F374289

General Info

Members Datasets Scaffolds Average Seq Length
266 156 532 238

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0017534|Ga0495586_0017534_1610_2416
Length 260
Sequence MVGRSCCETGFAEGRHPMPLTGKAALISGAGGGICRAIALAFAKAGAAVACCDIDEAASTETARLITGAGGRSLSQGCDVARESDTLAVAAATHREFGRLDILVSGAAPHDPSGTVVETSLTDWQRVLDINLTGSFLLSRAVLPMMIFIASQLGRVGSARRAAYCATKGALIQLAKVMAIDHAADNIRVNTLSPGGVETQRTLNRYGSFSAAREQLGAKHLMGRLGRPDEIADAALFLAGDTASFVTGSDLLVDGGYTAI

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.38
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0017534 3300046535 Bacteria 3806
2 rootH1_10200199 3300003323 Bacteria 2520
3 Ga0070690_100324243 3300005330 Bacteria 1111
4 Ga0070690_100480689 3300005330 Bacteria 926
5 Ga0070669_100003059 3300005353 Bacteria 12030
6 Ga0070669_100339031 3300005353 Bacteria 1218
7 Ga0070671_100317558 3300005355 Bacteria 1327
8 Ga0070688_100392098 3300005365 Bacteria 1026
9 Ga0070714_100000072 3300005435 Bacteria 89816
10 Ga0070714_100145584 3300005435 Bacteria 2131
11 Ga0070713_100824819 3300005436 Unclassified 890
12 Ga0070710_10380497 3300005437 Bacteria 941
13 Ga0070694_100217968 3300005444 Bacteria 1430
14 Ga0070662_100040487 3300005457 Bacteria 3318
15 Ga0070681_10210173 3300005458 Bacteria 1862
16 Ga0070681_10302870 3300005458 Bacteria 1508
17 Ga0070681_10358365 3300005458 Bacteria 1369
18 Ga0068867_100112391 3300005459 Bacteria 2094
19 Ga0070685_10379833 3300005466 Bacteria 973
20 Ga0070706_100005030 3300005467 Bacteria 12643
21 Ga0070706_100021770 3300005467 Bacteria 5903
22 Ga0070707_100087543 3300005468 Bacteria 3013
23 Ga0070707_100104996 3300005468 Bacteria 2739
24 Ga0070698_100090699 3300005471 Bacteria 3039
25 Ga0070699_100034658 3300005518 Bacteria 4363
26 Ga0070699_100038243 3300005518 Bacteria 4155
27 Ga0070699_100157892 3300005518 Bacteria 2007
28 Ga0070679_100175873 3300005530 Bacteria 2113
29 Ga0070679_100476175 3300005530 Bacteria 1193
30 Ga0070697_100014895 3300005536 Bacteria 6103
31 Ga0070697_100260983 3300005536 Bacteria 1483
32 Ga0070672_100042179 3300005543 Bacteria 3512
33 Ga0070695_100087959 3300005545 Bacteria 2068
34 Ga0070695_100177543 3300005545 Bacteria 1507
35 Ga0070696_100195407 3300005546 Bacteria 1508
36 Ga0070693_100214424 3300005547 Bacteria 1258
37 Ga0068855_100202546 3300005563 Bacteria 2234
38 Ga0068856_100932523 3300005614 Bacteria 887
39 Ga0068859_100113993 3300005617 Bacteria 2767
40 Ga0068859_100514056 3300005617 Bacteria 1293
41 Ga0068864_100259943 3300005618 Bacteria 1615
42 Ga0068861_100154907 3300005719 Bacteria 1884
43 Ga0068861_100576477 3300005719 Bacteria 1029
44 Ga0068863_100385133 3300005841 Bacteria 1369
45 Ga0068863_100747439 3300005841 Bacteria 974
46 Ga0068858_100615475 3300005842 Bacteria 1054
47 Ga0068862_100668786 3300005844 Bacteria 1003
48 Ga0070717_10002051 3300006028 Bacteria 14114
49 Ga0070717_10846926 3300006028 Bacteria 832
50 Ga0070715_10008494 3300006163 Bacteria 3582
51 Ga0070712_100000180 3300006175 Bacteria 35079
52 Ga0070712_100038927 3300006175 Bacteria 3251
53 Ga0075428_100121641 3300006844 Bacteria 2842
54 Ga0075428_100522387 3300006844 Bacteria 1270
55 Ga0075430_100013380 3300006846 Bacteria 6992
56 Ga0075431_100005838 3300006847 Bacteria 12178
57 Ga0075431_100024827 3300006847 Bacteria 6145
