | 6240 |
| 25 | Ga0209371_1006484 | 3300027312 | Bacteria | 4322 |
| 26 | Ga0307517_10032187 | 3300028786 | Bacteria | 6070 |
| 27 | Ga0307515_10013647 | 3300028794 | Bacteria | 15141 |
| 28 | Ga0307515_10038760 | 3300028794 | Bacteria | 7607 |
| 29 | Ga0268256_1007938 | 3300030500 | Bacteria | 3703 |
| 30 | Ga0307511_10007827 | 3300030521 | Bacteria | 10730 |
| 31 | Ga0307511_10037537 | 3300030521 | Bacteria | 4181 |
| 32 | Ga0307511_10072906 | 3300030521 | Bacteria | 2489 |
| 33 | Ga0307512_10003822 | 3300030522 | Bacteria | 16980 |
| 34 | Ga0307512_10021730 | 3300030522 | Bacteria | 5780 |
| 35 | Ga0307513_10010601 | 3300031456 | Bacteria | 11530 |
| 36 | Ga0307513_10070794 | 3300031456 | Bacteria | 3643 |
| 37 | Ga0307509_10084847 | 3300031507 | Bacteria | 3261 |
| 38 | Ga0307509_10110387 | 3300031507 | Bacteria | 2756 |
| 39 | Ga0307509_10205391 | 3300031507 | Bacteria | 1801 |
| 40 | Ga0307508_10120855 | 3300031616 | Bacteria | 2222 |
| 41 | Ga0307516_10202473 | 3300031730 | Bacteria | 1704 |
| 42 | Ga0307518_10089284 | 3300031838 | Bacteria | 2219 |
| 43 | Ga0307507_10008549 | 3300033179 | Bacteria | 14085 |
| 44 | Ga0307507_10179590 | 3300033179 | Bacteria | 1516 |
| 45 | Ga0307510_10037537 | 3300033180 | Bacteria | 5373 |
| 46 | Ga0307510_10066073 | 3300033180 | Bacteria | 3655 |
| 47 | Ga0307510_10079294 | 3300033180 | Bacteria | 3203 |
| 48 | Ga0395898_0002467 | 3300037466 | Bacteria | 21817 |
| 49 | Ga0439439_0037653 | 3300041406 | Bacteria | 1247 |
| 50 | Ga0451797_1131988 | 3300041453 | Bacteria | 1445 |
| 51 | Ga0451800_0619234 | 3300041459 | Bacteria | 1172 |
| 52 | Ga0451802_2123982 | 3300041460 | Bacteria | 1275 |
| 53 | Ga0451837_0633705 | 3300041494 | Bacteria | 2578 |
| 54 | Ga0451853_0394180 | 3300041512 | Bacteria | 2934 |
| 55 | Ga0451853_1767329 | 3300041512 | Bacteria | 9334 |
| 56 | Ga0451853_2904788 | 3300041512 | Bacteria | 1857 |
| 57 | Ga0439433_0006987 | 3300041999 | Bacteria | 2437 |
| 58 | Ga0439442_010200 | 3300042002 | Bacteria | 1903 |
| 59 | Ga0439448_0006197 | 3300042005 | Bacteria | 3433 |
| 60 | Ga0439448_0052199 | 3300042005 | Bacteria | 1340 |
| 61 | Ga0439432_020984 | 3300042006 | Bacteria | 2168 |
| 62 | Ga0439449_0000236 | 3300042007 | Bacteria | 19915 |
| 63 | Ga0439457_000228 | 3300042014 | Bacteria | 15000 |
| 64 | Ga0450894_000527 | 3300042131 | Bacteria | 6490 |
| 65 | Ga0450895_000918 | 3300042132 | Bacteria | 1900 |
| 66 | Ga0450898_001086 | 3300042134 | Bacteria | 3460 |
| 67 | Ga0450902_010376 | 3300042137 | Bacteria | 1472 |
| 68 | Ga0450903_000558 | 3300042138 | Bacteria | 7689 |
| 69 | Ga0439458_0000579 | 3300042157 | Bacteria | 9421 |
| 70 | Ga0466969_0028557 | 3300044656 | Bacteria | 2851 |
| 71 | Ga0466969_0045098 | 3300044656 | Bacteria | 2189 |
| 72 | Ga0466972_0007379 | 3300044658 | Bacteria | 5524 |
| 73 | Ga0466972_0013044 | 3300044658 | Bacteria | 4175 |
| 74 | Ga0466972_0028615 | 3300044658 | Bacteria | 2748 |
| 75 | Ga0466965_0000523 | 3300044683 | Bacteria | 13742 |
