F374169

General Info

Members Datasets Scaffolds Average Seq Length
266 211 195 317

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10246459|Ga0307513_102464592
Length 382
Sequence MAATLALRLRGARWVAGETVPFDRIGQENETIGRANRRTRSHLSVRPAPDPDNLKFWETIIMTNIFGATSTTDAVLAGIDLAGKRILVTGVSAGLGVETARTLVAHGADVVGAARDLDKARAATAVVRDAAEAGRGSLELVELDLASLASVRACADALVADGRRFDVVIANAGVMACPQGRTADGFETQFGTNHLGHFVLVNRIAALIEPGGRLVNLSSAGHRYADVDLDDPDFEHTPYEEFVAYGRSKTANILFALEFDRRHRHDGIRATAVHPGGIQTELGRHMTQDVHDALIKSINETQLAAGAPAFTYKSIPQGAATSVWAAIVAEPDAIGGHYCEDCHVADIQEGDGLRGGVRPYAQDAERAKALWAKSEEMVGERF

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
5 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
8 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
9 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
10 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
13 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
14 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
15 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
16 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
17 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
18 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
19 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
20 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
21 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
22 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
23 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
24 2791355266 Rhizobium sp. L43 Isolate Nodule
25 2802429633 Rhizobium anhuiense J3 Isolate Nodule
26 2802429634 Rhizobium anhuiense S10 Isolate Nodule
27 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
28 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
29 2802429637 Rhizobium anhuiense C15 Isolate Nodule
30 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
31 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
32 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
33 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
34 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
35 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
36 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
37 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
38 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
39 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
40 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
41 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
42 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
43 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
44 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
45 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
46 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
47 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
48 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
49 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
50 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
51 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
52 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
53 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
54 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
55 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
56 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
57 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
58 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
59 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
60 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
61 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
62 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
63 2936381700 Rhizobium chutanense C16 Isolate Unclassified
64 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
128 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