58 Ga0075433_10016434 3300006852 Bacteria 6100
59 Ga0075433_10042580 3300006852 Bacteria 3940
60 Ga0075434_100024468 3300006871 Bacteria 5902
61 Ga0075434_100095787 3300006871 Bacteria 2973
62 Ga0075434_100238735 3300006871 Bacteria 1837
63 Ga0075434_100515233 3300006871 Bacteria 1216
64 Ga0075429_100004455 3300006880 Bacteria 12047
65 Ga0075429_100061405 3300006880 Bacteria 3274
66 Ga0075429_100129233 3300006880 Bacteria 2210
67 Ga0075436_100064494 3300006914 Bacteria 2532
68 Ga0097620_100113995 3300006931 Bacteria 2767
69 Ga0097620_100514038 3300006931 Bacteria 1293
70 Ga0075435_100025761 3300007076 Bacteria 4581
71 Ga0075435_100087682 3300007076 Bacteria 2564
72 Ga0075435_100141496 3300007076 Bacteria 2019
73 Ga0111539_10019877 3300009094 Bacteria 8275
74 Ga0111539_10153983 3300009094 Bacteria 2690
75 Ga0111539_10186741 3300009094 Bacteria 2420
76 Ga0105245_10979419 3300009098 Bacteria 889
77 Ga0105245_11155987 3300009098 Bacteria 821
78 Ga0114129_10005930 3300009147 Bacteria 17291
79 Ga0114129_10007139 3300009147 Bacteria 15899
80 Ga0114129_10106865 3300009147 Bacteria 3866
81 Ga0114129_10134757 3300009147 Bacteria 3389
82 Ga0114129_10148009 3300009147 Bacteria 3215
83 Ga0114129_10986717 3300009147 Bacteria 1062
84 Ga0105243_10061681 3300009148 Bacteria 2999
85 Ga0105241_10036911 3300009174 Bacteria 3679
86 Ga0105249_10068851 3300009553 Bacteria 3265
87 Ga0105249_10183468 3300009553 Bacteria 2037
88 Ga0105249_10795865 3300009553 Bacteria 1009
89 Ga0099796_10029011 3300010159 Bacteria 1781
90 Ga0157378_10045969 3300013297 Bacteria 3881
91 Ga0157378_10155643 3300013297 Bacteria 2133
92 Ga0163162_10061458 3300013306 Bacteria 3794
93 Ga0163163_10987489 3300014325 Bacteria 905
94 Ga0182008_10070283 3300014497 Bacteria 1722
95 Ga0157379_10135247 3300014968 Bacteria 2220
96 Ga0213875_10000240 3300021388 Bacteria 54823
97 Ga0213875_10000615 3300021388 Bacteria 28752
98 Ga0213875_10000621 3300021388 Bacteria 28423
99 Ga0207685_10094620 3300025905 Bacteria 1266
100 Ga0207699_10124248 3300025906 Bacteria 1673
101 Ga0207684_10006433 3300025910 Bacteria 10706
102 Ga0207684_10007284 3300025910 Bacteria 9977
103 Ga0207684_10041974 3300025910 Bacteria 3877
104 Ga0207654_10026204 3300025911 Bacteria 3154
105 Ga0207707_10159907 3300025912 Bacteria 1970
106 Ga0207707_10389327 3300025912 Bacteria 1197
107 Ga0207707_10400994 3300025912 Bacteria 1177
108 Ga0207693_10001393 3300025915 Bacteria 21414
109 Ga0207693_10002456 3300025915 Bacteria 16102
110 Ga0207660_10397295 3300025917 Bacteria 1110
111 Ga0207646_10057077 3300025922 Bacteria 3488
112 Ga0207646_10076465 3300025922 Bacteria 2991
113 Ga0207646_10254660 3300025922 Bacteria 1586
114 Ga0207681_10003212 3300025923 Bacteria 10258
115 Ga0207681_10504107 3300025923 Bacteria 991
116 Ga0207700_10011360 3300025928 Bacteria 5672
117 Ga0207664_10000013 3300025929 Bacteria 260716
118 Ga0207664_10091132 3300025929 Bacteria 2499
119 Ga0207664_10112762 3300025929 Bacteria 2264
120 Ga0207664_10499371 3300025929 Bacteria 1089
121 Ga0207706_10055069 3300025933 Bacteria 3509
122 Ga0207669_10696797 3300025937 Bacteria 834
123 Ga0207691_10061745 3300025940 Bacteria 3403
124 Ga0207689_10437344 3300025942 Bacteria 1092
125 Ga0207712_10027579 3300025961 Bacteria 3793