| 76 | Ga0466965_0047877 | 3300044683 | Bacteria | 2117 |
| 77 | Ga0466966_0010882 | 3300044684 | Bacteria | 6042 |
| 78 | Ga0466966_0037261 | 3300044684 | Bacteria | 3137 |
| 79 | Ga0466961_0013675 | 3300044693 | Bacteria | 5200 |
| 80 | Ga0466963_0035510 | 3300044694 | Bacteria | 3248 |
| 81 | Ga0466963_0037610 | 3300044694 | Bacteria | 3161 |
| 82 | Ga0466964_0037571 | 3300044706 | Bacteria | 1945 |
| 83 | Ga0466971_0000467 | 3300044719 | Bacteria | 15848 |
| 84 | Ga0466971_0036377 | 3300044719 | Bacteria | 2208 |
| 85 | Ga0466968_0018261 | 3300044735 | Bacteria | 2812 |
| 86 | Ga0466970_0002390 | 3300044765 | Bacteria | 9067 |
| 87 | Ga0466957_0004536 | 3300044842 | Bacteria | 7751 |
| 88 | Ga0466959_0004853 | 3300045049 | Bacteria | 9091 |
| 89 | Ga0466967_0025576 | 3300045976 | Bacteria | 4871 |
| 90 | Ga0466967_0044256 | 3300045976 | Bacteria | 3860 |
| 91 | Ga0495592_0003299 | 3300046454 | Bacteria | 11564 |
| 92 | Ga0495603_0017048 | 3300046455 | Bacteria | 4397 |
| 93 | Ga0495603_0042252 | 3300046455 | Bacteria | 2725 |
| 94 | Ga0495603_0045948 | 3300046455 | Bacteria | 2603 |
| 95 | Ga0495590_0053213 | 3300046457 | Bacteria | 1414 |
| 96 | Ga0495629_0014731 | 3300046459 | Bacteria | 5624 |
| 97 | Ga0495629_0030829 | 3300046459 | Bacteria | 3798 |
| 98 | Ga0495629_0244721 | 3300046459 | Bacteria | 1234 |
| 99 | Ga0495638_0024482 | 3300046460 | Bacteria | 3936 |
| 100 | Ga0495638_0085741 | 3300046460 | Bacteria | 1904 |
| 101 | Ga0495651_0000900 | 3300046462 | Bacteria | 23054 |
| 102 | Ga0495582_0144650 | 3300046473 | Bacteria | 1348 |
| 103 | Ga0495605_0207759 | 3300046474 | Bacteria | 851 |
| 104 | Ga0495662_0013863 | 3300046476 | Bacteria | 3922 |
| 105 | Ga0495662_0022302 | 3300046476 | Bacteria | 3058 |
| 106 | Ga0495662_0046802 | 3300046476 | Bacteria | 2088 |
| 107 | Ga0495662_0082917 | 3300046476 | Bacteria | 1560 |
| 108 | Ga0495664_0004010 | 3300046477 | Bacteria | 8038 |
| 109 | Ga0495664_0331900 | 3300046477 | Bacteria | 917 |
| 110 | Ga0495585_0107521 | 3300046492 | Bacteria | 1486 |
| 111 | Ga0495594_0048360 | 3300046499 | Bacteria | 2337 |
| 112 | Ga0495594_0060225 | 3300046499 | Bacteria | 2099 |
| 113 | Ga0495607_0100999 | 3300046501 | Bacteria | 1545 |
| 114 | Ga0495583_0067026 | 3300046506 | Bacteria | 1586 |
| 115 | Ga0495606_0056158 | 3300046507 | Bacteria | 2542 |
| 116 | Ga0495610_0066499 | 3300046512 | Bacteria | 1697 |
| 117 | Ga0495616_0084546 | 3300046513 | Bacteria | 1512 |
| 118 | Ga0495620_0010114 | 3300046515 | Bacteria | 4987 |
| 119 | Ga0495628_0081763 | 3300046516 | Bacteria | 2509 |
| 120 | Ga0495628_0117974 | 3300046516 | Bacteria | 2037 |
| 121 | Ga0495630_0242757 | 3300046517 | Bacteria | 1376 |
| 122 | Ga0495631_0033609 | 3300046518 | Bacteria | 2302 |
| 123 | Ga0495637_0037094 | 3300046520 | Bacteria | 2119 |
| 124 | Ga0495643_0003627 | 3300046522 | Bacteria | 11219 |
| 125 | Ga0495652_0006999 | 3300046529 | Bacteria | 10425 |
| 126 | Ga0495665_0283417 | 3300046531 | Bacteria | 850 |
| 127 | Ga0495586_0030689 | 3300046535 | Bacteria | 2877 |
