F374343

General Info

Members Datasets Scaffolds Average Seq Length
266 131 532 312

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0006885|Ga0501033_0006885_7516_8556
Length 346
Sequence LVQFLLNGSREPVFGIETSRRMRVVPLVVFGFLFACAPLRAPEGPARMAPMIGQDSFTADDGTVLPLRIWAAEGRSGMEPRAVIVALHGMSDYSNAFAMPAAVWAEAGITTIAYDQRGFGAGPHPGIWAGGARMRADLRDAIAAAHARWPGVPVFALGESMGGAVLLTALADGAPLPIAGAVLVAPAVWSRADMPILYRVALFFAARLTPGLILSNSAARHVVTIMPSDNIEMLRALGRDPLFQKKTRADTLYGLVDLMDAARAAPAHLTRPGPPILLLYGAHDQVIPARPTKAVIAALDGSATVHRYETGYHMLLRDLGRALPEKDAADWILAHAPEPAGNKSSP

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0
Rhizoplane 0
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0006885 3300049570 Bacteria 8876
2 JGI25165J46597_1000008 3300003214 Bacteria 478603
3 JGI25153J46596_10000526 3300003215 Bacteria 24044
4 Ga0070658_10001580 3300005327 Bacteria 19269
5 Ga0070658_10016145 3300005327 Bacteria 5974
6 Ga0070658_10019136 3300005327 Bacteria 5485
7 Ga0070658_10096215 3300005327 Bacteria 2444
8 Ga0070658_10136256 3300005327 Bacteria 2049
9 Ga0070676_10255924 3300005328 Bacteria 1170
10 Ga0070683_100018312 3300005329 Bacteria 6200
11 Ga0068869_100039811 3300005334 Bacteria 3358
12 Ga0070666_10032052 3300005335 Bacteria 3471
13 Ga0070680_100202940 3300005336 Bacteria 1672
14 Ga0068868_100009116 3300005338 Bacteria 7125
15 Ga0068868_100354165 3300005338 Bacteria 1258
16 Ga0070660_100011874 3300005339 Bacteria 6208
17 Ga0070660_100090475 3300005339 Bacteria 2413
18 Ga0070660_100192248 3300005339 Bacteria 1653
19 Ga0070661_100000300 3300005344 Bacteria 39901
20 Ga0070659_100031221 3300005366 Bacteria 4126
21 Ga0070711_100059941 3300005439 Bacteria 2644
22 Ga0070678_100048322 3300005456 Bacteria 3063
23 Ga0070678_100069762 3300005456 Bacteria 2625
24 Ga0070681_10141488 3300005458 Bacteria 2336
25 Ga0070681_10404442 3300005458 Bacteria 1277
26 Ga0070679_100003839 3300005530 Bacteria 13800
27 Ga0070679_100018331 3300005530 Bacteria 6791
28 Ga0070679_100123990 3300005530 Bacteria 2566
29 Ga0070665_100005863 3300005548 Bacteria 12596
30 Ga0070665_100008260 3300005548 Bacteria 10530
31 Ga0070665_100017383 3300005548 Bacteria 7218
32 Ga0070665_100103950 3300005548 Bacteria 2843
33 Ga0070665_100124182 3300005548 Bacteria 2583
34 Ga0068855_100040453 3300005563 Bacteria 5533
35 Ga0068857_100061549 3300005577 Bacteria 3335
36 Ga0070702_100058202 3300005615 Bacteria 2238
37 Ga0097621_100002239 3300006237 Bacteria 13249
38 Ga0097621_100009210 3300006237 Bacteria 7160
39 Ga0097621_100051381 3300006237 Bacteria 3355
40 Ga0097621_100203530 3300006237 Bacteria 1719
41 Ga0097621_100314963 3300006237 Bacteria 1385
42 Ga0068871_100000115 3300006358 Bacteria 49397
43 Ga0068871_100025175 3300006358 Bacteria 4626
44 Ga0068871_100360976 3300006358 Bacteria 1287
45 Ga0068865_100062143 3300006881 Bacteria 2621
46 Ga0068865_100327343 3300006881 Bacteria 1234
47 Ga0105240_10007346 3300009093 Bacteria 16029
48 Ga0105240_10024520 3300009093 Bacteria 7948
49 Ga0105240_10055158 3300009093 Bacteria 4977