143 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
144 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
145 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
146 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
147 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
189 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
205 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
206 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
207 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
208 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
209 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
210 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
211 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.18
Metatranscriptomes 1.13
Isolates 26.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.08
Nodule 21.43
Rhizoplane 0.38
Rhizosphere 37.59
Stem 0
Stem Tuber 0
Unclassified 7.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000050 3300002739 Bacteria 27257
2 JGI25158J39367_1000062 3300002739 Bacteria 24133
3 JGI25152J39213_1012279 3300002773 Bacteria 1847
4 JGI25159J45721_1000293 3300002987 Bacteria 23430
5 JGI25151J46595_10001450 3300003187 Bacteria 16080
6 JGI25151J46595_10003717 3300003187 Bacteria 8292
7 JGI25153J46596_10013324 3300003215 Bacteria 3480
8 JGI25153J46596_10015539 3300003215 Bacteria 3094
9 JGI25153J46596_10023809 3300003215 Bacteria 2222
10 JGI25161J50226_1000055 3300003374 Bacteria 104131
11 JGI25161J50226_1005374 3300003374 Bacteria 2493
12 Ga0055526_1004543 3300003771 Bacteria 8297
13 Ga0055526_1020816 3300003771 Bacteria 2312
14 Ga0055524_1010182 3300003775 Bacteria 3761
15 Ga0055524_1019001 3300003775 Bacteria 2365
16 Ga0055528_1003737 3300003790 Bacteria 7510
17 Ga0055528_1006581 3300003790 Bacteria 5257
18 Ga0055530_10003235 3300003791 Bacteria 9510
19 Ga0055540_1002600 3300003792 Bacteria 9399
20 Ga0055531_10001982 3300003794 Bacteria 14249
21 Ga0055543_1000032 3300004625 Bacteria 130218
22 Ga0055543_1001284 3300004625 Bacteria 10327
23 Ga0065165_1001424 3300005262 Bacteria 25970
24 Ga0065165_1012220 3300005262 Bacteria 3512
25 Ga0070658_10120499 3300005327 Bacteria 2180
26 Ga0070676_10238885 3300005328 Unclassified 1207
27 Ga0070694_100025054 3300005444 Bacteria 3856
28 Ga0070678_100209226 3300005456 Unclassified 1615
29 Ga0070662_100005245 3300005457 Bacteria 8270
30 Ga0068867_100026731 3300005459 Bacteria 4145
31 Ga0070672_100198427 3300005543 Unclassified 1677
32 Ga0070695_100122230 3300005545 Bacteria 1783
33 Ga0070665_100000323 3300005548 Bacteria 73605
34 Ga0068862_100044332 3300005844 Bacteria 3793
35 Ga0075365_10041368 3300006038 Bacteria 3010
36 Ga0075362_10001370 3300006177 Bacteria 7725
37 Ga0075366_10140085 3300006195 Bacteria 1462
38 Ga0075370_10007341 3300006353 Bacteria 5611
39 Ga0075370_10102836 3300006353 Bacteria 1655
40 Ga0075428_100075582 3300006844 Bacteria 3678
41 Ga0075430_100063112 3300006846 Bacteria 3112
42 Ga0075431_100242383 3300006847 Bacteria 1833
43 Ga0075429_100099037 3300006880 Bacteria 2543
44 Ga0075429_100246684 3300006880 Unclassified 1564
45 Ga0105237_10000035 3300009545 Bacteria 191204
46 Ga0105237_10411263 3300009545 Bacteria 1358
47 Ga0105238_10098781 3300009551 Bacteria 2903
48 Ga0105238_10177470 3300009551 Bacteria 2107
49 Ga0105239_10005920 3300010375 Bacteria 14237
50 Ga0213872_10000995 3300021361 Bacteria 19804
51 Ga0213872_10034070 3300021361 Bacteria 2332
52 Ga0209436_100001 3300025208 Bacteria 304543
53 Ga0207425_1002139 3300025245 Bacteria 7248
54 Ga0209129_1000750 3300025258 Bacteria 20640
55 Ga0209129_1000880 3300025258 Bacteria 18487
56 Ga0209233_1019172 3300025261 Bacteria 1824
57 Ga0209673_1004376 3300025273 Bacteria 7608
58 Ga0209673_1009464 3300025273 Bacteria 4216
59 Ga0209673_1013657 3300025273 Bacteria 3194
60 Ga0209130_1000004 3300025284 Bacteria 633436