| 128 | Ga0495587_0000405 | 3300046536 | Bacteria | 30522 |
| 129 | Ga0495645_0073288 | 3300046543 | Bacteria | 2467 |
| 130 | Ga0495622_0067077 | 3300046557 | Bacteria | 1658 |
| 131 | Ga0495667_0205853 | 3300046559 | Bacteria | 1258 |
| 132 | Ga0495656_0071225 | 3300046615 | Bacteria | 1545 |
| 133 | Ga0495634_0002661 | 3300046642 | Bacteria | 14689 |
| 134 | Ga0495625_0004207 | 3300046660 | Bacteria | 13712 |
| 135 | Ga0495625_0042659 | 3300046660 | Bacteria | 3295 |
| 136 | Ga0495625_0125129 | 3300046660 | Bacteria | 1746 |
| 137 | Ga0495635_0001909 | 3300046663 | Bacteria | 14159 |
| 138 | Ga0495635_0114006 | 3300046663 | Bacteria | 1845 |
| 139 | Ga0495588_0128921 | 3300046674 | Bacteria | 1334 |
| 140 | Ga0495657_0037578 | 3300046675 | Bacteria | 3336 |
| 141 | Ga0495657_0055070 | 3300046675 | Bacteria | 2655 |
| 142 | Ga0495657_0236453 | 3300046675 | Bacteria | 1103 |
| 143 | Ga0495599_0212503 | 3300046678 | Bacteria | 1185 |
| 144 | Ga0495646_0001203 | 3300046680 | Bacteria | 15150 |
| 145 | Ga0495613_0042199 | 3300046689 | Bacteria | 3376 |
| 146 | Ga0495613_0046604 | 3300046689 | Bacteria | 3205 |
| 147 | Ga0495613_0057283 | 3300046689 | Bacteria | 2861 |
| 148 | Ga0495613_0232936 | 3300046689 | Bacteria | 1289 |
| 149 | Ga0495624_0155851 | 3300046690 | Bacteria | 1396 |
| 150 | Ga0495624_0252072 | 3300046690 | Bacteria | 1067 |
| 151 | Ga0495671_0010533 | 3300046692 | Bacteria | 5115 |
| 152 | Ga0495649_0043417 | 3300046694 | Bacteria | 2454 |
| 153 | Ga0495649_0126901 | 3300046694 | Bacteria | 1347 |
| 154 | Ga0495589_0009675 | 3300046794 | Bacteria | 5009 |
| 155 | Ga0495589_0021267 | 3300046794 | Bacteria | 3315 |
| 156 | Ga0495600_0014972 | 3300046809 | Bacteria | 4896 |
| 157 | Ga0495600_0033228 | 3300046809 | Bacteria | 3349 |
| 158 | Ga0495581_0019451 | 3300047315 | Bacteria | 3941 |
| 159 | Ga0495604_0016372 | 3300047317 | Bacteria | 5927 |
| 160 | Ga0495636_0036133 | 3300047318 | Bacteria | 2036 |
| 161 | Ga0495636_0066597 | 3300047318 | Bacteria | 1531 |
| 162 | Ga0495636_0127986 | 3300047318 | Bacteria | 1128 |
| 163 | Ga0495674_0122487 | 3300047319 | Bacteria | 2196 |
| 164 | Ga0495676_0013140 | 3300047321 | Bacteria | 7447 |
| 165 | Ga0495676_0047358 | 3300047321 | Bacteria | 3476 |
| 166 | Ga0495676_0107354 | 3300047321 | Bacteria | 2055 |
| 167 | Ga0495687_031015 | 3300047443 | Bacteria | 2456 |
| 168 | Ga0495687_033509 | 3300047443 | Bacteria | 2328 |
| 169 | Ga0495687_100489 | 3300047443 | Bacteria | 1086 |
| 170 | Ga0495675_0179270 | 3300047444 | Bacteria | 1298 |
| 171 | Ga0495685_001254 | 3300047447 | Bacteria | 7766 |
| 172 | Ga0495685_001565 | 3300047447 | Bacteria | 7041 |
| 173 | Ga0495681_0002779 | 3300047470 | Bacteria | 12384 |
| 174 | Ga0495681_0148271 | 3300047470 | Bacteria | 986 |
| 175 | Ga0495684_0026468 | 3300047471 | Bacteria | 4459 |
| 176 | Ga0495684_0211752 | 3300047471 | Bacteria | 1425 |
| 177 | Ga0495686_0117262 | 3300047472 | Bacteria | 1591 |
| 178 | Ga0495593_0007340 | 3300047673 | Bacteria | 6455 |