50 Ga0105240_10071798 3300009093 Bacteria 4280
51 Ga0105240_10170678 3300009093 Unclassified 2577
52 Ga0105240_10210920 3300009093 Bacteria 2270
53 Ga0105240_10342985 3300009093 Bacteria 1696
54 Ga0105245_10034129 3300009098 Bacteria 4511
55 Ga0105245_10034186 3300009098 Bacteria 4508
56 Ga0105245_10152536 3300009098 Bacteria 2186
57 Ga0105241_10060083 3300009174 Bacteria 2923
58 Ga0105242_10038358 3300009176 Bacteria 3852
59 Ga0105242_10078755 3300009176 Bacteria 2751
60 Ga0105237_10145640 3300009545 Bacteria 2363
61 Ga0105237_10200565 3300009545 Bacteria 1995
62 Ga0105238_10036416 3300009551 Bacteria 5002
63 Ga0105238_10051545 3300009551 Bacteria 4139
64 Ga0105238_10134147 3300009551 Bacteria 2454
65 Ga0105238_10360689 3300009551 Bacteria 1443
66 Ga0105238_10398416 3300009551 Bacteria 1369
67 Ga0105239_10119337 3300010375 Bacteria 2927
68 Ga0157370_10077098 3300013104 Bacteria 3140
69 Ga0157370_10087256 3300013104 Bacteria 2931
70 Ga0157370_10212330 3300013104 Bacteria 1794
71 Ga0157369_10058804 3300013105 Bacteria 4146
72 Ga0157369_10635074 3300013105 Bacteria 1101
73 Ga0157378_10009249 3300013297 Bacteria 8581
74 Ga0157378_10530450 3300013297 Bacteria 1180
75 Ga0163162_10047667 3300013306 Bacteria 4294
76 Ga0163162_10098258 3300013306 Unclassified 3017
77 Ga0163162_10169850 3300013306 Bacteria 2305
78 Ga0157375_10145677 3300013308 Bacteria 2499
79 Ga0163163_10000016 3300014325 Bacteria 213966
80 Ga0157379_10000131 3300014968 Bacteria 53172
81 Ga0157376_10044644 3300014969 Bacteria 3644
82 Ga0163161_10024959 3300017792 Bacteria 4226
83 Ga0213876_10007639 3300021384 Bacteria 5871
84 Ga0209233_1000006 3300025261 Bacteria 1473685
85 Ga0209233_1002228 3300025261 Bacteria 7259
86 Ga0209455_1007797 3300025272 Bacteria 2981
87 Ga0209758_1000032 3300025297 Bacteria 481623
88 Ga0207680_10021800 3300025903 Bacteria 3473
89 Ga0207645_10244365 3300025907 Bacteria 1186
90 Ga0207705_10000176 3300025909 Bacteria 67914
91 Ga0207705_10096418 3300025909 Bacteria 2171
92 Ga0207705_10099441 3300025909 Bacteria 2138
93 Ga0207654_10055001 3300025911 Bacteria 2302
94 Ga0207707_10043377 3300025912 Bacteria 3924
95 Ga0207707_10259032 3300025912 Bacteria 1509
96 Ga0207695_10003426 3300025913 Bacteria 22378
97 Ga0207695_10019398 3300025913 Bacteria 7831
98 Ga0207695_10024424 3300025913 Bacteria 6802
99 Ga0207695_10044386 3300025913 Bacteria 4728
100 Ga0207695_10091755 3300025913 Bacteria 3050
101 Ga0207660_10082486 3300025917 Bacteria 2366
102 Ga0207660_10132530 3300025917 Bacteria 1898
103 Ga0207657_10000129 3300025919 Bacteria 75856
104 Ga0207657_10028100 3300025919 Bacteria 5139
105 Ga0207657_10078727 3300025919 Bacteria 2775
106 Ga0207649_10000078 3300025920 Bacteria 82996
107 Ga0207652_10027044 3300025921 Bacteria 4780
108 Ga0207652_10435125 3300025921 Bacteria 1183
109 Ga0207694_10019419 3300025924 Bacteria 5136
110 Ga0207694_10050301 3300025924 Bacteria 3227
111 Ga0207694_10126724 3300025924 Bacteria 2043
112 Ga0207687_10009581 3300025927 Bacteria 6334
