F374425

General Info

Members Datasets Scaffolds Average Seq Length
266 206 532 280

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2816332295|2817482066
Length 313
Sequence DAPEIRKNPTSCFRKWYNGCWLKCITKGFTIYMAKQPIDLLIQPKWRIIDQSSLGPYFDAKQSFAIDDTLCASVGKGLSPATARSWVHHDTIVLGIQDTRLPYLQDGISLLEEAGYQVIVRNSGGLAVVLDSGVLNVSLIFQDKKNGIDIDRGYEAMFELVKRMLSSYDAAIEAYEIKGSYCPGSFDLSIGGRKFAGISQRRLRGGVAVQIYLCADQSGSGRAELIKRFYDTALKDMRGKTKAVYPDIRPETMASLSELLNEDISVQDLMLLLLTQLKELGGEIYQGPLTPAEEEAYEKNLVRMIERNEKVLG

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
54 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
57 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
58 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
78 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
79 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
85 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
86 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
87 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
88 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
89 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
90 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
91 2554235283 Bacillus safensis VK Isolate Rhizosphere
92 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
93 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
94 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
95 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
96 2643221729 Bacillus sp. Root11 Isolate Unclassified
97 2643221730 Bacillus sp. Root131 Isolate Unclassified
98 2643221731 Bacillus sp. Root147 Isolate Unclassified
99 2643221732 Bacillus sp. Root239 Isolate Unclassified
100 2643221735 Bacillus sp. Root920 Isolate Unclassified
101 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
102 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
103 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
104 2684622632 Bacillus cereus 905 Isolate Unclassified
105 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
106 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
107 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
108 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
109 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
110 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
111 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
112 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
113 2738541295 Bacillus sp. OK085 Isolate Unclassified
114 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
115 2738541358 Bacillus sp. OV752 Isolate Unclassified
116 2738543006 Bacillus sp. OK077 Isolate Unclassified
117 2738543010 Bacillus sp. YR335 Isolate Unclassified
118 2738543017 Bacillus sp. OV186 Isolate Unclassified
119 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
120 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
121 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
122 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
123 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
124 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
125 2811994870 Bacillus sp. JB4 Isolate Unclassified
126 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
127 2818991441 Niallia circulans 3243 Isolate Rhizosphere
128 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
129 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
130 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
131 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
132 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
133 2842682962 Bacillus sp. R-72492 Isolate Unclassified
134 2842882022 Bacillus sp. R-71893 Isolate Unclassified
135 2849139964 Bacillus sp. R-71875 Isolate Unclassified
136 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
