F374324

General Info

Members Datasets Scaffolds Average Seq Length
266 180 532 230

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0068014|Ga0496108_0068014_1777_2562
Length 261
Sequence MTGRSAASVREISATRAGMHADGKSARRGLSVRRLESAIRDPHSAFKVLNFVLSLGPFAWLIWAALTDHLSPNPLSDITNETGVWTLRFLCITLAITPFRRLTGWNAVIRLRRMTGLFAFFYGTLHFLTYVIADRFAALDFSQGVLAWSTLRDLVHSVGDDIYKRPFITVGFTAWLTMVPLALTSTAGMIRRLGGRRWNLLHRLVYATAAAGVIHYWWLVKADISRPRIYAVIVGLLLAFRAAWPRRGGIPVRDVLLSRAR

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 2816332133 Acidovorax radicis 2721A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 0
Rhizoplane 4.89
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0068014 3300048911 Bacteria 3005
2 Ga0065712_10071300 3300005290 Bacteria 5354
3 Ga0065707_10270197 3300005295 Bacteria 1069
4 Ga0070676_10006508 3300005328 Bacteria 6242
5 Ga0070676_10358833 3300005328 Bacteria 1004
6 Ga0070683_100001000 3300005329 Bacteria 21167
7 Ga0070670_100033902 3300005331 Bacteria 4396
8 Ga0068869_100221266 3300005334 Bacteria 1500
9 Ga0068869_100373724 3300005334 Bacteria 1167
10 Ga0070666_10010742 3300005335 Bacteria 5730
11 Ga0070666_10308854 3300005335 Bacteria 1127
12 Ga0070666_10452440 3300005335 Bacteria 927
13 Ga0068868_100454918 3300005338 Bacteria 1114
14 Ga0070660_100120778 3300005339 Bacteria 2091
15 Ga0070689_100038526 3300005340 Bacteria 3658
16 Ga0070691_10036113 3300005341 Bacteria 2329
17 Ga0070661_100013334 3300005344 Bacteria 5770
18 Ga0070661_100211736 3300005344 Bacteria 1484
19 Ga0070669_100003701 3300005353 Bacteria 11034
20 Ga0070675_100015312 3300005354 Bacteria 6061
21 Ga0070675_100236204 3300005354 Bacteria 1596
22 Ga0070675_100632835 3300005354 Bacteria 972
23 Ga0070671_100043997 3300005355 Unclassified 3710
24 Ga0070674_100048803 3300005356 Bacteria 2907
25 Ga0070667_100066579 3300005367 Bacteria 3061
26 Ga0070667_100496101 3300005367 Unclassified 1119
27 Ga0070709_10082617 3300005434 Bacteria 2099
28 Ga0070714_100055555 3300005435 Bacteria 3384
29 Ga0070700_100004383 3300005441 Bacteria 7370
30 Ga0070700_100281301 3300005441 Bacteria 1206
31 Ga0070708_100511636 3300005445 Bacteria 1132
32 Ga0070663_100097690 3300005455 Bacteria 2187
33 Ga0070662_100042727 3300005457 Bacteria 3239
34 Ga0070662_100408964 3300005457 Bacteria 1121
35 Ga0068867_100031485 3300005459 Bacteria 3830
36 Ga0068867_100083999 3300005459 Bacteria 2405
37 Ga0070685_10320105 3300005466 Bacteria 1051
38 Ga0070706_100065147 3300005467 Bacteria 3369
39 Ga0070706_100318713 3300005467 Bacteria 1450
40 Ga0070707_100125232 3300005468 Bacteria 2496
41 Ga0070679_100080454 3300005530 Bacteria 3248
42 Ga0070684_100002014 3300005535 Bacteria 14950
43 Ga0070684_100086242 3300005535 Bacteria 2786
44 Ga0068853_100138728 3300005539 Bacteria 2182
45 Ga0070672_100062039 3300005543 Bacteria 2949
46 Ga0070672_100299294 3300005543 Bacteria 1363
47 Ga0070672_100329831 3300005543 Unclassified 1298
48 Ga0070695_100068603 3300005545 Bacteria 2316
49 Ga0070696_100010758 3300005546 Bacteria 6128
50 Ga0070696_100082893 3300005546 Bacteria 2273
51 Ga0070665_100110240 3300005548 Bacteria 2755