61 Ga0209025_1000572 3300025294 Bacteria 66863
62 Ga0209564_1000375 3300025295 Bacteria 82204
63 Ga0209564_1000570 3300025295 Bacteria 58555
64 Ga0209758_1000342 3300025297 Bacteria 86095
65 Ga0209758_1000468 3300025297 Bacteria 66625
66 Ga0209758_1003958 3300025297 Bacteria 12853
67 Ga0209758_1008854 3300025297 Bacteria 6401
68 Ga0209050_1000173 3300025298 Bacteria 149800
69 Ga0209050_1031566 3300025298 Bacteria 1649
70 Ga0209256_1005734 3300025299 Bacteria 6963
71 Ga0209256_1015079 3300025299 Bacteria 2728
72 Ga0209256_1026986 3300025299 Bacteria 1644
73 Ga0207426_1000003 3300025302 Bacteria 1063212
74 Ga0207426_1000039 3300025302 Bacteria 439937
75 Ga0209051_1007905 3300025303 Bacteria 5732
76 Ga0209051_1013804 3300025303 Bacteria 3814
77 Ga0209257_1000196 3300025304 Bacteria 149656
78 Ga0209257_1002159 3300025304 Bacteria 20430
79 Ga0207645_10003049 3300025907 Bacteria 12887
80 Ga0207671_10000183 3300025914 Bacteria 96107
81 Ga0207660_10062633 3300025917 Bacteria 2680
82 Ga0207657_10139975 3300025919 Bacteria 1978
83 Ga0207649_10041554 3300025920 Bacteria 2799
84 Ga0207694_10000011 3300025924 Bacteria 417640
85 Ga0207694_10062311 3300025924 Bacteria 2904
86 Ga0207706_10002895 3300025933 Bacteria 16601
87 Ga0207691_10048226 3300025940 Bacteria 3906
88 Ga0207708_10022219 3300026075 Bacteria 4790
89 Ga0207648_10001568 3300026089 Bacteria 25093
90 Ga0207675_100006492 3300026118 Bacteria 11064
91 Ga0209971_1001881 3300027682 Bacteria 5136
92 Ga0209998_10003593 3300027717 Bacteria 3375
93 Ga0265354_1000908 3300028016 Bacteria 4709
94 Ga0265355_1000625 3300028036 Bacteria 1961
95 Ga0268266_10000002 3300028379 Bacteria 3059047
96 Ga0265770_1000457 3300030878 Bacteria 5622
97 Ga0265760_10000065 3300031090 Bacteria 28698
98 Ga0265760_10028372 3300031090 Bacteria 1642
99 Ga0265330_10108884 3300031235 Bacteria 1184
100 Ga0265325_10083988 3300031241 Bacteria 1579
101 Ga0265331_10040001 3300031250 Bacteria 2283
102 Ga0265331_10091445 3300031250 Bacteria 1406
103 Ga0265327_10000280 3300031251 Bacteria 100757
104 Ga0265327_10000721 3300031251 Bacteria 51910
105 Ga0307513_10009063 3300031456 Bacteria 12618
106 Ga0307513_10246459 3300031456 Bacteria 1586
107 Ga0265342_10018411 3300031712 Bacteria 4525
108 Ga0373926_0099797 3300035083 Bacteria 1085
109 Ga0395899_0060850 3300037312 Bacteria 2782
110 Ga0395905_0110336 3300037471 Bacteria 2583
111 Ga0395905_0452947 3300037471 Bacteria 1181
112 Ga0439465_0012034 3300041413 Bacteria 2709
113 Ga0451835_1113860 3300041492 Bacteria 1811
114 Ga0451847_0380723 3300041503 Bacteria 1426
115 Ga0451851_0020516 3300041507 Bacteria 1981
116 Ga0451855_0468942 3300041511 Bacteria 2599
117 Ga0450921_000896 3300042123 Bacteria 1627
118 Ga0450896_003925 3300042133 Bacteria 1999
119 Ga0495650_0038046 3300046471 Bacteria 2088
120 Ga0495584_0028815 3300046491 Bacteria 2815
121 Ga0495585_0085424 3300046492 Bacteria 1705
122 Ga0495596_0052636 3300046500 Bacteria 1594
123 Ga0495607_0033946 3300046501 Bacteria 3100
124 Ga0495583_0000001 3300046506 Bacteria 811973
125 Ga0495610_0043779 3300046512 Bacteria 2227
126 Ga0495616_0000014 3300046513 Bacteria 191010
127 Ga0495616_0000192 3300046513 Bacteria 50986
128 Ga0495616_0077002 3300046513 Bacteria 1602
129 Ga0495631_0033526 3300046518 Bacteria 2306
130 Ga0495631_0041104 3300046518 Bacteria 2047
131 Ga0495632_0021240 3300046519 Bacteria 3501
132 Ga0495643_0013430 3300046522 Bacteria 4902
133 Ga0495643_0059993 3300046522 Bacteria 2020
134 Ga0495648_0009410 3300046524 Bacteria 7579
135 Ga0495642_0042399 3300046528 Bacteria 1854
136 Ga0495654_0094002 3300046530 Bacteria 1388
137 Ga0495597_0019765 3300046542 Bacteria 3146
138 Ga0495633_0027727 3300046558 Bacteria 2766
139 Ga0495668_0000053 3300046616 Bacteria 209976
140 Ga0495668_0000072 3300046616 Bacteria 167170
141 Ga0495668_0001387 3300046616 Bacteria 23588
142 Ga0495668_0005187 3300046616 Bacteria 8947