126 Ga0207658_10573077 3300025986 Bacteria 1012
127 Ga0207641_10056403 3300026088 Bacteria 3339
128 Ga0207648_10086836 3300026089 Bacteria 2729
129 Ga0207648_10156122 3300026089 Bacteria 2014
130 Ga0207675_100257895 3300026118 Bacteria 1689
131 Ga0207675_100688335 3300026118 Bacteria 1031
132 Ga0207428_10148425 3300027907 Bacteria 1786
133 Ga0207428_10386128 3300027907 Bacteria 1027
134 Ga0268265_10485734 3300028380 Bacteria 1161
135 Ga0268264_10357126 3300028381 Bacteria 1393
136 Ga0307408_100135996 3300031548 Bacteria 1923
137 Ga0307407_10431375 3300031903 Bacteria 952
138 Ga0307412_10034623 3300031911 Bacteria 3220
139 Ga0307416_100079908 3300032002 Bacteria 2758
140 Ga0307416_100119529 3300032002 Bacteria 2344
141 Ga0307411_10008366 3300032005 Bacteria 5354
142 Ga0373926_0052170 3300035083 Bacteria 1477
143 Ga0373940_0001555 3300035088 Bacteria 4199
144 Ga0373949_0021374 3300035090 Bacteria 1487
145 Ga0373932_0011891 3300035112 Bacteria 2135
146 Ga0373953_0067293 3300035117 Bacteria 1473
147 Ga0373954_0007432 3300035118 Bacteria 4795
148 Ga0373957_0081476 3300035120 Bacteria 1278
149 Ga0373955_0178764 3300035172 Bacteria 1258
150 Ga0373931_0141363 3300035691 Bacteria 1394
151 Ga0373933_0143478 3300035724 Bacteria 1509
152 Ga0373933_0151800 3300035724 Bacteria 1467
153 Ga0373947_0370859 3300035725 Bacteria 963
154 Ga0373937_0045608 3300036401 Bacteria 4006
155 Ga0373937_0091879 3300036401 Bacteria 2812
156 Ga0373937_0358935 3300036401 Bacteria 1381
157 Ga0436364_0309006 3300037853 Bacteria 1000
158 Ga0436364_0335253 3300037853 Bacteria 76277
159 Ga0436364_0679410 3300037853 Bacteria 855
160 Ga0436364_0892255 3300037853 Bacteria 46954
161 Ga0436364_1534409 3300037853 Bacteria 67186
162 Ga0242420_007241 3300038996 Bacteria 1776
163 Ga0242420_040005 3300038996 Bacteria 894
164 Ga0436365_0410838 3300039437 Bacteria 1104
165 Ga0436365_0805693 3300039437 Bacteria 4432
166 Ga0436365_1711220 3300039437 Bacteria 1415
167 Ga0436363_0126711 3300039450 Bacteria 1339
168 Ga0436362_0249079 3300039453 Bacteria 1650
169 Ga0436362_1173873 3300039453 Bacteria 5531
170 Ga0453683_0152430 3300044673 Bacteria 1461
171 Ga0451576_0062271 3300045051 Bacteria 3890
172 Ga0466967_0284928 3300045976 Bacteria 1586
173 Ga0466967_0407499 3300045976 Bacteria 1324
174 Ga0495592_0032236 3300046454 Bacteria 3955
175 Ga0495629_0331816 3300046459 Bacteria 1039
176 Ga0495580_0007875 3300046472 Bacteria 8525
177 Ga0495580_0189343 3300046472 Bacteria 1419
178 Ga0495666_0198382 3300046526 Bacteria 923
179 Ga0495640_0183167 3300046533 Bacteria 1334
180 Ga0495667_0018383 3300046559 Bacteria 4721
181 Ga0495635_0022277 3300046663 Bacteria 4411
182 Ga0495599_0183578 3300046678 Bacteria 1289
183 Ga0495669_0054194 3300046684 Bacteria 1805
184 Ga0495600_0159055 3300046809 Bacteria 1461
185 Ga0495684_0221260 3300047471 Bacteria 1388
186 Ga0495593_0066491 3300047673 Bacteria 1879
187 Ga0496104_0000470 3300048907 Bacteria 34682
188 Ga0496105_0026181 3300048908 Bacteria 4755
189 Ga0496106_0112016 3300048909 Bacteria 2126
190 Ga0496108_0407899 3300048911 Bacteria 1187
191 Ga0496111_0179827 3300048914 Bacteria 1572
192 Ga0496112_0052766 3300048915 Bacteria 3991
193 Ga0496112_0089921 3300048915 Bacteria 3039
194 Ga0496113_0163251 3300048916 Bacteria 1762