137 2857581216 Bacillus sp. R-71922 Isolate Unclassified
138 2857586860 Bacillus sp. R-71935 Isolate Unclassified
139 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
140 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
141 2860837431 Bacillus sp. WR11 Isolate Unclassified
142 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
143 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
144 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
145 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
146 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
147 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
148 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
149 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
150 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
151 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
152 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
153 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
154 2919720352 Priestia megaterium 4340 Isolate Unclassified
155 2919726948 Bacillus pumilus 4489 Isolate Unclassified
156 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
157 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
158 2929004312 Priestia megaterium 1104 Isolate Unclassified
159 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
160 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
161 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
162 2938917290 Bacillus sp. CR71 Isolate Unclassified
163 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
164 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
165 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
166 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
167 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
168 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
169 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
170 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
171 2965761152 Bacillus sp. COPE52 Isolate Unclassified
172 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
173 2969141011 Bacillus velezensis MH25 Isolate Unclassified
174 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
175 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
176 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
177 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
178 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
179 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
180 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
181 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
182 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
183 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
184 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
185 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
186 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
187 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
188 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
189 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
190 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
191 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
192 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
193 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
194 8022653035 Bacillus sp. Rc4 Isolate Unclassified
195 8022792930 Bacillus sp. Xin Isolate Rhizosphere
196 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
197 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
198 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
199 8023438354 Bacillus sp. BH2 Isolate Unclassified
200 8023444577 Bacillus sp. BH32 Isolate Unclassified
201 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
202 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
203 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