52 Ga0070704_100079292 3300005549 Bacteria 2412
53 Ga0070704_100232786 3300005549 Bacteria 1504
54 Ga0070704_100484964 3300005549 Bacteria 1070
55 Ga0068855_100524268 3300005563 Bacteria 1285
56 Ga0070664_100001191 3300005564 Bacteria 20716
57 Ga0068854_100013710 3300005578 Bacteria 5326
58 Ga0068854_100045861 3300005578 Bacteria 3110
59 Ga0068854_100126923 3300005578 Bacteria 1944
60 Ga0068854_100207942 3300005578 Bacteria 1542
61 Ga0070702_100003191 3300005615 Bacteria 7278
62 Ga0068859_100152401 3300005617 Bacteria 2387
63 Ga0068859_100200746 3300005617 Bacteria 2079
64 Ga0068864_100044705 3300005618 Bacteria 3798
65 Ga0068866_10013115 3300005718 Bacteria 3627
66 Ga0068861_100001737 3300005719 Bacteria 13978
67 Ga0068861_100451874 3300005719 Bacteria 1151
68 Ga0068858_100175777 3300005842 Bacteria 2020
69 Ga0068860_100214208 3300005843 Bacteria 1869
70 Ga0068862_100200401 3300005844 Bacteria 1799
71 Ga0081455_10042720 3300005937 Bacteria 3973
72 Ga0075364_10013245 3300006051 Bacteria 5063
73 Ga0075432_10060155 3300006058 Bacteria 1351
74 Ga0070716_100229342 3300006173 Bacteria 1253
75 Ga0075362_10004544 3300006177 Bacteria 4998
76 Ga0075370_10021198 3300006353 Bacteria 3560
77 Ga0068871_100009895 3300006358 Bacteria 6922
78 Ga0068871_100115152 3300006358 Bacteria 2266
79 Ga0068871_100211714 3300006358 Bacteria 1677
80 Ga0068871_100254051 3300006358 Bacteria 1532
81 Ga0075434_100016542 3300006871 Bacteria 7092
82 Ga0075434_100616360 3300006871 Bacteria 1104
83 Ga0075436_100007049 3300006914 Bacteria 7695
84 Ga0075436_100431751 3300006914 Bacteria 957
85 Ga0075436_100634746 3300006914 Unclassified 788
86 Ga0097620_100152399 3300006931 Bacteria 2387
87 Ga0097620_100200761 3300006931 Bacteria 2079
88 Ga0075435_100000777 3300007076 Bacteria 19802
89 Ga0075435_100008442 3300007076 Bacteria 7391
90 Ga0105240_10164242 3300009093 Bacteria 2635
91 Ga0111539_10636113 3300009094 Bacteria 1242
92 Ga0105245_10107288 3300009098 Bacteria 2593
93 Ga0114129_10036802 3300009147 Bacteria 6911
94 Ga0105243_10013928 3300009148 Bacteria 6086
95 Ga0105243_10042764 3300009148 Bacteria 3548
96 Ga0105243_10428156 3300009148 Bacteria 1236
97 Ga0105248_10047144 3300009177 Bacteria 4832
98 Ga0105248_10137875 3300009177 Bacteria 2752
99 Ga0105248_10964199 3300009177 Bacteria 963
100 Ga0105237_10004861 3300009545 Bacteria 15417
101 Ga0105238_10218624 3300009551 Bacteria 1881
102 Ga0105249_10149166 3300009553 Bacteria 2249
103 Ga0105249_10791751 3300009553 Bacteria 1012
104 Ga0105239_10030119 3300010375 Bacteria 5967
105 Ga0105239_10834383 3300010375 Bacteria 1057
106 Ga0105246_10673628 3300011119 Bacteria 903
107 Ga0157374_10024270 3300013296 Bacteria 5434
108 Ga0157378_10003933 3300013297 Bacteria 13145
109 Ga0157378_10351656 3300013297 Bacteria 1440
110 Ga0163162_10935856 3300013306 Bacteria 978
111 Ga0157375_11403661 3300013308 Bacteria 823
112 Ga0163163_10020594 3300014325 Bacteria 6215
113 Ga0157380_10031914 3300014326 Bacteria 4046
114 Ga0157377_10014509 3300014745 Bacteria 4010
115 Ga0207697_10005995 3300025315 Bacteria 5566