195 Ga0496114_0068383 3300048917 Bacteria 2982
196 Ga0501038_0233446 3300049574 Bacteria 1463
197 Ga0501039_0200554 3300049575 Bacteria 1569
198 Ga0501040_0043333 3300049576 Bacteria 3067
199 Ga0501041_0415727 3300049577 Bacteria 852
200 Ga0501042_0521440 3300049578 Bacteria 863
201 Ga0501046_0153540 3300049580 Bacteria 1736
202 Ga0501071_0065851 3300049587 Bacteria 2632
203 Ga0501072_0000906 3300049588 Bacteria 21764
204 Ga0501072_0087281 3300049588 Bacteria 2475
205 Ga0501072_0087755 3300049588 Bacteria 2469
206 Ga0501075_0004692 3300049591 Bacteria 9279
207 Ga0501075_0225793 3300049591 Bacteria 1428
208 Ga0501075_0248289 3300049591 Bacteria 1356
209 Ga0501076_0013573 3300049592 Bacteria 6109
210 Ga0501076_0037663 3300049592 Bacteria 3794
211 Ga0501076_0122775 3300049592 Bacteria 2103
212 Ga0501076_0141586 3300049592 Bacteria 1954
213 Ga0501076_0199112 3300049592 Bacteria 1635
214 Ga0501077_0010932 3300049593 Bacteria 5657
215 Ga0501077_0030490 3300049593 Bacteria 3431
216 Ga0501079_0001495 3300049741 Bacteria 16543
217 Ga0501079_0097580 3300049741 Bacteria 2278
218 Ga0501079_0164982 3300049741 Bacteria 1727
219 Ga0501080_0296352 3300049742 Bacteria 1468
220 Ga0501080_0477560 3300049742 Bacteria 1116
221 Ga0501081_0002172 3300049743 Bacteria 12318
222 Ga0501081_0027599 3300049743 Bacteria 3828
223 Ga0501081_0189859 3300049743 Bacteria 1488
224 Ga0501035_0546917 3300049822 Bacteria 949
225 Ga0501045_0106308 3300049824 Bacteria 2080
226 nmdc:mga05p37_25587_c1 3300050507 Bacteria 7179
227 nmdc:mga05p37_39675_c1 3300050507 Bacteria 5781
228 nmdc:mga05p37_42542_c1 3300050507 Bacteria 5583
229 nmdc:mga05p37_496954_c1 3300050507 Unclassified 1401
230 nmdc:mga09592_13369_c1 3300050508 Bacteria 6703
231 nmdc:mga09592_305282_c1 3300050508 Bacteria 1380
232 nmdc:mga09592_3910_c1 3300050508 Bacteria 11998
233 nmdc:mga0qj67_108316_c1 3300050509 Bacteria 2242
234 nmdc:mga0qj67_30988_c1 3300050509 Bacteria 4164
235 nmdc:mga06r32_133502_c1 3300050510 Bacteria 2456
236 nmdc:mga06r32_14260_c1 3300050510 Bacteria 7208
237 nmdc:mga06r32_288565_c1 3300050510 Bacteria 1628
238 nmdc:mga06r32_42856_c1 3300050510 Bacteria 4305
239 nmdc:mga08y16_177876_c1 3300050511 Bacteria 2209
240 nmdc:mga08y16_239721_c1 3300050511 Bacteria 1875
241 nmdc:mga08y16_41826_c1 3300050511 Bacteria 4800
242 nmdc:mga0n895_118728_c1 3300050512 Bacteria 2665
243 nmdc:mga0n895_12249_c1 3300050512 Bacteria 7686
244 nmdc:mga0n895_141621_c1 3300050512 Bacteria 2433
245 nmdc:mga0n895_30746_c1 3300050512 Bacteria 5135
246 nmdc:mga0rr50_21167_c1 3300050513 Bacteria 4434
247 nmdc:mga0rr50_31033_c1 3300050513 Bacteria 3790
248 nmdc:mga08x19_59169_c1 3300050514 Bacteria 2480
249 nmdc:mga0a205_173169_c1 3300050515 Bacteria 2054
250 nmdc:mga0a205_17387_c1 3300050515 Bacteria 6739
251 nmdc:mga0a205_46713_c1 3300050515 Bacteria 4176
252 nmdc:mga0a205_58382_c1 3300050515 Bacteria 3727
253 nmdc:mga0a205_627988_c1 3300050515 Bacteria 926
254 Ga0495601_0064864 3300053077 Bacteria 2323
255 Ga0495601_0408037 3300053077 Bacteria 880
256 Ga0495595_0266258 3300053084 Bacteria 859
257 Ga0495619_0000759 3300053085 Bacteria 21040
258 Ga0495619_0022243 3300053085 Bacteria 4055
259 Ga0495619_0391015 3300053085 Bacteria 961
260 Ga0501084_0007314 3300054114 Bacteria 9094