| 179 | Ga0495614_0027590 | 3300048089 | Bacteria | 2447 |
| 180 | Ga0495614_0059531 | 3300048089 | Bacteria | 1640 |
| 181 | Ga0501032_0038438 | 3300049569 | Bacteria | 3259 |
| 182 | Ga0501033_0001943 | 3300049570 | Bacteria | 17996 |
| 183 | Ga0501033_0007566 | 3300049570 | Bacteria | 8451 |
| 184 | Ga0501033_0008815 | 3300049570 | Bacteria | 7795 |
| 185 | Ga0501033_0055913 | 3300049570 | Bacteria | 2917 |
| 186 | Ga0501034_0008050 | 3300049571 | Bacteria | 11188 |
| 187 | Ga0501034_0009031 | 3300049571 | Bacteria | 10466 |
| 188 | Ga0501034_0271920 | 3300049571 | Bacteria | 1635 |
| 189 | Ga0501036_0000606 | 3300049572 | Bacteria | 26021 |
| 190 | Ga0501036_0022089 | 3300049572 | Bacteria | 5352 |
| 191 | Ga0501036_0338471 | 3300049572 | Bacteria | 1257 |
| 192 | Ga0501038_0001743 | 3300049574 | Bacteria | 20226 |
| 193 | Ga0501038_0077160 | 3300049574 | Bacteria | 2813 |
| 194 | Ga0501039_0002299 | 3300049575 | Bacteria | 14180 |
| 195 | Ga0501042_0016108 | 3300049578 | Bacteria | 5130 |
| 196 | Ga0501043_0005014 | 3300049579 | Bacteria | 10718 |
| 197 | Ga0501043_0031680 | 3300049579 | Bacteria | 4156 |
| 198 | Ga0501046_0025232 | 3300049580 | Bacteria | 4865 |
| 199 | Ga0501047_0023728 | 3300049581 | Bacteria | 5888 |
| 200 | Ga0501047_0049940 | 3300049581 | Bacteria | 4039 |
| 201 | Ga0501047_0305545 | 3300049581 | Bacteria | 1432 |
| 202 | Ga0501048_0011955 | 3300049582 | Bacteria | 6471 |
| 203 | Ga0501070_0015186 | 3300049586 | Bacteria | 6482 |
| 204 | Ga0501074_0000971 | 3300049590 | Bacteria | 18563 |
| 205 | Ga0501035_0000852 | 3300049822 | Bacteria | 32539 |
| 206 | Ga0501035_0033535 | 3300049822 | Bacteria | 4669 |
| 207 | Ga0501035_0161651 | 3300049822 | Bacteria | 1938 |
| 208 | Ga0501035_0167296 | 3300049822 | Bacteria | 1901 |
| 209 | Ga0501044_0022694 | 3300049823 | Bacteria | 6683 |
| 210 | Ga0501044_0079120 | 3300049823 | Bacteria | 3331 |
| 211 | nmdc:mga03n38_16778_c1 | 3300050490 | Bacteria | 2856 |
| 212 | nmdc:mga03n38_63121_c1 | 3300050490 | Bacteria | 1692 |
| 213 | nmdc:mga06z11_586_c1 | 3300050494 | Bacteria | 13318 |
| 214 | Ga0495619_0104104 | 3300053085 | Bacteria | 1934 |
| 215 | Ga0500644_0035184 | 3300053088 | Bacteria | 1621 |
| 216 | Ga0500640_014614 | 3300053095 | Bacteria | 3272 |
| 217 | Ga0500600_0060047 | 3300053149 | Bacteria | 2123 |
| 218 | Ga0466962_0002527 | 3300061719 | Bacteria | 8686 |
| 219 | Ga0466962_0131312 | 3300061719 | Bacteria | 1210 |
| 220 | 2954006886 | 2954002825 | Bacteria | 9173742 |
| 221 | 2585305708 | 2582581313 | Bacteria | 10042643 |
| 222 | 2585314602 | 2582581314 | Bacteria | 11452267 |
| 223 | 2616702100 | 2616644814 | Bacteria | 11555299 |
| 224 | 2644262832 | 2643221647 | Bacteria | 10741251 |
| 225 | 2644443036 | 2643221678 | Bacteria | 9540101 |
| 226 | 2644627152 | 2643221714 | Bacteria | 9015452 |
| 227 | 2785342773 | 2784746763 | Bacteria | 9783172 |
| 228 | 2785370029 | 2784746768 | Bacteria | 10036182 |
| 229 | 2786671102 | 2786546132 | Bacteria | 10419719 |
