F374084

General Info

Members Datasets Scaffolds Average Seq Length
266 142 532 110

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11059193|Ga0157369_110591931
Length 127
Sequence MRLKISRGSLRQPRTDKIFMIKICDINETAKSKLPPATPDKSGIGVHYTDAFIKPMNTKLPDGTRVSCKRKGLKITLAVGTKKGEGLMRRLEVSQDPVAMLSAALQEAAKAAGLELQINDKEILVAA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
68 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
100 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 1.13
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 34.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_11059193 3300013105 Bacteria 829
2 Ga0070658_10617409 3300005327 Bacteria 940
3 Ga0070683_100353997 3300005329 Bacteria 1398
4 Ga0070680_100473972 3300005336 Bacteria 1070
5 Ga0070680_101003267 3300005336 Bacteria 721
6 Ga0070682_100423725 3300005337 Bacteria 1012
7 Ga0070673_100987648 3300005364 Bacteria 783
8 Ga0070713_102222707 3300005436 Unclassified 531
9 Ga0070710_11164865 3300005437 Unclassified 568
10 Ga0070711_100130435 3300005439 Bacteria 1871
11 Ga0070708_101073670 3300005445 Unclassified 754
12 Ga0070681_10025059 3300005458 Bacteria 6002
13 Ga0070681_10050429 3300005458 Bacteria 4152
14 Ga0070681_11396055 3300005458 Unclassified 624
15 Ga0070679_100260975 3300005530 Bacteria 1688
16 Ga0070679_100661530 3300005530 Bacteria 987
17 Ga0070686_100125263 3300005544 Bacteria 1769
18 Ga0070665_100235795 3300005548 Unclassified 1830
19 Ga0068855_100084635 3300005563 Unclassified 3671
20 Ga0068855_100241249 3300005563 Unclassified 2019
21 Ga0068855_100528686 3300005563 Bacteria 1279
22 Ga0068855_100727747 3300005563 Bacteria 1060
23 Ga0068855_100779281 3300005563 Bacteria 1018
24 Ga0068857_100036681 3300005577 Bacteria 4344
25 Ga0068857_100238077 3300005577 Bacteria 1666
26 Ga0068857_101117718 3300005577 Bacteria 761
27 Ga0068856_100098224 3300005614 Bacteria 2918
28 Ga0068856_100126189 3300005614 Bacteria 2562
29 Ga0068856_100414703 3300005614 Bacteria 1367
30 Ga0068856_101998892 3300005614 Unclassified 590
31 Ga0068856_102154259 3300005614 Unclassified 567
32 Ga0068852_100562939 3300005616 Bacteria 1141
33 Ga0068859_100188234 3300005617 Bacteria 2148
34 Ga0068859_100406339 3300005617 Bacteria 1458
35 Ga0068864_101403848 3300005618 Unclassified 700
36 Ga0068863_100437551 3300005841 Bacteria 1282
37 Ga0068858_101252777 3300005842 Unclassified 729
38 Ga0068860_100168933 3300005843 Bacteria 2112
39 Ga0070712_100190768 3300006175 Unclassified 1604
40 Ga0068871_100794214 3300006358 Unclassified 872
41 Ga0068871_100980813 3300006358 Unclassified 786
42 Ga0068871_101653378 3300006358 Bacteria 607
43 Ga0068865_101472615 3300006881 Bacteria 609
44 Ga0097620_100188250 3300006931 Bacteria 2148
45 Ga0097620_100406318 3300006931 Bacteria 1458
46 Ga0075435_100443352 3300007076 Unclassified 1119
47 Ga0105240_10037940 3300009093 Bacteria 6187
48 Ga0105240_10346858 3300009093 Bacteria 1685
49 Ga0105240_10599912 3300009093 Bacteria 1212
50 Ga0105240_10942246 3300009093 Bacteria 927