143 Ga0495668_0041508 3300046616 Bacteria 2562
144 Ga0495625_0088124 3300046660 Bacteria 2150
145 Ga0495680_0154597 3300047322 Bacteria 1670
146 Ga0495677_0004346 3300047445 Bacteria 5444
147 Ga0495686_0025722 3300047472 Bacteria 3856
148 Ga0495615_0033404 3300048090 Bacteria 1246
149 Ga0495626_0042346 3300048091 Bacteria 2139
150 Ga0496106_0015087 3300048909 Bacteria 5719
151 Ga0496116_0125348 3300048919 Bacteria 1476
152 Ga0496117_0169465 3300048920 Bacteria 1269
153 Ga0496118_0051729 3300048921 Bacteria 3139
154 Ga0496121_0000061 3300048924 Bacteria 275757
155 Ga0496121_0000105 3300048924 Bacteria 191437
156 Ga0496121_0062201 3300048924 Bacteria 3059
157 Ga0496122_0023670 3300048925 Bacteria 5401
158 Ga0496126_0008512 3300048929 Bacteria 11056
159 Ga0501043_0199952 3300049579 Bacteria 1551
160 Ga0501067_0207310 3300049583 Bacteria 1092
161 nmdc:mga03683_3930_c1 3300050489 Bacteria 4861
162 nmdc:mga0k408_23531_c1 3300050493 Bacteria 2714
163 nmdc:mga0k408_3552_c1 3300050493 Bacteria 8244
164 nmdc:mga06z11_20082_c1 3300050494 Bacteria 3083
165 nmdc:mga07m45_43500_c1 3300050496 Bacteria 2518
166 nmdc:mga07m45_8386_c1 3300050496 Bacteria 5311
167 nmdc:mga0qj67_72776_c1 3300050509 Bacteria 2745
168 nmdc:mga06r32_453619_c1 3300050510 Bacteria 1262
169 nmdc:mga0n895_415304_c1 3300050512 Bacteria 1360
170 nmdc:mga0sz30_4566_c2 3300050516 Bacteria 3154
171 Ga0500569_017449 3300053109 Bacteria 1835
172 Ga0500592_000133 3300053116 Bacteria 15954
173 Ga0500592_007697 3300053116 Bacteria 1711
174 Ga0500595_018787 3300053119 Bacteria 2521
175 Ga0500595_026414 3300053119 Bacteria 2001
176 Ga0500607_000001 3300053121 Bacteria 185408
177 Ga0500608_061763 3300053122 Bacteria 1789
178 Ga0500618_000086 3300053125 Bacteria 75318
179 Ga0500658_0002750 3300053134 Bacteria 6766
180 Ga0500658_0013313 3300053134 Bacteria 3038
181 Ga0500658_0049515 3300053134 Bacteria 1712
182 Ga0500559_0006993 3300053136 Bacteria 5043
183 Ga0500559_0007999 3300053136 Bacteria 4657
184 Ga0500564_052394 3300053138 Bacteria 1865
185 Ga0500568_0007314 3300053139 Bacteria 5428
186 Ga0500588_0031133 3300053146 Bacteria 1537
187 Ga0500604_0000164 3300053151 Bacteria 19296
188 Ga0500604_0018728 3300053151 Bacteria 1932
189 Ga0500622_0001666 3300053156 Bacteria 17367
190 Ga0500622_0007788 3300053156 Bacteria 6042
191 Ga0500627_0000040 3300053158 Bacteria 68950
192 Ga0500627_0000810 3300053158 Bacteria 8348
193 Ga0500627_0002274 3300053158 Bacteria 5642
194 Ga0500637_0004341 3300053178 Bacteria 6712
195 Ga0500645_005268 3300053730 Bacteria 4793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1004543 Ga0055526_10045435 271
2 3300025295 Ga0209564_1000375 Ga0209564_100037515 271
3 3300028016 Ga0265354_1000908 Ga0265354_10009084 273
4 3300030878 Ga0265770_1000457 Ga0265770_10004576 273
5 3300031090 Ga0265760_10000065 Ga0265760_1000006518 273
6 3300046512 Ga0495610_0043779 Ga0495610_0043779_16_837 273
7 3300025303 Ga0209051_1013804 Ga0209051_10138044 280
8 3300006038 Ga0075365_10041368 Ga0075365_100413682 281
9 3300006353 Ga0075370_10007341 Ga0075370_100073413 281
10 3300041507 Ga0451851_0020516 Ga0451851_0020516_80_1066 284
11 3300041511 Ga0451855_0468942 Ga0451855_0468942_299_1285 286
12 3300041413 Ga0439465_0012034 Ga0439465_0012034_778_1764 287
13 3300046616 Ga0495668_0001387 Ga0495668_0001387_970_1938 288
14 3300046500 Ga0495596_0052636 Ga0495596_0052636_557_1525 289
15 3300046616 Ga0495668_0005187 Ga0495668_0005187_4251_5180 294
16 3300049579 Ga0501043_0199952 Ga0501043_0199952_208_1176 294
17 3300049583 Ga0501067_0207310 Ga0501067_0207310_38_1006 294
18 3300053116 Ga0500592_007697 Ga0500592_007697_378_1307 294
19 3300046492 Ga0495585_0085424 Ga0495585_0085424_607_1593 295
20 3300046558 Ga0495633_0027727 Ga0495633_0027727_282_1268 295
21 3300046660 Ga0495625_0088124 Ga0495625_0088124_607_1593 295
22 3300003775 Ga0055524_1019001 Ga0055524_10190011 296