| 230 | 2808842540 | 2808606359 | Bacteria | 9866990 |
| 231 | 2808921047 | 2808606375 | Bacteria | 9466072 |
| 232 | 2812357576 | 2811994879 | Bacteria | 9313447 |
| 233 | 2812480096 | 2811994917 | Bacteria | 7761064 |
| 234 | 2852637347 | 2852635781 | Bacteria | 8251373 |
| 235 | 2862286131 | 2862281513 | Bacteria | 9621493 |
| 236 | 2862389688 | 2862382967 | Bacteria | 10317375 |
| 237 | 2862578786 | 2862574272 | Bacteria | 10567477 |
| 238 | 2863412664 | 2863404153 | Bacteria | 9672205 |
| 239 | 2867372417 | 2867369537 | Bacteria | 6501581 |
| 240 | 2867430578 | 2867428634 | Bacteria | 9590268 |
| 241 | 2873155276 | 2873151551 | Bacteria | 8625867 |
| 242 | 2877680595 | 2877676314 | Bacteria | 9512378 |
| 243 | 2912719301 | 2912715099 | Bacteria | 9460473 |
| 244 | 2919471804 | 2919468124 | Bacteria | 9133025 |
| 245 | 2946068278 | 2946064051 | Bacteria | 8957905 |
| 246 | 2946076420 | 2946072368 | Bacteria | 8999607 |
| 247 | 2947228643 | 2947224130 | Bacteria | 9938529 |
| 248 | 2954385722 | 2954380949 | Bacteria | 10050426 |
| 249 | 2954677433 | 2954673503 | Bacteria | 9685905 |
| 250 | 2954686721 | 2954682443 | Bacteria | 9862841 |
| 251 | 2954696369 | 2954691527 | Bacteria | 10720516 |
| 252 | 2954705908 | 2954701450 | Bacteria | 10834262 |
| 253 | 2954715726 | 2954711539 | Bacteria | 10867210 |
| 254 | 2954725664 | 2954721474 | Bacteria | 10456478 |
| 255 | 2954736148 | 2954731030 | Bacteria | 10243860 |
| 256 | 2954744603 | 2954740390 | Bacteria | 10229294 |
| 257 | 2954754996 | 2954749733 | Bacteria | 10366972 |
| 258 | 2954763585 | 2954759201 | Bacteria | 9358192 |
| 259 | 2990061576 | 2990059506 | Bacteria | 9321252 |
| 260 | 2990091486 | 2990088156 | Bacteria | 6657676 |
| 261 | 3006425793 | 3006425503 | Bacteria | 6491253 |
| 262 | 3006499457 | 3006493962 | Bacteria | 8825450 |
| 263 | 8008578457 | 8008574985 | Bacteria | 7815457 |
| 264 | 8033689040 | 8033684223 | Bacteria | 6906479 |
| 265 | 8048410275 | 8048406513 | Bacteria | 8936924 |
| 266 | 8056837990 | 8056829672 | Bacteria | 9045328 |
| 267 | JGI24739J22299_10007676 | |||
| 268 | rootH1_10033155 | |||
| 269 | Ga0006562J51391_1100324 | |||
| 270 | Ga0006562J51391_1100326 | |||
| 271 | Ga0068853_100502759 | |||
| 272 | Ga0075368_10034110 | |||
| 273 | Ga0075367_10001177 | |||
| 274 | Ga0075370_10008194 | |||
| 275 | Ga0105251_10104272 | |||
| 276 | Ga0105245_10132419 | |||
| 277 | Ga0105248_10209115 | |||
| 278 | Ga0105246_10001055 | |||
| 279 | Ga0157372_10012866 | |||
| 280 | Ga0157375_10188279 | |||
| 281 | Ga0182008_10001329 | |||
| 282 | Ga0157376_10061157 | |||
| 283 | Ga0182007_10005111 | |||
| 284 | Ga0209758_1024197 | |||
| 285 | Ga0207713_1034171 | |||
| 286 | Ga0207647_10004704 | |||
| 287 | Ga0207650_10139219 | |||
| 288 | Ga0207687_10230149 | |||
| 289 | Ga0207709_10049027 | |||
| 290 | Ga0207639_10011131 | |||
| 291 | Ga0209371_1006484 | |||
| 292 | Ga0307517_10032187 | |||
| 293 | Ga0307515_10013647 | |||
| 294 | Ga0307515_10038760 | |||
| 295 | Ga0268256_1007938 | |||