204 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
205 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
206 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 52.63
Metatranscriptomes 1.5
Isolates 45.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.29
Nodule 0
Rhizoplane 7.89
Rhizosphere 47.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010444 3300002987 Bacteria 2362
2 JGI25151J46595_10000061 3300003187 Bacteria 146828
3 JGI25151J46595_10001044 3300003187 Bacteria 20675
4 JGI25151J46595_10001316 3300003187 Bacteria 17391
5 JGI25151J46595_10004024 3300003187 Bacteria 7892
6 JGI25151J46595_10015451 3300003187 Bacteria 3362
7 JGI25151J46595_10057738 3300003187 Bacteria 1262
8 JGI25151J46595_10077992 3300003187 Bacteria 971
9 JGI25151J46595_10082009 3300003187 Bacteria 930
10 JGI25151J46595_10083878 3300003187 Bacteria 911
11 rootH2_10040044 3300003320 Bacteria 14085
12 rootL2_10010890 3300003322 Bacteria 24266
13 Ga0055538_1000106 3300003751 Bacteria 66606
14 Ga0055532_1001191 3300003758 Bacteria 7804
15 Ga0055536_1010972 3300003781 Bacteria 3529
16 Ga0070676_10032289 3300005328 Bacteria 2999
17 Ga0070670_100079738 3300005331 Bacteria 2814
18 Ga0070669_100048003 3300005353 Bacteria 3116
19 Ga0070669_100141446 3300005353 Bacteria 1855
20 Ga0070671_100034115 3300005355 Bacteria 4212
21 Ga0070678_100117180 3300005456 Bacteria 2094
22 Ga0070672_100155115 3300005543 Bacteria 1896
23 Ga0068870_10226033 3300005840 Bacteria 1148
24 Ga0105251_10006282 3300009011 Bacteria 7604
25 Ga0105251_10047159 3300009011 Bacteria 2071
26 Ga0105251_10076607 3300009011 Bacteria 1552
27 Ga0105244_10006735 3300009036 Bacteria 7390
28 Ga0105244_10008177 3300009036 Bacteria 6558
29 Ga0105244_10120265 3300009036 Bacteria 1272
30 Ga0105250_10003500 3300009092 Bacteria 7415
31 Ga0105250_10040561 3300009092 Bacteria 1867
32 Ga0105250_10040938 3300009092 Bacteria 1858
33 Ga0105250_10077922 3300009092 Bacteria 1342
34 Ga0105247_10472632 3300009101 Bacteria 908
35 Ga0105243_10011747 3300009148 Bacteria 6622
36 Ga0105242_10005936 3300009176 Bacteria 9420
37 Ga0105246_10078624 3300011119 Bacteria 2343
38 Ga0105246_10083661 3300011119 Bacteria 2281
39 Ga0105246_10528343 3300011119 Bacteria 1007
40 Ga0157371_10009255 3300013102 Bacteria 7771
41 Ga0157378_10002187 3300013297 Bacteria 17345
42 Ga0157372_10105587 3300013307 Bacteria 3222
43 Ga0157377_10013687 3300014745 Bacteria 4112
44 Ga0157376_10019662 3300014969 Bacteria 5210
45 Ga0209784_100051 3300025224 Bacteria 183666
46 Ga0209147_100062 3300025229 Bacteria 242831
47 Ga0209147_100470 3300025229 Bacteria 24707
48 Ga0209147_101772 3300025229 Bacteria 6841
49 Ga0209673_1004297 3300025273 Bacteria 7701
50 Ga0209130_1000355 3300025284 Bacteria 52430
51 Ga0209130_1003120 3300025284 Bacteria 7382
52 Ga0209675_1042946 3300025291 Bacteria 976
53 Ga0209676_1000784 3300025292 Bacteria 42325
54 Ga0209676_1001446 3300025292 Bacteria 22364
55 Ga0209676_1012411 3300025292 Bacteria 3350
56 Ga0209676_1027439 3300025292 Bacteria 1792
57 Ga0209676_1035593 3300025292 Bacteria 1458
58 Ga0209676_1060488 3300025292 Bacteria 945
59 Ga0209025_1000011 3300025294 Bacteria 976387
60 Ga0209025_1000287 3300025294 Bacteria 113923
61 Ga0209025_1000331 3300025294 Bacteria 104721
62 Ga0209025_1001038 3300025294 Bacteria 40754
63 Ga0209025_1002660 3300025294 Bacteria 18263
64 Ga0209025_1002664 3300025294 Bacteria 18239
65 Ga0209025_1002858 3300025294 Bacteria 17322
66 Ga0209025_1002923 3300025294 Bacteria 17011
67 Ga0209025_1004635 3300025294 Bacteria 11762
68 Ga0209025_1012315 3300025294 Bacteria 5501
69 Ga0209025_1026661 3300025294 Bacteria 2892
70 Ga0209025_1034715 3300025294 Bacteria 2295
71 Ga0209025_1034716 3300025294 Bacteria 2295
72 Ga0209025_1036193 3300025294 Bacteria 2215
73 Ga0209025_1050498 3300025294 Bacteria 1662