116 Ga0207682_10029547 3300025893 Bacteria 2192
117 Ga0207680_10209312 3300025903 Bacteria 1333
118 Ga0207645_10000346 3300025907 Bacteria 38743
119 Ga0207684_10215663 3300025910 Bacteria 1656
120 Ga0207684_10453166 3300025910 Bacteria 1101
121 Ga0207707_10309691 3300025912 Bacteria 1365
122 Ga0207695_10089395 3300025913 Bacteria 3097
123 Ga0207695_10129413 3300025913 Bacteria 2483
124 Ga0207695_10624914 3300025913 Bacteria 958
125 Ga0207671_10023595 3300025914 Bacteria 4638
126 Ga0207657_10144435 3300025919 Bacteria 1942
127 Ga0207649_10025052 3300025920 Bacteria 3474
128 Ga0207649_10159359 3300025920 Bacteria 1562
129 Ga0207681_10033899 3300025923 Bacteria 3353
130 Ga0207681_10038536 3300025923 Bacteria 3168
131 Ga0207681_10225699 3300025923 Bacteria 1451
132 Ga0207650_10013311 3300025925 Bacteria 5694
133 Ga0207650_10261134 3300025925 Bacteria 1405
134 Ga0207650_10648523 3300025925 Bacteria 890
135 Ga0207659_10105504 3300025926 Bacteria 2133
136 Ga0207659_10451484 3300025926 Bacteria 1083
137 Ga0207644_10050475 3300025931 Bacteria 2982
138 Ga0207644_10683707 3300025931 Bacteria 855
139 Ga0207706_10024686 3300025933 Bacteria 5387
140 Ga0207706_10183677 3300025933 Bacteria 1837
141 Ga0207709_10047838 3300025935 Bacteria 2603
142 Ga0207709_10142099 3300025935 Bacteria 1651
143 Ga0207709_10316949 3300025935 Bacteria 1166
144 Ga0207670_10039626 3300025936 Bacteria 3087
145 Ga0207669_10005240 3300025937 Bacteria 5798
146 Ga0207704_10106033 3300025938 Bacteria 1887
147 Ga0207665_10146972 3300025939 Bacteria 1685
148 Ga0207691_10166361 3300025940 Bacteria 1932
149 Ga0207691_10316902 3300025940 Unclassified 1337
150 Ga0207691_10446713 3300025940 Bacteria 1100
151 Ga0207711_10196994 3300025941 Bacteria 1837
152 Ga0207711_10321213 3300025941 Bacteria 1431
153 Ga0207689_10275860 3300025942 Bacteria 1392
154 Ga0207689_10334791 3300025942 Bacteria 1257
155 Ga0207661_10001718 3300025944 Bacteria 14980
156 Ga0207679_10002327 3300025945 Bacteria 11690
157 Ga0207651_10030454 3300025960 Bacteria 3436
158 Ga0207651_10151041 3300025960 Bacteria 1808
159 Ga0207712_10123151 3300025961 Bacteria 1965
160 Ga0207640_10025436 3300025981 Bacteria 3584
161 Ga0207640_10062630 3300025981 Bacteria 2468
162 Ga0207640_10154146 3300025981 Bacteria 1691
163 Ga0207658_10018258 3300025986 Bacteria 4840
164 Ga0207658_10474056 3300025986 Bacteria 1111
165 Ga0207677_10300957 3300026023 Bacteria 1325
166 Ga0207703_10158770 3300026035 Bacteria 1979
167 Ga0207639_10298470 3300026041 Bacteria 1423
168 Ga0207678_10042425 3300026067 Bacteria 3941
169 Ga0207678_10066544 3300026067 Bacteria 3094
170 Ga0207708_10002322 3300026075 Bacteria 13972
171 Ga0207708_10020497 3300026075 Bacteria 4986
172 Ga0207708_10628255 3300026075 Bacteria 912
173 Ga0207648_10001795 3300026089 Bacteria 23516
174 Ga0207648_10015634 3300026089 Bacteria 6970
175 Ga0207648_10077062 3300026089 Bacteria 2906
176 Ga0207648_10378959 3300026089 Bacteria 1279
177 Ga0207674_10056278 3300026116 Bacteria 3995
178 Ga0207674_10247379 3300026116 Bacteria 1730
179 Ga0207675_100011719 3300026118 Bacteria 8200
180 Ga0207675_100094067 3300026118 Unclassified 2819