113 Ga0207690_10186567 3300025932 Bacteria 1565
114 Ga0207686_10075497 3300025934 Bacteria 2182
115 Ga0207689_10095669 3300025942 Bacteria 2439
116 Ga0207661_10037865 3300025944 Bacteria 3776
117 Ga0207667_10045090 3300025949 Bacteria 4670
118 Ga0207667_10056061 3300025949 Bacteria 4141
119 Ga0207667_10295913 3300025949 Bacteria 1653
120 Ga0207667_10438383 3300025949 Bacteria 1328
121 Ga0207677_10006599 3300026023 Bacteria 6367
122 Ga0207639_10175142 3300026041 Bacteria 1821
123 Ga0207678_10117190 3300026067 Bacteria 2272
124 Ga0207674_10029813 3300026116 Bacteria 5741
125 Ga0207674_10111364 3300026116 Bacteria 2711
126 Ga0207683_10006132 3300026121 Bacteria 10297
127 Ga0207683_10090368 3300026121 Bacteria 2727
128 Ga0207683_10117496 3300026121 Bacteria 2385
129 Ga0268266_10001197 3300028379 Bacteria 32012
130 Ga0268266_10005719 3300028379 Bacteria 11523
131 Ga0265318_10002820 3300028577 Bacteria 9070
132 Ga0265338_10033015 3300028800 Bacteria 5034
133 Ga0265330_10014891 3300031235 Bacteria 3602
134 Ga0265330_10034062 3300031235 Bacteria 2276
135 Ga0265332_10047409 3300031238 Bacteria 1849
136 Ga0265332_10104934 3300031238 Bacteria 1191
137 Ga0265328_10051929 3300031239 Bacteria 1505
138 Ga0265320_10038042 3300031240 Bacteria 2418
139 Ga0265325_10015590 3300031241 Bacteria 4269
140 Ga0265340_10000908 3300031247 Bacteria 16772
141 Ga0265340_10025004 3300031247 Bacteria 3028
142 Ga0265339_10029636 3300031249 Bacteria 3104
143 Ga0265331_10000011 3300031250 Bacteria 308171
144 Ga0265331_10000506 3300031250 Bacteria 36469
145 Ga0265331_10000956 3300031250 Bacteria 22980
146 Ga0265331_10045911 3300031250 Bacteria 2107
147 Ga0265327_10000007 3300031251 Bacteria 678515
148 Ga0265316_10006223 3300031344 Bacteria 11443
149 Ga0265316_10074773 3300031344 Bacteria 2607
150 Ga0265316_10246441 3300031344 Bacteria 1313
151 Ga0265313_10001228 3300031595 Bacteria 24429
152 Ga0265313_10002887 3300031595 Bacteria 14391
153 Ga0265313_10027436 3300031595 Bacteria 2980
154 Ga0265313_10056084 3300031595 Bacteria 1864
155 Ga0265314_10001388 3300031711 Bacteria 27152
156 Ga0265314_10030000 3300031711 Bacteria 4031
157 Ga0265314_10050912 3300031711 Bacteria 2887
158 Ga0265314_10055917 3300031711 Bacteria 2720
159 Ga0265314_10069212 3300031711 Bacteria 2369
160 Ga0265342_10049371 3300031712 Bacteria 2518
161 Ga0265342_10093758 3300031712 Bacteria 1718
162 Ga0307516_10020942 3300031730 Bacteria 6747
163 Ga0373944_0052797 3300035089 Bacteria 1285
164 Ga0373936_0025972 3300035113 Bacteria 2293
165 Ga0373936_0038489 3300035113 Bacteria 1912
166 Ga0373945_0016571 3300035116 Bacteria 2487
167 Ga0373943_0047212 3300035170 Bacteria 2104
168 Ga0373946_0013674 3300035171 Bacteria 3054
169 Ga0373927_0092468 3300035695 Bacteria 1965
170 Ga0373947_0002942 3300035725 Bacteria 10165
171 Ga0373925_0002544 3300037068 Bacteria 14519
172 Ga0373925_0102981 3300037068 Bacteria 2197
173 Ga0395899_0234631 3300037312 Bacteria 1265
174 Ga0395898_0105420 3300037466 Bacteria 2703