51 Ga0105240_11373723 3300009093 Bacteria 743
52 Ga0105240_11924215 3300009093 Bacteria 615
53 Ga0111539_11976538 3300009094 Bacteria 676
54 Ga0105242_10098410 3300009176 Unclassified 2474
55 Ga0105242_10392187 3300009176 Bacteria 1293
56 Ga0105242_10934729 3300009176 Unclassified 870
57 Ga0105237_10190035 3300009545 Bacteria 2054
58 Ga0105238_10041936 3300009551 Bacteria 4635
59 Ga0105249_11288438 3300009553 Unclassified 802
60 Ga0105239_12101189 3300010375 Unclassified 656
61 Ga0157370_10021040 3300013104 Bacteria 6504
62 Ga0157370_10042324 3300013104 Bacteria 4390
63 Ga0157370_10244036 3300013104 Bacteria 1662
64 Ga0157369_10271647 3300013105 Bacteria 1766
65 Ga0157369_11147075 3300013105 Unclassified 794
66 Ga0157374_10322201 3300013296 Bacteria 1532
67 Ga0157374_10480236 3300013296 Unclassified 1246
68 Ga0157374_10890301 3300013296 Bacteria 907
69 Ga0157378_11314498 3300013297 Bacteria 764
70 Ga0157372_10117686 3300013307 Bacteria 3048
71 Ga0157372_10124207 3300013307 Bacteria 2967
72 Ga0157372_10144010 3300013307 Unclassified 2748
73 Ga0157372_10820472 3300013307 Unclassified 1080
74 Ga0157372_11592030 3300013307 Bacteria 752
75 Ga0157372_13002701 3300013307 Unclassified 539
76 Ga0163163_10926399 3300014325 Unclassified 935
77 Ga0207705_10662731 3300025909 Unclassified 811
78 Ga0207707_10038732 3300025912 Bacteria 4166
79 Ga0207707_10105137 3300025912 Bacteria 2467
80 Ga0207695_10001734 3300025913 Bacteria 34698
81 Ga0207695_10592428 3300025913 Unclassified 990
82 Ga0207695_10665029 3300025913 Bacteria 922
83 Ga0207695_11267383 3300025913 Bacteria 617
84 Ga0207671_10397233 3300025914 Bacteria 1096
85 Ga0207660_10267298 3300025917 Bacteria 1354
86 Ga0207660_10596498 3300025917 Bacteria 899
87 Ga0207652_10016608 3300025921 Bacteria 6014
88 Ga0207652_10654620 3300025921 Unclassified 939
89 Ga0207694_10449753 3300025924 Bacteria 1075
90 Ga0207700_10789960 3300025928 Unclassified 849
91 Ga0207661_10044348 3300025944 Bacteria 3514
92 Ga0207661_10098795 3300025944 Bacteria 2447
93 Ga0207667_10079774 3300025949 Unclassified 3392
94 Ga0207667_10632086 3300025949 Bacteria 1077
95 Ga0207667_10824479 3300025949 Unclassified 923
96 Ga0207667_11825380 3300025949 Unclassified 572
97 Ga0207678_11862467 3300026067 Unclassified 525
98 Ga0207702_10037909 3300026078 Bacteria 4037
99 Ga0207702_10110814 3300026078 Bacteria 2440
100 Ga0207702_11877355 3300026078 Unclassified 590
101 Ga0207641_10201365 3300026088 Bacteria 1836
102 Ga0207641_10500255 3300026088 Bacteria 1180
103 Ga0207648_10612004 3300026089 Bacteria 1005
104 Ga0207676_10272003 3300026095 Unclassified 1535
105 Ga0207674_10047793 3300026116 Bacteria 4384
106 Ga0207674_10422525 3300026116 Bacteria 1288
107 Ga0207698_10050368 3300026142 Bacteria 3176
108 Ga0268266_10198779 3300028379 Unclassified 1834
109 Ga0268264_11451221 3300028381 Unclassified 697
110 Ga0265337_1001703 3300028556 Bacteria 10665
111 Ga0265326_10019408 3300028558 Bacteria 1954
112 Ga0265319_1015571 3300028563 Unclassified 2945