23 3300025299 Ga0209256_1015079 Ga0209256_10150791 296
24 3300046518 Ga0495631_0041104 Ga0495631_0041104_486_1454 296
25 3300046519 Ga0495632_0021240 Ga0495632_0021240_1774_2742 296
26 3300046542 Ga0495597_0019765 Ga0495597_0019765_1669_2637 296
27 3300046616 Ga0495668_0041508 Ga0495668_0041508_502_1470 296
28 3300047472 Ga0495686_0025722 Ga0495686_0025722_2305_3273 296
29 3300048091 Ga0495626_0042346 Ga0495626_0042346_600_1568 296
30 3300053109 Ga0500569_017449 Ga0500569_017449_318_1286 296
31 3300053134 Ga0500658_0002750 Ga0500658_0002750_762_1730 296
32 3300002773 JGI25152J39213_1012279 JGI25152J39213_10122791 298
33 3300003187 JGI25151J46595_10001450 JGI25151J46595_100014502 298
34 3300003187 JGI25151J46595_10003717 JGI25151J46595_100037171 298
35 3300006880 Ga0075429_100246684 Ga0075429_1002466842 298
36 3300025245 Ga0207425_1002139 Ga0207425_10021394 298
37 3300025258 Ga0209129_1000880 Ga0209129_100088019 298
38 3300025294 Ga0209025_1000572 Ga0209025_100057219 298
39 3300025297 Ga0209758_1000342 Ga0209758_100034272 298
40 3300046513 Ga0495616_0000014 Ga0495616_0000014_127230_128159 298
41 3300053151 Ga0500604_0000164 Ga0500604_0000164_5064_5993 298
42 3300053158 Ga0500627_0000810 Ga0500627_0000810_2390_3319 298
43 3300048925 Ga0496122_0023670 Ga0496122_0023670_958_1944 300
44 3300048090 Ga0495615_0033404 Ga0495615_0033404_22_1008 302
45 3300046530 Ga0495654_0094002 Ga0495654_0094002_156_1085 304
46 3300053116 Ga0500592_000133 Ga0500592_000133_11282_12211 304
47 3300053151 Ga0500604_0018728 Ga0500604_0018728_936_1865 304
48 3300053158 Ga0500627_0000040 Ga0500627_0000040_13470_14399 304
49 iso_pu_bacteria 2902405164 2902407720 305
50 3300046491 Ga0495584_0028815 Ga0495584_0028815_144_1115 306
51 3300046522 Ga0495643_0013430 Ga0495643_0013430_3862_4833 306
52 3300046528 Ga0495642_0042399 Ga0495642_0042399_755_1726 306
53 3300047445 Ga0495677_0004346 Ga0495677_0004346_876_1847 306
54 3300046518 Ga0495631_0033526 Ga0495631_0033526_310_1278 307
55 3300046522 Ga0495643_0059993 Ga0495643_0059993_801_1772 307
56 3300053125 Ga0500618_000086 Ga0500618_000086_26899_27867 307
57 3300028036 Ga0265355_1000625 Ga0265355_10006253 309
58 3300048920 Ga0496117_0169465 Ga0496117_0169465_265_1251 309
59 3300048921 Ga0496118_0051729 Ga0496118_0051729_637_1704 309
60 3300053138 Ga0500564_052394 Ga0500564_052394_231_1175 309
61 3300003771 Ga0055526_1020816 Ga0055526_10208162 310
62 3300025273 Ga0209673_1009464 Ga0209673_10094644 310
63 3300025273 Ga0209673_1013657 Ga0209673_10136572 310
64 3300025295 Ga0209564_1000570 Ga0209564_100057060 310
65 3300025299 Ga0209256_1026986 Ga0209256_10269863 310
66 3300050512 nmdc:mga0n895_415304_c1 nmdc:mga0n895_415304_c1_245_1198 311
67 3300005444 Ga0070694_100025054 Ga0070694_1000250542 312
68 3300005545 Ga0070695_100122230 Ga0070695_1001222302 312
69 3300031250 Ga0265331_10040001 Ga0265331_100400011 312
70 3300031251 Ga0265327_10000721 Ga0265327_1000072140 312
71 3300047322 Ga0495680_0154597 Ga0495680_0154597_680_1624 312
72 3300053122 Ga0500608_061763 Ga0500608_061763_68_1045 312
73 3300031090 Ga0265760_10028372 Ga0265760_100283721 313
74 3300031241 Ga0265325_10083988 Ga0265325_100839882 313
75 3300048924 Ga0496121_0000105 Ga0496121_0000105_7350_8315 313
76 3300006847 Ga0075431_100242383 Ga0075431_1002423832 314
77 3300005328 Ga0070676_10238885 Ga0070676_102388851 315
78 3300025304 Ga0209257_1002159 Ga0209257_10021595 316
79 3300046506 Ga0495583_0000001 Ga0495583_0000001_759493_760452 316
80 3300048924 Ga0496121_0000061 Ga0496121_0000061_35436_36389 316
81 iso_pu_bacteria 2582581279 2585147055 316
82 3300005327 Ga0070658_10120499 Ga0070658_101204992 317
83 3300006353 Ga0075370_10102836 Ga0075370_101028362 317
84 3300006844 Ga0075428_100075582 Ga0075428_1000755822 317
85 3300006846 Ga0075430_100063112 Ga0075430_1000631123 317