261 Ga0501084_0347378 3300054114 Bacteria 1253
262 Ga0501082_0008158 3300060353 Bacteria 9035
263 Ga0501082_0047698 3300060353 Bacteria 3691
264 Ga0501082_0080703 3300060353 Bacteria 2807
265 Ga0530510_0024312 3300061734 Bacteria 4321
266 Ga0530510_0138218 3300061734 Bacteria 1794
267 Ga0495586_0017534
268 rootH1_10200199
269 Ga0070690_100324243
270 Ga0070690_100480689
271 Ga0070669_100003059
272 Ga0070669_100339031
273 Ga0070671_100317558
274 Ga0070688_100392098
275 Ga0070714_100000072
276 Ga0070714_100145584
277 Ga0070713_100824819
278 Ga0070710_10380497
279 Ga0070694_100217968
280 Ga0070662_100040487
281 Ga0070681_10210173
282 Ga0070681_10302870
283 Ga0070681_10358365
284 Ga0068867_100112391
285 Ga0070685_10379833
286 Ga0070706_100005030
287 Ga0070706_100021770
288 Ga0070707_100087543
289 Ga0070707_100104996
290 Ga0070698_100090699
291 Ga0070699_100034658
292 Ga0070699_100038243
293 Ga0070699_100157892
294 Ga0070679_100175873
295 Ga0070679_100476175
296 Ga0070697_100014895
297 Ga0070697_100260983
298 Ga0070672_100042179
299 Ga0070695_100087959
300 Ga0070695_100177543
301 Ga0070696_100195407
302 Ga0070693_100214424
303 Ga0068855_100202546
304 Ga0068856_100932523
305 Ga0068859_100113993
306 Ga0068859_100514056
307 Ga0068864_100259943
308 Ga0068861_100154907
309 Ga0068861_100576477
310 Ga0068863_100385133
311 Ga0068863_100747439
312 Ga0068858_100615475
313 Ga0068862_100668786
314 Ga0070717_10002051
315 Ga0070717_10846926
316 Ga0070715_10008494
317 Ga0070712_100000180
318 Ga0070712_100038927
319 Ga0075428_100121641
320 Ga0075428_100522387
321 Ga0075430_100013380
322 Ga0075431_100005838
323 Ga0075431_100024827
324 Ga0075433_10016434
325 Ga0075433_10042580
326 Ga0075434_100024468
327 Ga0075434_100095787
328 Ga0075434_100238735
329 Ga0075434_100515233
330 Ga0075429_100004455
331 Ga0075429_100061405
332 Ga0075429_100129233
333 Ga0075436_100064494
334 Ga0097620_100113995
335 Ga0097620_100514038
336 Ga0075435_100025761
337 Ga0075435_100087682
338 Ga0075435_100141496
339 Ga0111539_10019877
340 Ga0111539_10153983
341 Ga0111539_10186741
342 Ga0105245_10979419
343 Ga0105245_11155987
344 Ga0114129_10005930
345 Ga0114129_10007139
346 Ga0114129_10106865
347 Ga0114129_10134757
348 Ga0114129_10148009
349 Ga0114129_10986717
350 Ga0105243_10061681
351 Ga0105241_10036911
352 Ga0105249_10068851
353 Ga0105249_10183468
354 Ga0105249_10795865
355 Ga0099796_10029011
356 Ga0157378_10045969
357 Ga0157378_10155643
358 Ga0163162_10061458
359 Ga0163163_10987489
360 Ga0182008_10070283
361 Ga0157379_10135247
362 Ga0213875_10000240
363 Ga0213875_10000615
364 Ga0213875_10000621
365 Ga0207685_10094620
366 Ga0207699_10124248
367 Ga0207684_10006433
368 Ga0207684_10007284
369 Ga0207684_10041974
370 Ga0207654_10026204
371 Ga0207707_10159907
372 Ga0207707_10389327
373 Ga0207707_10400994
374 Ga0207693_10001393
375 Ga0207693_10002456
376 Ga0207660_10397295
377 Ga0207646_10057077
378 Ga0207646_10076465
379 Ga0207646_10254660
380 Ga0207681_10003212
381 Ga0207681_10504107
382 Ga0207700_10011360
383 Ga0207664_10000013
384 Ga0207664_10091132
385 Ga0207664_10112762
386 Ga0207664_10499371
387 Ga0207706_10055069
388 Ga0207669_10696797
389 Ga0207691_10061745
390 Ga0207689_10437344
391 Ga0207712_10027579
392 Ga0207658_10573077
393 Ga0207641_10056403
394 Ga0207648_10086836