113 Ga0265334_10012568 3300028573 Bacteria 3555
114 Ga0265334_10016687 3300028573 Bacteria 3036
115 Ga0265334_10026642 3300028573 Bacteria 2333
116 Ga0265334_10078742 3300028573 Bacteria 1217
117 Ga0265334_10138693 3300028573 Unclassified 862
118 Ga0265323_10032860 3300028653 Bacteria 1924
119 Ga0265323_10248280 3300028653 Bacteria 554
120 Ga0265336_10022781 3300028666 Bacteria 1992
121 Ga0265336_10060171 3300028666 Unclassified 1139
122 Ga0265336_10120453 3300028666 Unclassified 781
123 Ga0265338_10000132 3300028800 Bacteria 137378
124 Ga0265338_10001670 3300028800 Bacteria 35304
125 Ga0265338_10039116 3300028800 Bacteria 4481
126 Ga0265338_10039855 3300028800 Bacteria 4422
127 Ga0265338_10069080 3300028800 Unclassified 3038
128 Ga0265338_10093487 3300028800 Unclassified 2477
129 Ga0265338_10345905 3300028800 Unclassified 1070
130 Ga0265338_10370483 3300028800 Bacteria 1026
131 Ga0265338_10736911 3300028800 Bacteria 678
132 Ga0265338_10913410 3300028800 Unclassified 597
133 Ga0265324_10037661 3300029957 Bacteria 1680
134 Ga0265324_10056639 3300029957 Bacteria 1343
135 Ga0265324_10115491 3300029957 Unclassified 911
136 Ga0265765_1011629 3300030879 Unclassified 990
137 Ga0265332_10017145 3300031238 Unclassified 3194
138 Ga0265332_10067302 3300031238 Unclassified 1527
139 Ga0265328_10233501 3300031239 Unclassified 702
140 Ga0265320_10000892 3300031240 Bacteria 22456
141 Ga0265320_10005800 3300031240 Bacteria 7870
142 Ga0265320_10228372 3300031240 Bacteria 828
143 Ga0265320_10307586 3300031240 Unclassified 701
144 Ga0265325_10008068 3300031241 Bacteria 6243
145 Ga0265340_10027936 3300031247 Unclassified 2841
146 Ga0265340_10090570 3300031247 Bacteria 1430
147 Ga0265340_10102005 3300031247 Bacteria 1332
148 Ga0265339_10010853 3300031249 Bacteria 5634
149 Ga0265339_10142111 3300031249 Unclassified 1220
150 Ga0265339_10543821 3300031249 Unclassified 534
151 Ga0265331_10148765 3300031250 Bacteria 1064
152 Ga0265327_10000047 3300031251 Bacteria 273466
153 Ga0265316_10026816 3300031344 Bacteria 4785
154 Ga0265316_10243806 3300031344 Unclassified 1321
155 Ga0265313_10001781 3300031595 Bacteria 19674
156 Ga0265313_10446808 3300031595 Unclassified 503
157 Ga0307508_10000027 3300031616 Bacteria 171013
158 Ga0316579_10077610 3300031691 Bacteria 1579
159 Ga0265314_10546131 3300031711 Bacteria 603
160 Ga0265342_10087685 3300031712 Unclassified 1788
161 Ga0265342_10193905 3300031712 Unclassified 1107
162 Ga0265342_10636688 3300031712 Bacteria 536
163 Ga0307516_10888156 3300031730 Unclassified 557
164 Ga0316583_10034263 3300032133 Bacteria 1802
165 Ga0316583_10089392 3300032133 Bacteria 1074
166 Ga0373958_0050689 3300034819 Unclassified 876
167 Ga0373940_0262514 3300035088 Unclassified 585
168 Ga0373949_0207356 3300035090 Bacteria 591
169 Ga0373953_0102451 3300035117 Unclassified 1206
170 Ga0373954_0049255 3300035118 Unclassified 1975
171 Ga0373954_0543910 3300035118 Unclassified 575
172 Ga0373956_0020651 3300035119 Bacteria 2805