| 296 | Ga0307511_10007827 | |||
| 297 | Ga0307511_10037537 | |||
| 298 | Ga0307511_10072906 | |||
| 299 | Ga0307512_10003822 | |||
| 300 | Ga0307512_10021730 | |||
| 301 | Ga0307513_10010601 | |||
| 302 | Ga0307513_10070794 | |||
| 303 | Ga0307509_10084847 | |||
| 304 | Ga0307509_10110387 | |||
| 305 | Ga0307509_10205391 | |||
| 306 | Ga0307508_10120855 | |||
| 307 | Ga0307516_10202473 | |||
| 308 | Ga0307518_10089284 | |||
| 309 | Ga0307507_10008549 | |||
| 310 | Ga0307507_10179590 | |||
| 311 | Ga0307510_10037537 | |||
| 312 | Ga0307510_10066073 | |||
| 313 | Ga0307510_10079294 | |||
| 314 | Ga0395898_0002467 | |||
| 315 | Ga0439439_0037653 | |||
| 316 | Ga0451797_1131988 | |||
| 317 | Ga0451800_0619234 | |||
| 318 | Ga0451802_2123982 | |||
| 319 | Ga0451837_0633705 | |||
| 320 | Ga0451853_0394180 | |||
| 321 | Ga0451853_1767329 | |||
| 322 | Ga0451853_2904788 | |||
| 323 | Ga0439433_0006987 | |||
| 324 | Ga0439442_010200 | |||
| 325 | Ga0439448_0006197 | |||
| 326 | Ga0439448_0052199 | |||
| 327 | Ga0439432_020984 | |||
| 328 | Ga0439449_0000236 | |||
| 329 | Ga0439457_000228 | |||
| 330 | Ga0450894_000527 | |||
| 331 | Ga0450895_000918 | |||
| 332 | Ga0450898_001086 | |||
| 333 | Ga0450902_010376 | |||
| 334 | Ga0450903_000558 | |||
| 335 | Ga0439458_0000579 | |||
| 336 | Ga0466969_0028557 | |||
| 337 | Ga0466969_0045098 | |||
| 338 | Ga0466972_0007379 | |||
| 339 | Ga0466972_0013044 | |||
| 340 | Ga0466972_0028615 | |||
| 341 | Ga0466965_0000523 | |||
| 342 | Ga0466965_0047877 | |||
| 343 | Ga0466966_0010882 | |||
| 344 | Ga0466966_0037261 | |||
| 345 | Ga0466961_0013675 | |||
| 346 | Ga0466963_0035510 | |||
| 347 | Ga0466963_0037610 | |||
| 348 | Ga0466964_0037571 | |||
| 349 | Ga0466971_0000467 | |||
| 350 | Ga0466971_0036377 | |||
| 351 | Ga0466968_0018261 | |||
| 352 | Ga0466970_0002390 | |||
| 353 | Ga0466957_0004536 | |||
| 354 | Ga0466959_0004853 | |||
| 355 | Ga0466967_0025576 | |||
| 356 | Ga0466967_0044256 | |||
| 357 | Ga0495592_0003299 | |||
| 358 | Ga0495603_0017048 | |||
| 359 | Ga0495603_0042252 | |||
| 360 | Ga0495603_0045948 | |||
| 361 | Ga0495590_0053213 | |||
| 362 | Ga0495629_0014731 | |||
| 363 | Ga0495629_0030829 | |||
| 364 | Ga0495629_0244721 | |||
| 365 | Ga0495638_0024482 | |||
| 366 | Ga0495638_0085741 | |||
| 367 | Ga0495651_0000900 | |||
| 368 | Ga0495582_0144650 | |||
| 369 | Ga0495605_0207759 | |||
| 370 | Ga0495662_0013863 | |||
| 371 | Ga0495662_0022302 | |||
| 372 | Ga0495662_0046802 | |||
| 373 | Ga0495662_0082917 | |||
| 374 | Ga0495664_0004010 | |||
| 375 | Ga0495664_0331900 | |||
| 376 | Ga0495585_0107521 | |||
| 377 | Ga0495594_0048360 | |||
| 378 | Ga0495594_0060225 | |||
| 379 | Ga0495607_0100999 | |||
| 380 | Ga0495583_0067026 | |||
| 381 | Ga0495606_0056158 | |||
| 382 | Ga0495610_0066499 | |||
| 383 | Ga0495616_0084546 | |||
| 384 | Ga0495620_0010114 | |||
| 385 | Ga0495628_0081763 | |||
| 386 | Ga0495628_0117974 | |||
| 387 | Ga0495630_0242757 | |||
| 388 | Ga0495631_0033609 | |||
| 389 | Ga0495637_0037094 | |||