74 Ga0209025_1065857 3300025294 Bacteria 1320
75 Ga0209025_1077290 3300025294 Bacteria 1149
76 Ga0209256_1020296 3300025299 Bacteria 2079
77 Ga0207426_1009875 3300025302 Bacteria 3741
78 Ga0207696_1002199 3300025711 Bacteria 9767
79 Ga0207696_1003968 3300025711 Bacteria 6509
80 Ga0207696_1030336 3300025711 Bacteria 1644
81 Ga0207655_1004832 3300025728 Bacteria 9376
82 Ga0207713_1002567 3300025735 Bacteria 13121
83 Ga0207713_1004189 3300025735 Bacteria 9456
84 Ga0207713_1050868 3300025735 Bacteria 1651
85 Ga0207713_1064349 3300025735 Bacteria 1381
86 Ga0207710_10084669 3300025900 Bacteria 1476
87 Ga0207645_10014343 3300025907 Bacteria 5305
88 Ga0207681_10017266 3300025923 Bacteria 4530
89 Ga0207681_10112949 3300025923 Bacteria 1980
90 Ga0207686_10128043 3300025934 Bacteria 1737
91 Ga0207709_10020716 3300025935 Bacteria 3713
92 Ga0207691_10120955 3300025940 Bacteria 2320
93 Ga0237817_10046 3300030083 Bacteria 42105
94 Ga0237817_10084 3300030083 Bacteria 28761
95 Ga0307405_10488911 3300031731 Bacteria 984
96 Ga0307409_100310602 3300031995 Bacteria 1471
97 Ga0307409_100673799 3300031995 Bacteria 1031
98 Ga0307416_100025672 3300032002 Bacteria 4324
99 Ga0307416_100052254 3300032002 Bacteria 3271
100 Ga0237819_00011 3300038705 Bacteria 65140
101 Ga0237819_02378 3300038705 Bacteria 3833
102 Ga0466967_0000081 3300045976 Bacteria 34669
103 Ga0495603_0027784 3300046455 Bacteria 3412
104 Ga0495585_0007991 3300046492 Bacteria 6431
105 Ga0495597_0094735 3300046542 Bacteria 1264
106 Ga0495622_0060648 3300046557 Bacteria 1752
107 Ga0495622_0142842 3300046557 Bacteria 1086
108 Ga0495633_0096822 3300046558 Bacteria 1371
109 Ga0495661_0021919 3300046665 Bacteria 4158
110 Ga0495660_0126064 3300046810 Bacteria 1289
111 Ga0495683_0009169 3300047323 Bacteria 5273
112 Ga0496100_0001375 3300048903 Bacteria 11916
113 Ga0496100_0051590 3300048903 Bacteria 2671
114 Ga0496101_0000506 3300048904 Bacteria 24503
115 Ga0496102_0003257 3300048905 Bacteria 13770
116 Ga0496103_0007342 3300048906 Bacteria 6568
117 Ga0496103_0097333 3300048906 Bacteria 1860
118 Ga0496104_0001346 3300048907 Bacteria 21272
119 Ga0496105_0009758 3300048908 Bacteria 7518
120 Ga0496106_0008997 3300048909 Bacteria 7380
121 Ga0496107_0000306 3300048910 Bacteria 26247
122 Ga0496108_0002954 3300048911 Bacteria 13670
123 Ga0496109_0001532 3300048912 Bacteria 19232
124 Ga0496110_0000375 3300048913 Bacteria 29935
125 Ga0496110_0002559 3300048913 Bacteria 13670
126 Ga0496110_0410836 3300048913 Bacteria 1234
127 Ga0496111_0001455 3300048914 Bacteria 13533
128 Ga0496111_0002682 3300048914 Bacteria 10810
129 Ga0496112_0005699 3300048915 Bacteria 10816
130 Ga0496113_0079145 3300048916 Bacteria 2515
131 Ga0496113_0323650 3300048916 Bacteria 1236
132 Ga0496116_0000782 3300048919 Bacteria 40453
133 Ga0496117_0023767 3300048920 Bacteria 4871
134 Ga0496119_0002498 3300048922 Bacteria 20103
135 Ga0496120_0037898 3300048923 Bacteria 2857
136 Ga0496121_0214045 3300048924 Bacteria 1363
137 Ga0496122_0008160 3300048925 Bacteria 11387
138 Ga0496123_0113204 3300048926 Bacteria 1546
139 Ga0501305_008201 3300049161 Bacteria 1346
140 Ga0501312_000261 3300049528 Bacteria 3828
141 Ga0501316_001724 3300049532 Bacteria 1918
142 Ga0501317_001277 3300049533 Bacteria 2130
143 Ga0501202_039124 3300049652 Bacteria 1018
144 Ga0501217_003147 3300049661 Bacteria 3311
145 2817482066 2816332295 Bacteria 4352468
146 2511701487 2511231119 Bacteria 4019861
147 2540608690 2540341094 Bacteria 4061186
148 2545557799 2545555800 Bacteria 4222588
149 2553391273 2551306519 Bacteria 5465154
150 2555468631 2554235283 Bacteria 3683090
151 2556064039 2554235469 Bacteria 3590176
152 2578932189 2576861599 Bacteria 4217202
153 2595091932 2593339131 Bacteria 5116855
154 2631983345 2630968484 Bacteria 3876276
155 2644702505 2643221729 Bacteria 6621700