181 Ga0207683_10023508 3300026121 Bacteria 5302
182 Ga0207683_10300359 3300026121 Unclassified 1469
183 Ga0207428_10020982 3300027907 Bacteria 5537
184 Ga0268266_10301762 3300028379 Bacteria 1494
185 Ga0268265_10791476 3300028380 Bacteria 923
186 Ga0307517_10230354 3300028786 Bacteria 1113
187 Ga0307515_10002885 3300028794 Bacteria 36551
188 Ga0307513_10017125 3300031456 Bacteria 8704
189 Ga0373930_0005938 3300034816 Bacteria 2048
190 Ga0373928_0004879 3300035084 Unclassified 2558
191 Ga0373951_0008928 3300035091 Unclassified 2259
192 Ga0373939_0178007 3300035114 Unclassified 791
193 Ga0373941_0005883 3300035115 Bacteria 2918
194 Ga0373942_0003380 3300035207 Bacteria 3750
195 Ga0373962_0007597 3300035242 Unclassified 2658
196 Ga0373931_0033644 3300035691 Bacteria 2657
197 Ga0373937_0278921 3300036401 Bacteria 1578
198 Ga0439465_0034636 3300041413 Bacteria 1617
199 Ga0439431_0012130 3300041997 Bacteria 1977
200 Ga0439442_027069 3300042002 Bacteria 1195
201 Ga0439460_0158806 3300042461 Bacteria 757
202 Ga0466963_0241286 3300044694 Bacteria 1267
203 Ga0466967_0758471 3300045976 Bacteria 962
204 Ga0495590_0028634 3300046457 Bacteria 1953
205 Ga0495632_0001731 3300046519 Bacteria 17729
206 Ga0495640_0454875 3300046533 Unclassified 782
207 Ga0495621_0100675 3300046539 Bacteria 1099
208 Ga0495668_0158152 3300046616 Bacteria 1241
209 Ga0495649_0002228 3300046694 Bacteria 13794
210 Ga0495660_0062130 3300046810 Bacteria 2003
211 Ga0495687_006886 3300047443 Bacteria 6847
212 Ga0496104_0065604 3300048907 Bacteria 3445
213 Ga0496105_0144033 3300048908 Bacteria 1960
214 Ga0496107_0513874 3300048910 Bacteria 888
215 Ga0496108_0005527 3300048911 Bacteria 10225
216 Ga0496109_0004989 3300048912 Bacteria 11082
217 Ga0496110_0018192 3300048913 Bacteria 5888
218 Ga0496111_0018723 3300048914 Bacteria 4800
219 Ga0496112_0000128 3300048915 Bacteria 47314
220 Ga0496112_0323327 3300048915 Bacteria 1487
221 Ga0496113_0109309 3300048916 Unclassified 2150
222 Ga0496113_0178941 3300048916 Bacteria 1681
223 Ga0496114_0357856 3300048917 Bacteria 1291
224 Ga0501031_0319133 3300049568 Bacteria 1007
225 Ga0501034_0528644 3300049571 Bacteria 1091
226 Ga0501039_0027993 3300049575 Bacteria 4336
227 Ga0501041_0159057 3300049577 Bacteria 1412
228 Ga0501042_0223717 3300049578 Bacteria 1357
229 Ga0501048_0139028 3300049582 Bacteria 1717
230 Ga0501071_0013363 3300049587 Bacteria 5594
231 Ga0501073_0468821 3300049589 Bacteria 871
232 Ga0501075_0071754 3300049591 Bacteria 2617
233 Ga0501076_0116491 3300049592 Bacteria 2162
234 Ga0501077_0376619 3300049593 Bacteria 907
235 Ga0501079_0277102 3300049741 Bacteria 1311
236 Ga0501045_0045656 3300049824 Bacteria 3189
237 nmdc:mga03683_91355_c1 3300050489 Bacteria 1328
238 nmdc:mga00v17_20526_c1 3300050491 Bacteria 3786
239 nmdc:mga06z11_8664_c1 3300050494 Bacteria 4255
240 nmdc:mga07m45_10728_c1 3300050496 Bacteria 4794
241 nmdc:mga07m45_91008_c1 3300050496 Bacteria 1748
242 nmdc:mga05p37_1086903_c1 3300050507 Bacteria 839
243 nmdc:mga05p37_191283_c1 3300050507 Unclassified 2484
244 nmdc:mga05p37_6587_c1 3300050507 Bacteria 13693