175 Ga0395901_0092762 3300038443 Bacteria 3161
176 Ga0436365_0292851 3300039437 Bacteria 11194
177 Ga0436365_1675136 3300039437 Bacteria 18309
178 Ga0466967_0126580 3300045976 Bacteria 2367
179 Ga0495629_0064987 3300046459 Bacteria 2547
180 Ga0495654_0062833 3300046530 Bacteria 1779
181 Ga0495622_0004752 3300046557 Bacteria 6290
182 Ga0495684_0024326 3300047471 Bacteria 4663
183 Ga0496121_0003690 3300048924 Bacteria 21494
184 Ga0501031_0008958 3300049568 Bacteria 6509
185 Ga0501031_0151960 3300049568 Bacteria 1513
186 Ga0501032_0009330 3300049569 Bacteria 7107
187 Ga0501032_0160995 3300049569 Bacteria 1474
188 Ga0501033_0004484 3300049570 Bacteria 11169
189 Ga0501033_0028902 3300049570 Bacteria 4166
190 Ga0501033_0126262 3300049570 Bacteria 1855
191 Ga0501033_0176352 3300049570 Bacteria 1533
192 Ga0501034_0001907 3300049571 Bacteria 26379
193 Ga0501034_0146533 3300049571 Bacteria 2338
194 Ga0501034_0155009 3300049571 Bacteria 2265
195 Ga0501034_0327282 3300049571 Bacteria 1464
196 Ga0501034_0350112 3300049571 Bacteria 1406
197 Ga0501036_0013859 3300049572 Bacteria 6705
198 Ga0501036_0563338 3300049572 Bacteria 946
199 Ga0501037_0184422 3300049573 Bacteria 1480
200 Ga0501037_0225131 3300049573 Bacteria 1318
201 Ga0501037_0291074 3300049573 Bacteria 1136
202 Ga0501038_0027980 3300049574 Bacteria 5008
203 Ga0501038_0036987 3300049574 Bacteria 4282
204 Ga0501038_0320798 3300049574 Bacteria 1212
205 Ga0501039_0056667 3300049575 Bacteria 3035
206 Ga0501042_0009936 3300049578 Bacteria 6359
207 Ga0501043_0008044 3300049579 Bacteria 8325
208 Ga0501043_0049504 3300049579 Bacteria 3303
209 Ga0501043_0414837 3300049579 Bacteria 1016
210 Ga0501046_0001650 3300049580 Bacteria 21369
211 Ga0501046_0007379 3300049580 Bacteria 9668
212 Ga0501046_0007477 3300049580 Bacteria 9592
213 Ga0501047_0001899 3300049581 Bacteria 20092
214 Ga0501047_0032157 3300049581 Bacteria 5063
215 Ga0501047_0052457 3300049581 Bacteria 3942
216 Ga0501047_0094830 3300049581 Unclassified 2863
217 Ga0501047_0114180 3300049581 Bacteria 2583
218 Ga0501047_0349276 3300049581 Bacteria 1316
219 Ga0501048_0019451 3300049582 Bacteria 4981
220 Ga0501067_0004930 3300049583 Bacteria 7419
221 Ga0501068_0053867 3300049584 Bacteria 2437
222 Ga0501069_0028995 3300049585 Bacteria 3036
223 Ga0501069_0085296 3300049585 Bacteria 1782
224 Ga0501070_0000280 3300049586 Bacteria 47649
225 Ga0501070_0011573 3300049586 Bacteria 7449
226 Ga0501070_0092557 3300049586 Bacteria 2502
227 Ga0501070_0174316 3300049586 Bacteria 1771
228 Ga0501070_0244757 3300049586 Bacteria 1468
229 Ga0501070_0625712 3300049586 Bacteria 856
230 Ga0501073_0006840 3300049589 Bacteria 8478
231 Ga0501073_0129782 3300049589 Bacteria 1747
232 Ga0501073_0204093 3300049589 Bacteria 1367
233 Ga0501074_0080383 3300049590 Bacteria 2339
234 Ga0501079_0008217 3300049741 Bacteria 7912
235 Ga0501080_0007970 3300049742 Bacteria 9599
236 Ga0501080_0037973 3300049742 Bacteria 4498
237 Ga0501080_0061921 3300049742 Bacteria 3482