395 Ga0207648_10156122
396 Ga0207675_100257895
397 Ga0207675_100688335
398 Ga0207428_10148425
399 Ga0207428_10386128
400 Ga0268265_10485734
401 Ga0268264_10357126
402 Ga0307408_100135996
403 Ga0307407_10431375
404 Ga0307412_10034623
405 Ga0307416_100079908
406 Ga0307416_100119529
407 Ga0307411_10008366
408 Ga0373926_0052170
409 Ga0373940_0001555
410 Ga0373949_0021374
411 Ga0373932_0011891
412 Ga0373953_0067293
413 Ga0373954_0007432
414 Ga0373957_0081476
415 Ga0373955_0178764
416 Ga0373931_0141363
417 Ga0373933_0143478
418 Ga0373933_0151800
419 Ga0373947_0370859
420 Ga0373937_0045608
421 Ga0373937_0091879
422 Ga0373937_0358935
423 Ga0436364_0309006
424 Ga0436364_0335253
425 Ga0436364_0679410
426 Ga0436364_0892255
427 Ga0436364_1534409
428 Ga0242420_007241
429 Ga0242420_040005
430 Ga0436365_0410838
431 Ga0436365_0805693
432 Ga0436365_1711220
433 Ga0436363_0126711
434 Ga0436362_0249079
435 Ga0436362_1173873
436 Ga0453683_0152430
437 Ga0451576_0062271
438 Ga0466967_0284928
439 Ga0466967_0407499
440 Ga0495592_0032236
441 Ga0495629_0331816
442 Ga0495580_0007875
443 Ga0495580_0189343
444 Ga0495666_0198382
445 Ga0495640_0183167
446 Ga0495667_0018383
447 Ga0495635_0022277
448 Ga0495599_0183578
449 Ga0495669_0054194
450 Ga0495600_0159055
451 Ga0495684_0221260
452 Ga0495593_0066491
453 Ga0496104_0000470
454 Ga0496105_0026181
455 Ga0496106_0112016
456 Ga0496108_0407899
457 Ga0496111_0179827
458 Ga0496112_0052766
459 Ga0496112_0089921
460 Ga0496113_0163251
461 Ga0496114_0068383
462 Ga0501038_0233446
463 Ga0501039_0200554
464 Ga0501040_0043333
465 Ga0501041_0415727
466 Ga0501042_0521440
467 Ga0501046_0153540
468 Ga0501071_0065851
469 Ga0501072_0000906
470 Ga0501072_0087281
471 Ga0501072_0087755
472 Ga0501075_0004692
473 Ga0501075_0225793
474 Ga0501075_0248289
475 Ga0501076_0013573
476 Ga0501076_0037663
477 Ga0501076_0122775
478 Ga0501076_0141586
479 Ga0501076_0199112
480 Ga0501077_0010932
481 Ga0501077_0030490
482 Ga0501079_0001495
483 Ga0501079_0097580
484 Ga0501079_0164982
485 Ga0501080_0296352
486 Ga0501080_0477560
487 Ga0501081_0002172
488 Ga0501081_0027599
489 Ga0501081_0189859
490 Ga0501035_0546917
491 Ga0501045_0106308
492 nmdc:mga05p37_25587_c1
493 nmdc:mga05p37_39675_c1
494 nmdc:mga05p37_42542_c1
495 nmdc:mga05p37_496954_c1
496 nmdc:mga09592_13369_c1
497 nmdc:mga09592_305282_c1
498 nmdc:mga09592_3910_c1
499 nmdc:mga0qj67_108316_c1
500 nmdc:mga0qj67_30988_c1
501 nmdc:mga06r32_133502_c1
502 nmdc:mga06r32_14260_c1
503 nmdc:mga06r32_288565_c1
504 nmdc:mga06r32_42856_c1
505 nmdc:mga08y16_177876_c1
506 nmdc:mga08y16_239721_c1
507 nmdc:mga08y16_41826_c1
508 nmdc:mga0n895_118728_c1
509 nmdc:mga0n895_12249_c1
510 nmdc:mga0n895_141621_c1
511 nmdc:mga0n895_30746_c1
512 nmdc:mga0rr50_21167_c1
513 nmdc:mga0rr50_31033_c1
514 nmdc:mga08x19_59169_c1
515 nmdc:mga0a205_173169_c1
516 nmdc:mga0a205_17387_c1
517 nmdc:mga0a205_46713_c1
518 nmdc:mga0a205_58382_c1
519 nmdc:mga0a205_627988_c1
520 Ga0495601_0064864
521 Ga0495601_0408037
522 Ga0495595_0266258
523 Ga0495619_0000759
524 Ga0495619_0022243
525 Ga0495619_0391015
526 Ga0501084_0007314
527 Ga0501084_0347378
528 Ga0501082_0008158
529 Ga0501082_0047698
530 Ga0501082_0080703
531 Ga0530510_0024312
532 Ga0530510_0138218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