156 2644715135 2643221730 Bacteria 6523787
157 2644720486 2643221731 Bacteria 5623886
158 2644726429 2643221732 Bacteria 5756404
159 2644738574 2643221735 Bacteria 3676263
160 2651531088 2648501850 Bacteria 3975476
161 2672338699 2671180330 Bacteria 5521719
162 2674421573 2671180844 Bacteria 4164150
163 2685153343 2684622632 Bacteria 5380049
164 2686998776 2684623153 Bacteria 3878815
165 2687500064 2687453109 Bacteria 3860091
166 2695629444 2695420354 Bacteria 3922431
167 2698319845 2695420987 Bacteria 6152737
168 2705997256 2703719227 Bacteria 5631989
169 2712197393 2711768088 Bacteria 3195027
170 2717914864 2716884898 Bacteria 3928789
171 2721508505 2718218445 Bacteria 5113413
172 2738813601 2738541295 Bacteria 5730091
173 2738839170 2738541299 Bacteria 4020721
174 2739156854 2738541358 Bacteria 5932299
175 2739209396 2738543006 Bacteria 5904091
176 2739232331 2738543010 Bacteria 5583595
177 2739269390 2738543017 Bacteria 4271950
178 2757566981 2757320391 Bacteria 4746095
179 2777761994 2775507177 Bacteria 4384303
180 2777836305 2775507192 Bacteria 4622234
181 2791211822 2788500588 Bacteria 4584915
182 2808870764 2808606364 Bacteria 4465927
183 2809053829 2808606399 Bacteria 4021018
184 2812313961 2811994870 Bacteria 3776934
185 2816865377 2816332186 Bacteria 5331395
186 2819567411 2818991441 Bacteria 5062707
187 2819583683 2818991443 Bacteria 6598732
188 2819626632 2818991451 Bacteria 4697364
189 2819711013 2818991465 Bacteria 5388835
190 2819722978 2818991468 Bacteria 3723169
191 2823530006 2823526263 Bacteria 3765752
192 2842687551 2842682962 Bacteria 5589973
193 2842886426 2842882022 Bacteria 6158489
194 2849142962 2849139964 Bacteria 5613304
195 2852674203 2852673933 Bacteria 3347676
196 2857583165 2857581216 Bacteria 5522813
197 2857588985 2857586860 Bacteria 4354574
198 2857609133 2857604169 Bacteria 5111450
199 2857610330 2857609550 Bacteria 3753890
200 2860841507 2860837431 Bacteria 4202080
201 2877772371 2877768649 Bacteria 3957164
202 2880173220 2880169592 Bacteria 3900066
203 2881646071 2881644220 Bacteria 5302661
204 2897113486 2897109615 Bacteria 4009619
205 2904528839 2904524088 Bacteria 5887454
206 2904561815 2904560550 Bacteria 4029838
207 2904608955 2904606771 Bacteria 4684500
208 2908667241 2908665501 Bacteria 3678115
209 2919094744 2919093281 Bacteria 3660974
210 2919148469 2919143609 Bacteria 6219228
211 2919416124 2919414237 Bacteria 5429133
212 2919521762 2919517244 Bacteria 5858162
213 2919724892 2919720352 Bacteria 5986006
214 2919727307 2919726948 Bacteria 3696050
215 2928098185 2928093941 Bacteria 5965005
216 2928510845 2928510474 Bacteria 4815308
217 2929007619 2929004312 Bacteria 5678476
218 2929239053 2929233124 Bacteria 5948380
219 2936344462 2936340661 Bacteria 5139038
220 2936363343 2936361878 Bacteria 5632809
221 2938923278 2938917290 Bacteria 5914775
222 2939597790 2939593269 Bacteria 4798695
223 2947432147 2947426588 Bacteria 5357194
224 2954776581 2954773129 Bacteria 3741715
225 2956901021 2956897341 Bacteria 5447711
226 2956902319 2956897341 Bacteria 5447711
227 2960321408 2960319331 Bacteria 5502575
228 2960378358 2960375949 Bacteria 5361395
229 2962294745 2962290636 Bacteria 4072939
230 2964375448 2964375228 Bacteria 4909004
231 2965766672 2965761152 Bacteria 5806513
232 2969140668 2969136845 Bacteria 3923176
233 2969144938 2969141011 Bacteria 4118468
234 2969768505 2969765954 Bacteria 4216713
235 2969770855 2969770375 Bacteria 4271280
236 2971897062 2971893375 Bacteria 3929648
237 2977254969 2977254563 Bacteria 4828420
238 2979089033 2979083700 Bacteria 5894929
239 2980496512 2980492589 Bacteria 4072961
240 2990275954 2990275345 Bacteria 4887158
241 3001269719 3001267043 Bacteria 4823521
242 3001275065 3001272096 Bacteria 4729684
243 3001894428 3001892409 Bacteria 6328293
244 3006826611 3006826541 Bacteria 4678913