238 Ga0501080_0072599 3300049742 Unclassified 3202
239 Ga0501080_0093424 3300049742 Bacteria 2793
240 Ga0501083_0001727 3300049744 Bacteria 14885
241 Ga0501035_0004683 3300049822 Bacteria 12982
242 Ga0501035_0005356 3300049822 Bacteria 12128
243 Ga0501035_0024671 3300049822 Bacteria 5513
244 Ga0501035_0041415 3300049822 Bacteria 4158
245 Ga0501035_0182145 3300049822 Bacteria 1809
246 Ga0501044_0004898 3300049823 Bacteria 14963
247 Ga0501044_0005757 3300049823 Bacteria 13714
248 Ga0501044_0007254 3300049823 Bacteria 12190
249 Ga0501044_0017349 3300049823 Bacteria 7722
250 Ga0501044_0024634 3300049823 Bacteria 6385
251 Ga0501044_0032140 3300049823 Bacteria 5517
252 Ga0501044_0059825 3300049823 Bacteria 3902
253 Ga0501044_0091376 3300049823 Bacteria 3071
254 Ga0501044_0108236 3300049823 Bacteria 2790
255 Ga0501044_0111105 3300049823 Bacteria 2749
256 Ga0501044_0154158 3300049823 Unclassified 2278
257 Ga0501044_0313607 3300049823 Bacteria 1494
258 Ga0500643_000008 3300053087 Bacteria 457931
259 Ga0500646_0026268 3300053090 Bacteria 1578
260 Ga0500559_0067618 3300053136 Bacteria 1604
261 Ga0500559_0071344 3300053136 Bacteria 1564
262 Ga0500568_0017850 3300053139 Bacteria 3122
263 Ga0500573_0000051 3300053140 Bacteria 95469
264 Ga0501084_0003801 3300054114 Bacteria 12275
265 Ga0501084_0108446 3300054114 Bacteria 2333
266 Ga0501082_0055121 3300060353 Bacteria 3426
267 Ga0501033_0006885
268 JGI25165J46597_1000008
269 JGI25153J46596_10000526
270 Ga0070658_10001580
271 Ga0070658_10016145
272 Ga0070658_10019136
273 Ga0070658_10096215
274 Ga0070658_10136256
275 Ga0070676_10255924
276 Ga0070683_100018312
277 Ga0068869_100039811
278 Ga0070666_10032052
279 Ga0070680_100202940
280 Ga0068868_100009116
281 Ga0068868_100354165
282 Ga0070660_100011874
283 Ga0070660_100090475
284 Ga0070660_100192248
285 Ga0070661_100000300
286 Ga0070659_100031221
287 Ga0070711_100059941
288 Ga0070678_100048322
289 Ga0070678_100069762
290 Ga0070681_10141488
291 Ga0070681_10404442
292 Ga0070679_100003839
293 Ga0070679_100018331
294 Ga0070679_100123990
295 Ga0070665_100005863
296 Ga0070665_100008260
297 Ga0070665_100017383
298 Ga0070665_100103950
299 Ga0070665_100124182
300 Ga0068855_100040453
301 Ga0068857_100061549
302 Ga0070702_100058202
303 Ga0097621_100002239
304 Ga0097621_100009210
305 Ga0097621_100051381
306 Ga0097621_100203530
307 Ga0097621_100314963
308 Ga0068871_100000115
309 Ga0068871_100025175
310 Ga0068871_100360976
311 Ga0068865_100062143
312 Ga0068865_100327343
313 Ga0105240_10007346
314 Ga0105240_10024520
315 Ga0105240_10055158
316 Ga0105240_10071798
317 Ga0105240_10170678
318 Ga0105240_10210920
319 Ga0105240_10342985
320 Ga0105245_10034129
321 Ga0105245_10034186
322 Ga0105245_10152536
323 Ga0105241_10060083
324 Ga0105242_10038358
325 Ga0105242_10078755
326 Ga0105237_10145640
327 Ga0105237_10200565
328 Ga0105238_10036416
329 Ga0105238_10051545
330 Ga0105238_10134147
331 Ga0105238_10360689
332 Ga0105238_10398416
333 Ga0105239_10119337
334 Ga0157370_10077098
335 Ga0157370_10087256