206

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

258

0.95

PF08659

KR

KR domain

24

187

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t7c-assembly1.cif.gz_B crystal structure of carveol dehydrogenase from mycobacterium avium bound to nad 0.9464 23 227
7v1r-assembly1.cif.gz_B leifsonia alcohol dehydrogenases lnadh 0.9446 23 231
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9407 12 226
3oec-assembly1.cif.gz_A crystal structure of carveol dehydrogenase from mycobacterium thermoresistibile 0.9403 23 226
3oec-assembly1.cif.gz_D crystal structure of carveol dehydrogenase from mycobacterium thermoresistibile 0.9399 23 226
ID Description Score Start End Superfamily
3t7cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 23 227 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 76 171 3.40.50.720
3oecB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 23 226 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9354 23 231 3.40.50.720
af_Q2FVE2_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9327 42 230 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L8E3I0-F1-model_v4 SDR family oxidoreductase 0.9829 28 231 GO:0016491
AF-A0A2K2V898-F1-model_v4 Short-chain dehydrogenase 0.974 26 226
AF-A0A284VTZ5-F1-model_v4 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (EC 1.1.1.-) 0.9699 23 231 GO:0016491
AF-A0A1X0ID11-F1-model_v4 Short-chain dehydrogenase 0.9697 23 226 GO:0016491
AF-A0A6L8E3I0-F1-model_v4 SDR family oxidoreductase 0.9688 28 231 GO:0016491

Map