245 3006862495 3006858327 Bacteria 4317835
246 3006883218 3006879489 Bacteria 4064221
247 3006969528 3006969106 Bacteria 4739423
248 3006977988 3006973921 Bacteria 4423788
249 3006980423 3006978542 Bacteria 5328100
250 3006986483 3006984091 Bacteria 4207523
251 3006990804 3006988479 Bacteria 4767936
252 8022626867 8022621104 Bacteria 5241040
253 8022632589 8022630665 Bacteria 3886130
254 8022655566 8022653035 Bacteria 4035078
255 8022793668 8022792930 Bacteria 5693794
256 8022894456 8022893055 Bacteria 5300455
257 8022918432 8022914991 Bacteria 5584517
258 8022954066 8022948649 Bacteria 5366783
259 8023441525 8023438354 Bacteria 5779374
260 8023449047 8023444577 Bacteria 5661597
261 8051954021 8051952484 Bacteria 3926774
262 8052175913 8052174270 Bacteria 3881265
263 8054283820 8054280661 Bacteria 4232245
264 8055532409 8055531788 Bacteria 5249694
265 8057587800 8057582654 Bacteria 5218944
266 8057636717 8057632132 Bacteria 4726859
267 JGI25159J45721_1010444
268 JGI25151J46595_10000061
269 JGI25151J46595_10001044
270 JGI25151J46595_10001316
271 JGI25151J46595_10004024
272 JGI25151J46595_10015451
273 JGI25151J46595_10057738
274 JGI25151J46595_10077992
275 JGI25151J46595_10082009
276 JGI25151J46595_10083878
277 rootH2_10040044
278 rootL2_10010890
279 Ga0055538_1000106
280 Ga0055532_1001191
281 Ga0055536_1010972
282 Ga0070676_10032289
283 Ga0070670_100079738
284 Ga0070669_100048003
285 Ga0070669_100141446
286 Ga0070671_100034115
287 Ga0070678_100117180
288 Ga0070672_100155115
289 Ga0068870_10226033
290 Ga0105251_10006282
291 Ga0105251_10047159
292 Ga0105251_10076607
293 Ga0105244_10006735
294 Ga0105244_10008177
295 Ga0105244_10120265
296 Ga0105250_10003500
297 Ga0105250_10040561
298 Ga0105250_10040938
299 Ga0105250_10077922
300 Ga0105247_10472632
301 Ga0105243_10011747
302 Ga0105242_10005936
303 Ga0105246_10078624
304 Ga0105246_10083661
305 Ga0105246_10528343
306 Ga0157371_10009255
307 Ga0157378_10002187
308 Ga0157372_10105587
309 Ga0157377_10013687
310 Ga0157376_10019662
311 Ga0209784_100051
312 Ga0209147_100062
313 Ga0209147_100470
314 Ga0209147_101772
315 Ga0209673_1004297
316 Ga0209130_1000355
317 Ga0209130_1003120
318 Ga0209675_1042946
319 Ga0209676_1000784
320 Ga0209676_1001446
321 Ga0209676_1012411
322 Ga0209676_1027439
323 Ga0209676_1035593
324 Ga0209676_1060488
325 Ga0209025_1000011
326 Ga0209025_1000287
327 Ga0209025_1000331
328 Ga0209025_1001038
329 Ga0209025_1002660
330 Ga0209025_1002664
331 Ga0209025_1002858
332 Ga0209025_1002923
333 Ga0209025_1004635
334 Ga0209025_1012315
335 Ga0209025_1026661
336 Ga0209025_1034715
337 Ga0209025_1034716
338 Ga0209025_1036193
339 Ga0209025_1050498
340 Ga0209025_1065857
341 Ga0209025_1077290
342 Ga0209256_1020296
343 Ga0207426_1009875
344 Ga0207696_1002199
345 Ga0207696_1003968
346 Ga0207696_1030336
347 Ga0207655_1004832
348 Ga0207713_1002567
349 Ga0207713_1004189
350 Ga0207713_1050868
351 Ga0207713_1064349
352 Ga0207710_10084669
353 Ga0207645_10014343
354 Ga0207681_10017266
355 Ga0207681_10112949
356 Ga0207686_10128043
357 Ga0207709_10020716
358 Ga0207691_10120955
359 Ga0237817_10046
360 Ga0237817_10084
361 Ga0307405_10488911
362 Ga0307409_100310602
363 Ga0307409_100673799
364 Ga0307416_100025672
365 Ga0307416_100052254
366 Ga0237819_00011
367 Ga0237819_02378
368 Ga0466967_0000081
369 Ga0495603_0027784
370 Ga0495585_0007991
371 Ga0495597_0094735
372 Ga0495622_0060648
373 Ga0495622_0142842
374 Ga0495633_0096822
375 Ga0495661_0021919
376 Ga0495660_0126064
377 Ga0495683_0009169
378 Ga0496100_0001375
379 Ga0496100_0051590
380 Ga0496101_0000506
381 Ga0496102_0003257
382 Ga0496103_0007342
383 Ga0496103_0097333
384 Ga0496104_0001346
385 Ga0496105_0009758
386 Ga0496106_0008997
387 Ga0496107_0000306
388 Ga0496108_0002954
389 Ga0496109_0001532
390 Ga0496110_0000375
391 Ga0496110_0002559
392 Ga0496110_0410836
393 Ga0496111_0001455