86 3300006880 Ga0075429_100099037 Ga0075429_1000990372 317
87 3300009551 Ga0105238_10177470 Ga0105238_101774702 317
88 3300021361 Ga0213872_10000995 Ga0213872_1000099516 317
89 3300021361 Ga0213872_10034070 Ga0213872_100340703 317
90 3300042123 Ga0450921_000896 Ga0450921_000896_324_1292 317
91 3300042133 Ga0450896_003925 Ga0450896_003925_452_1420 317
92 3300050493 nmdc:mga0k408_23531_c1 nmdc:mga0k408_23531_c1_1484_2440 317
93 3300050509 nmdc:mga0qj67_72776_c1 nmdc:mga0qj67_72776_c1_875_1843 317
94 3300050510 nmdc:mga06r32_453619_c1 nmdc:mga06r32_453619_c1_87_1055 317
95 3300053119 Ga0500595_026414 Ga0500595_026414_673_1689 317
96 3300053146 Ga0500588_0031133 Ga0500588_0031133_337_1467 317
97 3300053730 Ga0500645_005268 Ga0500645_005268_3496_4452 317
98 3300005456 Ga0070678_100209226 Ga0070678_1002092262 318
99 3300005457 Ga0070662_100005245 Ga0070662_1000052457 318
100 3300005459 Ga0068867_100026731 Ga0068867_1000267313 318
101 3300005543 Ga0070672_100198427 Ga0070672_1001984272 318
102 3300005844 Ga0068862_100044332 Ga0068862_1000443322 318
103 3300025907 Ga0207645_10003049 Ga0207645_1000304911 318
104 3300025917 Ga0207660_10062633 Ga0207660_100626333 318
105 3300025933 Ga0207706_10002895 Ga0207706_1000289510 318
106 3300025940 Ga0207691_10048226 Ga0207691_100482262 318
107 3300026075 Ga0207708_10022219 Ga0207708_100222193 318
108 3300026089 Ga0207648_10001568 Ga0207648_1000156822 318
109 3300026118 Ga0207675_100006492 Ga0207675_1000064929 318
110 3300027682 Ga0209971_1001881 Ga0209971_10018815 318
111 3300027717 Ga0209998_10003593 Ga0209998_100035933 318
112 3300035083 Ga0373926_0099797 Ga0373926_0099797_47_1012 318
113 iso_pu_bacteria 2510065019 2510133229 318
114 iso_pu_bacteria 2513237085 2513579642 318
115 iso_pu_bacteria 2515075009 2515112184 318
116 iso_pu_bacteria 2515154134 2515738663 318
117 iso_pu_bacteria 2516653085 2517076311 318
118 iso_pu_bacteria 2585427526 2585527555 318
119 iso_pu_bacteria 2595698237 2596377303 318
120 iso_pu_bacteria 2765235942 2766063083 318
121 iso_pu_bacteria 2838680041 2838682312 318
122 iso_pu_bacteria 2838686498 2838689405 318
123 iso_pu_bacteria 2838694306 2838696883 318
124 iso_pu_bacteria 2838707686 2838709876 318
125 iso_pu_bacteria 2838729681 2838730738 318
126 iso_pu_bacteria 2838742623 2838743679 318
127 iso_pu_bacteria 2841851746 2841857755 318
128 iso_pu_bacteria 2842077413 2842078050 318
129 iso_pu_bacteria 2842110456 2842110588 318
130 iso_pu_bacteria 2842118031 2842119441 318
131 iso_pu_bacteria 2842156927 2842157508 318
132 iso_pu_bacteria 2842163707 2842164700 318
133 iso_pu_bacteria 2842180545 2842180907 318
134 iso_pu_bacteria 2842229732 2842231034 318
135 iso_pu_bacteria 2842237096 2842239289 318
136 iso_pu_bacteria 2842243621 2842244858 318
137 iso_pu_bacteria 2842257432 2842258671 318
138 iso_pu_bacteria 2842271015 2842273425 318
139 iso_pu_bacteria 2842291075 2842291713 318
140 iso_pu_bacteria 2842304105 2842304202 318
141 iso_pu_bacteria 2842370503 2842372878 318
142 iso_pu_bacteria 2842377471 2842378109 318
143 iso_pu_bacteria 2842384541 2842385950 318
144 iso_pu_bacteria 2844454524 2844459254 318
145 iso_pu_bacteria 2857516855 2857518628 318
146 iso_pu_bacteria 2919100787 2919106989 318
147 iso_pu_bacteria 2933570622 2933571479 318
148 iso_pu_bacteria 2935901341 2935904651 318
149 iso_pu_bacteria 8005307578 8005314441 318
150 iso_pu_bacteria 8005460587 8005462846 318
151 iso_pu_bacteria 8023680758 8023685482 318
152 iso_pu_bacteria 8024486573 8024492946 318
153 3300005548 Ga0070665_100000323 Ga0070665_10000032341 319
154 3300028379 Ga0268266_10000002 Ga0268266_100000022981 319
155 3300006195 Ga0075366_10140085 Ga0075366_101400852 320
156 3300010375 Ga0105239_10005920 Ga0105239_100059203 320
157 3300025261 Ga0209233_1019172 Ga0209233_10191721 320
158 3300025919 Ga0207657_10139975 Ga0207657_101399752 320
159 3300025920 Ga0207649_10041554 Ga0207649_100415543 320