245 nmdc:mga08y16_47747_c1 3300050511 Bacteria 4481
246 nmdc:mga0n895_143163_c1 3300050512 Bacteria 2420
247 nmdc:mga0n895_250714_c1 3300050512 Bacteria 1797
248 nmdc:mga0n895_586422_c1 3300050512 Bacteria 1118
249 nmdc:mga0n895_70930_c1 3300050512 Bacteria 3453
250 nmdc:mga0rr50_16454_c1 3300050513 Bacteria 4915
251 nmdc:mga0rr50_220338_c1 3300050513 Bacteria 1566
252 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
253 nmdc:mga0rr50_34109_c1 3300050513 Bacteria 3642
254 nmdc:mga0rr50_46997_c1 3300050513 Bacteria 3181
255 nmdc:mga08x19_212314_c1 3300050514 Bacteria 1329
256 nmdc:mga08x19_21645_c2 3300050514 Bacteria 2565
257 nmdc:mga08x19_34992_c1 3300050514 Bacteria 3177
258 nmdc:mga08x19_588_c1 3300050514 Bacteria 23676
259 nmdc:mga0a205_129055_c1 3300050515 Bacteria 2429
260 nmdc:mga0a205_36432_c1 3300050515 Bacteria 4726
261 nmdc:mga0a205_403390_c1 3300050515 Bacteria 1231
262 Ga0495601_0354056 3300053077 Bacteria 954
263 Ga0500651_0121602 3300053093 Bacteria 1585
264 Ga0500658_0045031 3300053134 Bacteria 1782
265 Ga0500568_0012036 3300053139 Bacteria 3989
266 2816470586 2816332133 Bacteria 7249298
267 Ga0496108_0068014
268 Ga0065712_10071300
269 Ga0065707_10270197
270 Ga0070676_10006508
271 Ga0070676_10358833
272 Ga0070683_100001000
273 Ga0070670_100033902
274 Ga0068869_100221266
275 Ga0068869_100373724
276 Ga0070666_10010742
277 Ga0070666_10308854
278 Ga0070666_10452440
279 Ga0068868_100454918
280 Ga0070660_100120778
281 Ga0070689_100038526
282 Ga0070691_10036113
283 Ga0070661_100013334
284 Ga0070661_100211736
285 Ga0070669_100003701
286 Ga0070675_100015312
287 Ga0070675_100236204
288 Ga0070675_100632835
289 Ga0070671_100043997
290 Ga0070674_100048803
291 Ga0070667_100066579
292 Ga0070667_100496101
293 Ga0070709_10082617
294 Ga0070714_100055555
295 Ga0070700_100004383
296 Ga0070700_100281301
297 Ga0070708_100511636
298 Ga0070663_100097690
299 Ga0070662_100042727
300 Ga0070662_100408964
301 Ga0068867_100031485
302 Ga0068867_100083999
303 Ga0070685_10320105
304 Ga0070706_100065147
305 Ga0070706_100318713
306 Ga0070707_100125232
307 Ga0070679_100080454
308 Ga0070684_100002014
309 Ga0070684_100086242
310 Ga0068853_100138728
311 Ga0070672_100062039
312 Ga0070672_100299294
313 Ga0070672_100329831
314 Ga0070695_100068603
315 Ga0070696_100010758
316 Ga0070696_100082893
317 Ga0070665_100110240
318 Ga0070704_100079292
319 Ga0070704_100232786
320 Ga0070704_100484964
321 Ga0068855_100524268
322 Ga0070664_100001191
323 Ga0068854_100013710
324 Ga0068854_100045861
325 Ga0068854_100126923
326 Ga0068854_100207942
327 Ga0070702_100003191
328 Ga0068859_100152401
329 Ga0068859_100200746
330 Ga0068864_100044705
331 Ga0068866_10013115
332 Ga0068861_100001737
333 Ga0068861_100451874
334 Ga0068858_100175777
335 Ga0068860_100214208
336 Ga0068862_100200401
337 Ga0081455_10042720
338 Ga0075364_10013245
339 Ga0075432_10060155
340 Ga0070716_100229342
341 Ga0075362_10004544
342 Ga0075370_10021198
343 Ga0068871_100009895
344 Ga0068871_100115152
345 Ga0068871_100211714
346 Ga0068871_100254051
347 Ga0075434_100016542
348 Ga0075434_100616360