394 Ga0496111_0002682
395 Ga0496112_0005699
396 Ga0496113_0079145
397 Ga0496113_0323650
398 Ga0496116_0000782
399 Ga0496117_0023767
400 Ga0496119_0002498
401 Ga0496120_0037898
402 Ga0496121_0214045
403 Ga0496122_0008160
404 Ga0496123_0113204
405 Ga0501305_008201
406 Ga0501312_000261
407 Ga0501316_001724
408 Ga0501317_001277
409 Ga0501202_039124
410 Ga0501217_003147
411 2817482066
412 2511701487
413 2540608690
414 2545557799
415 2553391273
416 2555468631
417 2556064039
418 2578932189
419 2595091932
420 2631983345
421 2644702505
422 2644715135
423 2644720486
424 2644726429
425 2644738574
426 2651531088
427 2672338699
428 2674421573
429 2685153343
430 2686998776
431 2687500064
432 2695629444
433 2698319845
434 2705997256
435 2712197393
436 2717914864
437 2721508505
438 2738813601
439 2738839170
440 2739156854
441 2739209396
442 2739232331
443 2739269390
444 2757566981
445 2777761994
446 2777836305
447 2791211822
448 2808870764
449 2809053829
450 2812313961
451 2816865377
452 2819567411
453 2819583683
454 2819626632
455 2819711013
456 2819722978
457 2823530006
458 2842687551
459 2842886426
460 2849142962
461 2852674203
462 2857583165
463 2857588985
464 2857609133
465 2857610330
466 2860841507
467 2877772371
468 2880173220
469 2881646071
470 2897113486
471 2904528839
472 2904561815
473 2904608955
474 2908667241
475 2919094744
476 2919148469
477 2919416124
478 2919521762
479 2919724892
480 2919727307
481 2928098185
482 2928510845
483 2929007619
484 2929239053
485 2936344462
486 2936363343
487 2938923278
488 2939597790
489 2947432147
490 2954776581
491 2956901021
492 2956902319
493 2960321408
494 2960378358
495 2962294745
496 2964375448
497 2965766672
498 2969140668
499 2969144938
500 2969768505
501 2969770855
502 2971897062
503 2977254969
504 2979089033
505 2980496512
506 2990275954
507 3001269719
508 3001275065
509 3001894428
510 3006826611
511 3006862495
512 3006883218
513 3006969528
514 3006977988
515 3006980423
516 3006986483
517 3006990804
518 8022626867
519 8022632589
520 8022655566
521 8022793668
522 8022894456
523 8022918432
524 8022954066
525 8023441525
526 8023449047
527 8051954021
528 8052175913
529 8054283820
530 8055532409
531 8057587800
532 8057636717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

59

278

0.92

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

94

218

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p5i-assembly1.cif.gz_A crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family 0.9811 13 276
2p5i-assembly1.cif.gz_A crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family 0.97 13 276
2p0l-assembly1.cif.gz_A crystal structure of a lipoate-protein ligase a 0.8986 4 271
2p0l-assembly1.cif.gz_A crystal structure of a lipoate-protein ligase a 0.8889 4 271
2c7i-assembly3.cif.gz_C structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.8384 12 268
ID Description Score Start End Superfamily
2p5iA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9784 13 276 3.30.930.10
2p5iA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9671 13 276 3.30.930.10
af_Q2G0I9_4_278_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9591 12 281 3.30.930.10
af_Q2G0I9_4_278_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9284 12 281 3.30.930.10
2p0lA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.927 4 268 3.30.930.10
ID Description Score Start End GO Terms
AF-C3ATM0-F1-model_v4 deleted 0.9962 33 281
AF-C3ATM0-F1-model_v4 deleted 0.9922 33 281
AF-M5RG15-F1-model_v4 deleted 0.9919 2 277
AF-A0A2V3A5G5-F1-model_v4 Octanoyl-[GcvH]:protein N-octanoyltransferase (EC 2.3.1.204) (Octanoyl-[GcvH]:E2 amidotransferase) 0.9896 3 278 GO:0009107
GO:0033819
AF-A0A846MHG1-F1-model_v4 Octanoyl-[GcvH]:protein N-octanoyltransferase (EC 2.3.1.204) (Octanoyl-[GcvH]:E2 amidotransferase) 0.988 7 276 GO:0009107
GO:0033819

Map