160 3300025924 Ga0207694_10000011 Ga0207694_10000011303 320
161 3300031235 Ga0265330_10108884 Ga0265330_101088842 320
162 3300031250 Ga0265331_10091445 Ga0265331_100914452 320
163 3300031251 Ga0265327_10000280 Ga0265327_1000028058 320
164 3300031456 Ga0307513_10009063 Ga0307513_1000906313 320
165 3300031712 Ga0265342_10018411 Ga0265342_100184112 320
166 3300037312 Ga0395899_0060850 Ga0395899_0060850_914_1879 320
167 3300037471 Ga0395905_0452947 Ga0395905_0452947_156_1121 320
168 3300046524 Ga0495648_0009410 Ga0495648_0009410_726_1691 320
169 3300046616 Ga0495668_0000053 Ga0495668_0000053_181158_182123 320
170 3300053134 Ga0500658_0013313 Ga0500658_0013313_350_1315 320
171 3300053136 Ga0500559_0007999 Ga0500559_0007999_306_1274 320
172 3300050496 nmdc:mga07m45_43500_c1 nmdc:mga07m45_43500_c1_1109_2077 321
173 3300053121 Ga0500607_000001 Ga0500607_000001_168106_169074 321
174 3300053136 Ga0500559_0006993 Ga0500559_0006993_2492_3460 321
175 3300053156 Ga0500622_0001666 Ga0500622_0001666_15606_16574 321
176 3300053178 Ga0500637_0004341 Ga0500637_0004341_3389_4357 321
177 3300003215 JGI25153J46596_10015539 JGI25153J46596_100155393 322
178 3300009545 Ga0105237_10000035 Ga0105237_1000003557 322
179 3300009551 Ga0105238_10098781 Ga0105238_100987813 322
180 3300025297 Ga0209758_1003958 Ga0209758_100395814 322
181 3300025914 Ga0207671_10000183 Ga0207671_1000018329 322
182 3300025924 Ga0207694_10062311 Ga0207694_100623113 322
183 3300046471 Ga0495650_0038046 Ga0495650_0038046_1110_2078 322
184 3300046501 Ga0495607_0033946 Ga0495607_0033946_316_1284 322
185 3300046513 Ga0495616_0000192 Ga0495616_0000192_21835_22803 322
186 3300046513 Ga0495616_0077002 Ga0495616_0077002_54_1022 322
187 3300046616 Ga0495668_0000072 Ga0495668_0000072_1164_2135 322
188 3300048909 Ga0496106_0015087 Ga0496106_0015087_1285_2253 322
189 3300048929 Ga0496126_0008512 Ga0496126_0008512_5687_6655 322
190 3300053134 Ga0500658_0049515 Ga0500658_0049515_132_1100 322
191 3300053139 Ga0500568_0007314 Ga0500568_0007314_3231_4199 322
192 3300053158 Ga0500627_0002274 Ga0500627_0002274_1540_2508 322
193 3300037471 Ga0395905_0110336 Ga0395905_0110336_697_1701 323
194 3300053119 Ga0500595_018787 Ga0500595_018787_757_1731 323
195 iso_pu_bacteria 2510461076 2510894592 324
196 iso_pu_bacteria 2510917030 2511200006 324
197 iso_pu_bacteria 2513237093 2513634410 324
198 iso_pu_bacteria 2513237162 2514021542 324
199 iso_pu_bacteria 2515154113 2515637263 324
200 iso_pu_bacteria 2515154114 2515639688 324
201 iso_pu_bacteria 2515154116 2515657331 324
202 iso_pu_bacteria 2517093000 2517095065 324
203 iso_pu_bacteria 2517287029 2517406700 324
204 iso_pu_bacteria 2582581298 2585224266 324
205 iso_pu_bacteria 2585427528 2585537452 324
206 iso_pu_bacteria 2585427529 2585546387 324
207 iso_pu_bacteria 2585427593 2585835408 324
208 iso_pu_bacteria 2738541333 2739036419 324
209 iso_pu_bacteria 2791355266 2793361253 324
210 iso_pu_bacteria 2802429633 2806045969 324
211 iso_pu_bacteria 2802429634 2806054349 324
212 iso_pu_bacteria 2802429635 2806060354 324
213 iso_pu_bacteria 2802429636 2806065190 324
214 iso_pu_bacteria 2802429637 2806072457 324
215 iso_pu_bacteria 2933586486 2933586616 324
216 iso_pu_bacteria 2935894831 2935897261 324
217 iso_pu_bacteria 2936367885 2936372809 324
218 iso_pu_bacteria 2936375103 2936376683 324
219 iso_pu_bacteria 2936381700 2936385064 324
220 iso_pu_bacteria 8005376324 8005379109 324
221 iso_pu_bacteria 8005570704 8005574794 324
222 iso_pu_bacteria 8024479707 8024482206 324
223 iso_pu_bacteria 8057874678 8057875159 324
224 3300003215 JGI25153J46596_10013324 JGI25153J46596_100133243 325
225 3300003791 Ga0055530_10003235 Ga0055530_1000323510 325
226 3300003794 Ga0055531_10001982 Ga0055531_1000198214 325
227 3300005262 Ga0065165_1001424 Ga0065165_100142420 325
228 3300009545 Ga0105237_10411263 Ga0105237_104112631 325