| 390 | Ga0495643_0003627 | |||
| 391 | Ga0495652_0006999 | |||
| 392 | Ga0495665_0283417 | |||
| 393 | Ga0495586_0030689 | |||
| 394 | Ga0495587_0000405 | |||
| 395 | Ga0495645_0073288 | |||
| 396 | Ga0495622_0067077 | |||
| 397 | Ga0495667_0205853 | |||
| 398 | Ga0495656_0071225 | |||
| 399 | Ga0495634_0002661 | |||
| 400 | Ga0495625_0004207 | |||
| 401 | Ga0495625_0042659 | |||
| 402 | Ga0495625_0125129 | |||
| 403 | Ga0495635_0001909 | |||
| 404 | Ga0495635_0114006 | |||
| 405 | Ga0495588_0128921 | |||
| 406 | Ga0495657_0037578 | |||
| 407 | Ga0495657_0055070 | |||
| 408 | Ga0495657_0236453 | |||
| 409 | Ga0495599_0212503 | |||
| 410 | Ga0495646_0001203 | |||
| 411 | Ga0495613_0042199 | |||
| 412 | Ga0495613_0046604 | |||
| 413 | Ga0495613_0057283 | |||
| 414 | Ga0495613_0232936 | |||
| 415 | Ga0495624_0155851 | |||
| 416 | Ga0495624_0252072 | |||
| 417 | Ga0495671_0010533 | |||
| 418 | Ga0495649_0043417 | |||
| 419 | Ga0495649_0126901 | |||
| 420 | Ga0495589_0009675 | |||
| 421 | Ga0495589_0021267 | |||
| 422 | Ga0495600_0014972 | |||
| 423 | Ga0495600_0033228 | |||
| 424 | Ga0495581_0019451 | |||
| 425 | Ga0495604_0016372 | |||
| 426 | Ga0495636_0036133 | |||
| 427 | Ga0495636_0066597 | |||
| 428 | Ga0495636_0127986 | |||
| 429 | Ga0495674_0122487 | |||
| 430 | Ga0495676_0013140 | |||
| 431 | Ga0495676_0047358 | |||
| 432 | Ga0495676_0107354 | |||
| 433 | Ga0495687_031015 | |||
| 434 | Ga0495687_033509 | |||
| 435 | Ga0495687_100489 | |||
| 436 | Ga0495675_0179270 | |||
| 437 | Ga0495685_001254 | |||
| 438 | Ga0495685_001565 | |||
| 439 | Ga0495681_0002779 | |||
| 440 | Ga0495681_0148271 | |||
| 441 | Ga0495684_0026468 | |||
| 442 | Ga0495684_0211752 | |||
| 443 | Ga0495686_0117262 | |||
| 444 | Ga0495593_0007340 | |||
| 445 | Ga0495614_0027590 | |||
| 446 | Ga0495614_0059531 | |||
| 447 | Ga0501032_0038438 | |||
| 448 | Ga0501033_0001943 | |||
| 449 | Ga0501033_0007566 | |||
| 450 | Ga0501033_0008815 | |||
| 451 | Ga0501033_0055913 | |||
| 452 | Ga0501034_0008050 | |||
| 453 | Ga0501034_0009031 | |||
| 454 | Ga0501034_0271920 | |||
| 455 | Ga0501036_0000606 | |||
| 456 | Ga0501036_0022089 | |||
| 457 | Ga0501036_0338471 | |||
| 458 | Ga0501038_0001743 | |||
| 459 | Ga0501038_0077160 | |||
| 460 | Ga0501039_0002299 | |||
| 461 | Ga0501042_0016108 | |||
| 462 | Ga0501043_0005014 | |||
| 463 | Ga0501043_0031680 | |||
| 464 | Ga0501046_0025232 | |||
| 465 | Ga0501047_0023728 | |||
| 466 | Ga0501047_0049940 | |||
| 467 | Ga0501047_0305545 | |||
| 468 | Ga0501048_0011955 | |||
| 469 | Ga0501070_0015186 | |||
| 470 | Ga0501074_0000971 | |||
| 471 | Ga0501035_0000852 | |||
| 472 | Ga0501035_0033535 | |||
| 473 | Ga0501035_0161651 | |||
| 474 | Ga0501035_0167296 | |||
| 475 | Ga0501044_0022694 | |||
| 476 | Ga0501044_0079120 | |||
| 477 | nmdc:mga03n38_16778_c1 | |||
| 478 | nmdc:mga03n38_63121_c1 | |||
| 479 | nmdc:mga06z11_586_c1 | |||
| 480 | Ga0495619_0104104 | |||
| 481 | Ga0500644_0035184 | |||
| 482 | Ga0500640_014614 | |||