349 Ga0075436_100007049
350 Ga0075436_100431751
351 Ga0075436_100634746
352 Ga0097620_100152399
353 Ga0097620_100200761
354 Ga0075435_100000777
355 Ga0075435_100008442
356 Ga0105240_10164242
357 Ga0111539_10636113
358 Ga0105245_10107288
359 Ga0114129_10036802
360 Ga0105243_10013928
361 Ga0105243_10042764
362 Ga0105243_10428156
363 Ga0105248_10047144
364 Ga0105248_10137875
365 Ga0105248_10964199
366 Ga0105237_10004861
367 Ga0105238_10218624
368 Ga0105249_10149166
369 Ga0105249_10791751
370 Ga0105239_10030119
371 Ga0105239_10834383
372 Ga0105246_10673628
373 Ga0157374_10024270
374 Ga0157378_10003933
375 Ga0157378_10351656
376 Ga0163162_10935856
377 Ga0157375_11403661
378 Ga0163163_10020594
379 Ga0157380_10031914
380 Ga0157377_10014509
381 Ga0207697_10005995
382 Ga0207682_10029547
383 Ga0207680_10209312
384 Ga0207645_10000346
385 Ga0207684_10215663
386 Ga0207684_10453166
387 Ga0207707_10309691
388 Ga0207695_10089395
389 Ga0207695_10129413
390 Ga0207695_10624914
391 Ga0207671_10023595
392 Ga0207657_10144435
393 Ga0207649_10025052
394 Ga0207649_10159359
395 Ga0207681_10033899
396 Ga0207681_10038536
397 Ga0207681_10225699
398 Ga0207650_10013311
399 Ga0207650_10261134
400 Ga0207650_10648523
401 Ga0207659_10105504
402 Ga0207659_10451484
403 Ga0207644_10050475
404 Ga0207644_10683707
405 Ga0207706_10024686
406 Ga0207706_10183677
407 Ga0207709_10047838
408 Ga0207709_10142099
409 Ga0207709_10316949
410 Ga0207670_10039626
411 Ga0207669_10005240
412 Ga0207704_10106033
413 Ga0207665_10146972
414 Ga0207691_10166361
415 Ga0207691_10316902
416 Ga0207691_10446713
417 Ga0207711_10196994
418 Ga0207711_10321213
419 Ga0207689_10275860
420 Ga0207689_10334791
421 Ga0207661_10001718
422 Ga0207679_10002327
423 Ga0207651_10030454
424 Ga0207651_10151041
425 Ga0207712_10123151
426 Ga0207640_10025436
427 Ga0207640_10062630
428 Ga0207640_10154146
429 Ga0207658_10018258
430 Ga0207658_10474056
431 Ga0207677_10300957
432 Ga0207703_10158770
433 Ga0207639_10298470
434 Ga0207678_10042425
435 Ga0207678_10066544
436 Ga0207708_10002322
437 Ga0207708_10020497
438 Ga0207708_10628255
439 Ga0207648_10001795
440 Ga0207648_10015634
441 Ga0207648_10077062
442 Ga0207648_10378959
443 Ga0207674_10056278
444 Ga0207674_10247379
445 Ga0207675_100011719
446 Ga0207675_100094067
447 Ga0207683_10023508
448 Ga0207683_10300359
449 Ga0207428_10020982
450 Ga0268266_10301762
451 Ga0268265_10791476
452 Ga0307517_10230354
453 Ga0307515_10002885
454 Ga0307513_10017125
455 Ga0373930_0005938
456 Ga0373928_0004879
457 Ga0373951_0008928
458 Ga0373939_0178007
459 Ga0373941_0005883
460 Ga0373942_0003380
461 Ga0373962_0007597
462 Ga0373931_0033644
463 Ga0373937_0278921
464 Ga0439465_0034636
465 Ga0439431_0012130
466 Ga0439442_027069
467 Ga0439460_0158806
468 Ga0466963_0241286
469 Ga0466967_0758471
470 Ga0495590_0028634
471 Ga0495632_0001731
472 Ga0495640_0454875
473 Ga0495621_0100675
474 Ga0495668_0158152
475 Ga0495649_0002228
476 Ga0495660_0062130
477 Ga0495687_006886
478 Ga0496104_0065604
479 Ga0496105_0144033
480 Ga0496107_0513874
481 Ga0496108_0005527
482 Ga0496109_0004989
483 Ga0496110_0018192