336 Ga0157370_10212330
337 Ga0157369_10058804
338 Ga0157369_10635074
339 Ga0157378_10009249
340 Ga0157378_10530450
341 Ga0163162_10047667
342 Ga0163162_10098258
343 Ga0163162_10169850
344 Ga0157375_10145677
345 Ga0163163_10000016
346 Ga0157379_10000131
347 Ga0157376_10044644
348 Ga0163161_10024959
349 Ga0213876_10007639
350 Ga0209233_1000006
351 Ga0209233_1002228
352 Ga0209455_1007797
353 Ga0209758_1000032
354 Ga0207680_10021800
355 Ga0207645_10244365
356 Ga0207705_10000176
357 Ga0207705_10096418
358 Ga0207705_10099441
359 Ga0207654_10055001
360 Ga0207707_10043377
361 Ga0207707_10259032
362 Ga0207695_10003426
363 Ga0207695_10019398
364 Ga0207695_10024424
365 Ga0207695_10044386
366 Ga0207695_10091755
367 Ga0207660_10082486
368 Ga0207660_10132530
369 Ga0207657_10000129
370 Ga0207657_10028100
371 Ga0207657_10078727
372 Ga0207649_10000078
373 Ga0207652_10027044
374 Ga0207652_10435125
375 Ga0207694_10019419
376 Ga0207694_10050301
377 Ga0207694_10126724
378 Ga0207687_10009581
379 Ga0207690_10186567
380 Ga0207686_10075497
381 Ga0207689_10095669
382 Ga0207661_10037865
383 Ga0207667_10045090
384 Ga0207667_10056061
385 Ga0207667_10295913
386 Ga0207667_10438383
387 Ga0207677_10006599
388 Ga0207639_10175142
389 Ga0207678_10117190
390 Ga0207674_10029813
391 Ga0207674_10111364
392 Ga0207683_10006132
393 Ga0207683_10090368
394 Ga0207683_10117496
395 Ga0268266_10001197
396 Ga0268266_10005719
397 Ga0265318_10002820
398 Ga0265338_10033015
399 Ga0265330_10014891
400 Ga0265330_10034062
401 Ga0265332_10047409
402 Ga0265332_10104934
403 Ga0265328_10051929
404 Ga0265320_10038042
405 Ga0265325_10015590
406 Ga0265340_10000908
407 Ga0265340_10025004
408 Ga0265339_10029636
409 Ga0265331_10000011
410 Ga0265331_10000506
411 Ga0265331_10000956
412 Ga0265331_10045911
413 Ga0265327_10000007
414 Ga0265316_10006223
415 Ga0265316_10074773
416 Ga0265316_10246441
417 Ga0265313_10001228
418 Ga0265313_10002887
419 Ga0265313_10027436
420 Ga0265313_10056084
421 Ga0265314_10001388
422 Ga0265314_10030000
423 Ga0265314_10050912
424 Ga0265314_10055917
425 Ga0265314_10069212
426 Ga0265342_10049371
427 Ga0265342_10093758
428 Ga0307516_10020942
429 Ga0373944_0052797
430 Ga0373936_0025972
431 Ga0373936_0038489
432 Ga0373945_0016571
433 Ga0373943_0047212
434 Ga0373946_0013674
435 Ga0373927_0092468
436 Ga0373947_0002942
437 Ga0373925_0002544
438 Ga0373925_0102981
439 Ga0395899_0234631
440 Ga0395898_0105420
441 Ga0395901_0092762
442 Ga0436365_0292851
443 Ga0436365_1675136
444 Ga0466967_0126580
445 Ga0495629_0064987
446 Ga0495654_0062833
447 Ga0495622_0004752
448 Ga0495684_0024326
449 Ga0496121_0003690
450 Ga0501031_0008958
451 Ga0501031_0151960
452 Ga0501032_0009330
453 Ga0501032_0160995
454 Ga0501033_0004484
455 Ga0501033_0028902
456 Ga0501033_0126262
457 Ga0501033_0176352
458 Ga0501034_0001907
459 Ga0501034_0146533
460 Ga0501034_0155009
461 Ga0501034_0327282
462 Ga0501034_0350112
463 Ga0501036_0013859
464 Ga0501036_0563338
465 Ga0501037_0184422
466 Ga0501037_0225131
467 Ga0501037_0291074