173 Ga0373956_0151255 3300035119 Bacteria 1092
174 Ga0316574_0066160 3300035398 Bacteria 2277
175 Ga0373924_0223707 3300035410 Bacteria 832
176 Ga0373931_0324314 3300035691 Bacteria 957
177 Ga0373935_1498963 3300035692 Unclassified 505
178 Ga0373933_0134521 3300035724 Bacteria 1556
179 Ga0373933_0475812 3300035724 Bacteria 818
180 Ga0373933_0621821 3300035724 Bacteria 710
181 Ga0373947_0469070 3300035725 Unclassified 854
182 Ga0373937_0017831 3300036401 Bacteria 6334
183 Ga0373937_0038887 3300036401 Bacteria 4335
184 Ga0373937_1760070 3300036401 Unclassified 566
185 Ga0316582_0194002 3300036647 Bacteria 1384
186 Ga0316581_0137866 3300037588 Bacteria 752
187 Ga0451787_468213 3300041441 Bacteria 554
188 Ga0451791_1570895 3300041451 Bacteria 589
189 Ga0451807_2365347 3300041486 Bacteria 793
190 Ga0451833_1261193 3300041491 Bacteria 666
191 Ga0451835_0330188 3300041492 Unclassified 540
192 Ga0451853_2553286 3300041512 Bacteria 1271
193 Ga0451577_0000524 3300042876 Bacteria 63869
194 Ga0451577_0012996 3300042876 Bacteria 7809
195 Ga0451577_0021108 3300042876 Bacteria 5965
196 Ga0453683_0002185 3300044673 Bacteria 15562
197 Ga0466966_0050837 3300044684 Bacteria 2636
198 Ga0453684_0034159 3300044712 Bacteria 7067
199 Ga0453684_0080998 3300044712 Bacteria 4051
200 Ga0453684_0344695 3300044712 Bacteria 1681
201 Ga0453684_0640362 3300044712 Bacteria 1161
202 Ga0466957_0499291 3300044842 Unclassified 843
203 Ga0451576_0016231 3300045051 Bacteria 8225
204 Ga0451576_0068563 3300045051 Bacteria 3691
205 Ga0451576_0685210 3300045051 Viruses 1077
206 Ga0451576_0784632 3300045051 Bacteria 1000
207 Ga0451576_1110858 3300045051 Bacteria 827
208 Ga0451576_1707262 3300045051 Bacteria 652
209 Ga0451576_2360998 3300045051 Unclassified 544
210 Ga0495592_0429694 3300046454 Unclassified 831
211 Ga0495629_0500347 3300046459 Unclassified 820
212 Ga0495651_0527428 3300046462 Unclassified 753
213 Ga0495653_0435834 3300046463 Unclassified 827
214 Ga0495582_0019305 3300046473 Unclassified 3728
215 Ga0495582_0116052 3300046473 Bacteria 1506
216 Ga0495662_0078281 3300046476 Bacteria 1606
217 Ga0495618_0030566 3300046514 Bacteria 3364
218 Ga0495628_0785317 3300046516 Unclassified 667
219 Ga0495628_0797546 3300046516 Unclassified 661
220 Ga0495630_0012333 3300046517 Bacteria 6203
221 Ga0495630_0033151 3300046517 Unclassified 3851
222 Ga0495630_0112079 3300046517 Unclassified 2066
223 Ga0495630_0114428 3300046517 Bacteria 2044
224 Ga0495630_0445317 3300046517 Unclassified 992
225 Ga0495666_0046057 3300046526 Bacteria 2103
226 Ga0495666_0190583 3300046526 Bacteria 945
227 Ga0495640_0279738 3300046533 Bacteria 1039
228 Ga0495640_0299814 3300046533 Bacteria 998
229 Ga0495586_0000499 3300046535 Bacteria 23147
230 Ga0495586_0002640 3300046535 Bacteria 9698
231 Ga0495586_0111737 3300046535 Unclassified 1521
232 Ga0495586_0670824 3300046535 Bacteria 599
233 Ga0495645_0083526 3300046543 Bacteria 2289
234 Ga0495645_0361194 3300046543 Bacteria 933
235 Ga0495667_0046088 3300046559 Bacteria 2884