| 483 | Ga0500600_0060047 | |||
| 484 | Ga0466962_0002527 | |||
| 485 | Ga0466962_0131312 | |||
| 486 | 2954006886 | |||
| 487 | 2585305708 | |||
| 488 | 2585314602 | |||
| 489 | 2616702100 | |||
| 490 | 2644262832 | |||
| 491 | 2644443036 | |||
| 492 | 2644627152 | |||
| 493 | 2785342773 | |||
| 494 | 2785370029 | |||
| 495 | 2786671102 | |||
| 496 | 2808842540 | |||
| 497 | 2808921047 | |||
| 498 | 2812357576 | |||
| 499 | 2812480096 | |||
| 500 | 2852637347 | |||
| 501 | 2862286131 | |||
| 502 | 2862389688 | |||
| 503 | 2862578786 | |||
| 504 | 2863412664 | |||
| 505 | 2867372417 | |||
| 506 | 2867430578 | |||
| 507 | 2873155276 | |||
| 508 | 2877680595 | |||
| 509 | 2912719301 | |||
| 510 | 2919471804 | |||
| 511 | 2946068278 | |||
| 512 | 2946076420 | |||
| 513 | 2947228643 | |||
| 514 | 2954385722 | |||
| 515 | 2954677433 | |||
| 516 | 2954686721 | |||
| 517 | 2954696369 | |||
| 518 | 2954705908 | |||
| 519 | 2954715726 | |||
| 520 | 2954725664 | |||
| 521 | 2954736148 | |||
| 522 | 2954744603 | |||
| 523 | 2954754996 | |||
| 524 | 2954763585 | |||
| 525 | 2990061576 | |||
| 526 | 2990091486 | |||
| 527 | 3006425793 | |||
| 528 | 3006499457 | |||
| 529 | 8008578457 | |||
| 530 | 8033689040 | |||
| 531 | 8048410275 | |||
| 532 | 8056837990 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3odj-assembly1.cif.gz_A | crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 | 0.8402 | 92 | 265 |
| 6pja-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.8364 | 93 | 265 |
| 6pjp-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.8259 | 92 | 265 |
| 6pju-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.825 | 93 | 265 |
| 5f5d-assembly1.cif.gz_A | crystal structures and inhibition kinetics reveal a two-state catalytic mechanism with drug design implications for rhomboid proteolysis | 0.8078 | 93 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53632_31_206_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.9522 | 86 | 269 | 1.20.1540.10 |
| af_O53632_31_206_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.9311 | 86 | 269 | 1.20.1540.10 |
| af_H2KML1_907_1063_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8749 | 139 | 264 | 1.20.1540.10 |
| af_Q67UY4_137_320_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8662 | 85 | 271 | 1.20.1540.10 |
| af_A0A1D8PFE0_278_452_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8649 | 139 | 271 | 1.20.1540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J6U758-F1-model_v4 | Unannotated protein | 0.9442 | 92 | 270 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A6G3D5I1-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9437 | 77 | 293 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A6A0BIT8-F1-model_v4 | deleted | 0.9425 | 76 | 293 |
|
| AF-A0A0R2PBG8-F1-model_v4 | Peptidase S54 rhomboid domain-containing protein | 0.9411 | 111 | 270 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A6J6VDH4-F1-model_v4 | Unannotated protein | 0.9335 | 92 | 265 |
GO:0004252
GO:0006508 GO:0016020 |