484 Ga0496111_0018723
485 Ga0496112_0000128
486 Ga0496112_0323327
487 Ga0496113_0109309
488 Ga0496113_0178941
489 Ga0496114_0357856
490 Ga0501031_0319133
491 Ga0501034_0528644
492 Ga0501039_0027993
493 Ga0501041_0159057
494 Ga0501042_0223717
495 Ga0501048_0139028
496 Ga0501071_0013363
497 Ga0501073_0468821
498 Ga0501075_0071754
499 Ga0501076_0116491
500 Ga0501077_0376619
501 Ga0501079_0277102
502 Ga0501045_0045656
503 nmdc:mga03683_91355_c1
504 nmdc:mga00v17_20526_c1
505 nmdc:mga06z11_8664_c1
506 nmdc:mga07m45_10728_c1
507 nmdc:mga07m45_91008_c1
508 nmdc:mga05p37_1086903_c1
509 nmdc:mga05p37_191283_c1
510 nmdc:mga05p37_6587_c1
511 nmdc:mga08y16_47747_c1
512 nmdc:mga0n895_143163_c1
513 nmdc:mga0n895_250714_c1
514 nmdc:mga0n895_586422_c1
515 nmdc:mga0n895_70930_c1
516 nmdc:mga0rr50_16454_c1
517 nmdc:mga0rr50_220338_c1
518 nmdc:mga0rr50_27_c1
519 nmdc:mga0rr50_34109_c1
520 nmdc:mga0rr50_46997_c1
521 nmdc:mga08x19_212314_c1
522 nmdc:mga08x19_21645_c2
523 nmdc:mga08x19_34992_c1
524 nmdc:mga08x19_588_c1
525 nmdc:mga0a205_129055_c1
526 nmdc:mga0a205_36432_c1
527 nmdc:mga0a205_403390_c1
528 Ga0495601_0354056
529 Ga0500651_0121602
530 Ga0500658_0045031
531 Ga0500568_0012036
532 2816470586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01794

Ferric_reduct

Ferric reductase like transmembrane component

82

213

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tai-assembly1.cif.gz_A structure of steap2 in complex with ligands 0.6391 16 212
6y9b-assembly1.cif.gz_C cryo-em structure of trimeric human steap1 bound to three fab120.545 fragments 0.6308 14 213
6wxr-assembly1.cif.gz_A cryoem structure of mouse duox1-duoxa1 complex in the absence of nadph 0.6242 3 213
6wxr-assembly1.cif.gz_A cryoem structure of mouse duox1-duoxa1 complex in the absence of nadph 0.5941 3 213
5o0t-assembly1.cif.gz_A crystal structure of trans-membrane domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) 0.5861 4 213
ID Description Score Start End Superfamily
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9397 51 176 1.20.950.20
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8926 51 176 1.20.950.20
af_A0A1D8PQI6_121_240_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6954 51 180 1.20.950.20
af_Q55C03_152_358_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6941 40 209 1.20.120.1770
af_A0A1D8PQM2_150_271_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6918 48 180 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2V9HQU5-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9753 9 210 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A521WU73-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9739 1 212 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A524L2N2-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9703 11 210 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A7C7NZX2-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9691 11 208 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A3B0X2X9-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ 0.9683 12 209 GO:0005886
GO:0010181
GO:0016679
GO:0020037

Map