229 3300025297 Ga0209758_1008854 Ga0209758_10088542 325
230 3300025298 Ga0209050_1000173 Ga0209050_100017328 325
231 3300025298 Ga0209050_1031566 Ga0209050_10315662 325
232 3300025304 Ga0209257_1000196 Ga0209257_100019628 325
233 3300031456 Ga0307513_10246459 Ga0307513_102464592 326
234 3300002739 JGI25158J39367_1000050 JGI25158J39367_100005012 328
235 3300002739 JGI25158J39367_1000062 JGI25158J39367_10000626 328
236 3300002987 JGI25159J45721_1000293 JGI25159J45721_100029310 328
237 3300003215 JGI25153J46596_10023809 JGI25153J46596_100238091 328
238 3300003374 JGI25161J50226_1000055 JGI25161J50226_100005529 328
239 3300003374 JGI25161J50226_1005374 JGI25161J50226_10053743 328
240 3300003775 Ga0055524_1010182 Ga0055524_10101823 328
241 3300003790 Ga0055528_1003737 Ga0055528_10037377 328
242 3300003790 Ga0055528_1006581 Ga0055528_10065813 328
243 3300003792 Ga0055540_1002600 Ga0055540_10026008 328
244 3300004625 Ga0055543_1000032 Ga0055543_100003283 328
245 3300004625 Ga0055543_1001284 Ga0055543_100128411 328
246 3300005262 Ga0065165_1012220 Ga0065165_10122202 328
247 3300006177 Ga0075362_10001370 Ga0075362_100013707 328
248 3300025208 Ga0209436_100001 Ga0209436_1000017 328
249 3300025258 Ga0209129_1000750 Ga0209129_100075024 328
250 3300025273 Ga0209673_1004376 Ga0209673_10043767 328
251 3300025284 Ga0209130_1000004 Ga0209130_1000004107 328
252 3300025297 Ga0209758_1000468 Ga0209758_100046847 328
253 3300025299 Ga0209256_1005734 Ga0209256_10057348 328
254 3300025302 Ga0207426_1000003 Ga0207426_1000003621 328
255 3300025302 Ga0207426_1000039 Ga0207426_100003919 328
256 3300025303 Ga0209051_1007905 Ga0209051_10079053 328
257 3300041492 Ga0451835_1113860 Ga0451835_1113860_80_1066 328
258 3300041503 Ga0451847_0380723 Ga0451847_0380723_80_1066 328
259 3300048919 Ga0496116_0125348 Ga0496116_0125348_464_1450 328
260 3300048924 Ga0496121_0062201 Ga0496121_0062201_334_1320 328
261 3300050489 nmdc:mga03683_3930_c1 nmdc:mga03683_3930_c1_915_1901 328
262 3300050493 nmdc:mga0k408_3552_c1 nmdc:mga0k408_3552_c1_6303_7289 328
263 3300050494 nmdc:mga06z11_20082_c1 nmdc:mga06z11_20082_c1_723_1709 328
264 3300050496 nmdc:mga07m45_8386_c1 nmdc:mga07m45_8386_c1_3270_4256 328
265 3300050516 nmdc:mga0sz30_4566_c2 nmdc:mga0sz30_4566_c2_1162_2148 328
266 3300053156 Ga0500622_0007788 Ga0500622_0007788_3242_4228 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08659

KR

KR domain

85

219

0.93

PF00106

adh_short

short chain dehydrogenase

84

291

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

86

311

0.79

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

90

306

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8808 25 328
5u2w-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp 0.8512 26 284
4pcv-assembly1.cif.gz_A the structure of bdca (yjgi) from e. coli 0.85 26 217
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.843 25 328
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8413 25 223
ID Description Score Start End Superfamily
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9459 28 60 3.50.50.60
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9176 58 328 3.40.50.720
af_Q95QH4_36_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9169 28 223 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9091 16 102 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9069 58 328 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I4TQ83-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.953 7 328
AF-R4V4L8-F1-model_v4 Retinol dehydrogenase 13-like protein 0.9513 23 214 GO:0016491
AF-A0A183VUQ0-F1-model_v4 deleted 0.9504 25 223
AF-A0A670Z6X7-F1-model_v4 Retinol dehydrogenase 12 0.9466 23 216 GO:0016491
AF-A0A7S0XD79-F1-model_v4 Protochlorophyllide reductase 0.946 24 199 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.34 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map