468 Ga0501038_0027980
469 Ga0501038_0036987
470 Ga0501038_0320798
471 Ga0501039_0056667
472 Ga0501042_0009936
473 Ga0501043_0008044
474 Ga0501043_0049504
475 Ga0501043_0414837
476 Ga0501046_0001650
477 Ga0501046_0007379
478 Ga0501046_0007477
479 Ga0501047_0001899
480 Ga0501047_0032157
481 Ga0501047_0052457
482 Ga0501047_0094830
483 Ga0501047_0114180
484 Ga0501047_0349276
485 Ga0501048_0019451
486 Ga0501067_0004930
487 Ga0501068_0053867
488 Ga0501069_0028995
489 Ga0501069_0085296
490 Ga0501070_0000280
491 Ga0501070_0011573
492 Ga0501070_0092557
493 Ga0501070_0174316
494 Ga0501070_0244757
495 Ga0501070_0625712
496 Ga0501073_0006840
497 Ga0501073_0129782
498 Ga0501073_0204093
499 Ga0501074_0080383
500 Ga0501079_0008217
501 Ga0501080_0007970
502 Ga0501080_0037973
503 Ga0501080_0061921
504 Ga0501080_0072599
505 Ga0501080_0093424
506 Ga0501083_0001727
507 Ga0501035_0004683
508 Ga0501035_0005356
509 Ga0501035_0024671
510 Ga0501035_0041415
511 Ga0501035_0182145
512 Ga0501044_0004898
513 Ga0501044_0005757
514 Ga0501044_0007254
515 Ga0501044_0017349
516 Ga0501044_0024634
517 Ga0501044_0032140
518 Ga0501044_0059825
519 Ga0501044_0091376
520 Ga0501044_0108236
521 Ga0501044_0111105
522 Ga0501044_0154158
523 Ga0501044_0313607
524 Ga0500643_000008
525 Ga0500646_0026268
526 Ga0500559_0067618
527 Ga0500559_0071344
528 Ga0500568_0017850
529 Ga0500573_0000051
530 Ga0501084_0003801
531 Ga0501084_0108446
532 Ga0501082_0055121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

78

320

0.95

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

82

212

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l4u-assembly1.cif.gz_A crystal structure of human monoacylglycerol lipase in complex with compound 1h 0.8666 35 313
3jw8-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase 0.8504 35 313
7l4u-assembly2.cif.gz_B crystal structure of human monoacylglycerol lipase in complex with compound 1h 0.848 35 314
8aqf-assembly1.cif.gz_A crystal structure of human monoglyceride lipase with compound lei-515 0.8389 35 313
6eic-assembly2.cif.gz_A crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8354 37 312
ID Description Score Start End Superfamily
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8503 31 161 3.40.50.1820
af_A3BYJ4_101_392_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8447 24 313 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8385 28 314 3.40.50.1820
3hjuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8359 35 313 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8357 28 314 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A848W6H1-F1-model_v4 Alpha/beta hydrolase 0.9357 27 315 GO:0016787
AF-A0A382ALN0-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9354 27 310
AF-G7ZED3-F1-model_v4 Putative lysophospholipase (EC 3.1.1.23) 0.9298 22 316 GO:0047372
AF-A0A382ALN0-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9258 27 310
AF-A0A2E7HEZ1-F1-model_v4 Alpha/beta hydrolase 0.9252 27 310 GO:0016787

Map