236 Ga0495667_0070349 3300046559 Bacteria 2283
237 Ga0495634_0001667 3300046642 Bacteria 19346
238 Ga0495634_0004477 3300046642 Bacteria 10962
239 Ga0495634_0080415 3300046642 Viruses 2133
240 Ga0495634_0264289 3300046642 Bacteria 1049
241 Ga0495634_0840248 3300046642 Unclassified 522
242 Ga0495635_0232185 3300046663 Bacteria 1246
243 Ga0495647_0187911 3300046681 Bacteria 901
244 Ga0495647_0442482 3300046681 Unclassified 601
245 Ga0495658_0004565 3300046683 Bacteria 6810
246 Ga0495658_0252937 3300046683 Unclassified 1108
247 Ga0495613_0000896 3300046689 Bacteria 22904
248 Ga0495604_0183085 3300047317 Bacteria 1464
249 Ga0495674_0027182 3300047319 Bacteria 5230
250 Ga0495674_1310140 3300047319 Unclassified 543
251 Ga0495676_0043012 3300047321 Unclassified 3701
252 Ga0495676_1039756 3300047321 Unclassified 522
253 Ga0495680_0003875 3300047322 Bacteria 14473
254 Ga0495675_0035400 3300047444 Bacteria 3189
255 Ga0495675_0139350 3300047444 Bacteria 1504
256 Ga0495675_0389590 3300047444 Unclassified 814
257 Ga0495675_0405824 3300047444 Unclassified 794
258 Ga0495684_0514443 3300047471 Bacteria 821
259 Ga0495684_0648674 3300047471 Bacteria 706
260 Ga0495684_0682950 3300047471 Bacteria 683
261 Ga0495682_0043472 3300049460 Unclassified 1645
262 Ga0501070_0326171 3300049586 Unclassified 1248
263 nmdc:mga0rr50_430155_c1 3300050513 Unclassified 1117
264 Ga0495619_0925096 3300053085 Unclassified 586
265 Ga0500650_0008823 3300053098 Bacteria 4012
266 Ga0500568_0021748 3300053139 Bacteria 2756
267 Ga0157369_11059193
268 Ga0070658_10617409
269 Ga0070683_100353997
270 Ga0070680_100473972
271 Ga0070680_101003267
272 Ga0070682_100423725
273 Ga0070673_100987648
274 Ga0070713_102222707
275 Ga0070710_11164865
276 Ga0070711_100130435
277 Ga0070708_101073670
278 Ga0070681_10025059
279 Ga0070681_10050429
280 Ga0070681_11396055
281 Ga0070679_100260975
282 Ga0070679_100661530
283 Ga0070686_100125263
284 Ga0070665_100235795
285 Ga0068855_100084635
286 Ga0068855_100241249
287 Ga0068855_100528686
288 Ga0068855_100727747
289 Ga0068855_100779281
290 Ga0068857_100036681
291 Ga0068857_100238077
292 Ga0068857_101117718
293 Ga0068856_100098224
294 Ga0068856_100126189
295 Ga0068856_100414703
296 Ga0068856_101998892
297 Ga0068856_102154259
298 Ga0068852_100562939
299 Ga0068859_100188234
300 Ga0068859_100406339
301 Ga0068864_101403848
302 Ga0068863_100437551
303 Ga0068858_101252777
304 Ga0068860_100168933
305 Ga0070712_100190768
306 Ga0068871_100794214
307 Ga0068871_100980813
308 Ga0068871_101653378
309 Ga0068865_101472615
310 Ga0097620_100188250
311 Ga0097620_100406318
312 Ga0075435_100443352
313 Ga0105240_10037940
314 Ga0105240_10346858
315 Ga0105240_10599912
316 Ga0105240_10942246
317 Ga0105240_11373723
318 Ga0105240_11924215
319 Ga0111539_11976538
320 Ga0105242_10098410
321 Ga0105242_10392187
322 Ga0105242_10934729
323 Ga0105237_10190035
324 Ga0105238_10041936
325 Ga0105249_11288438
326 Ga0105239_12101189
327 Ga0157370_10021040
328 Ga0157370_10042324
329 Ga0157370_10244036
330 Ga0157369_10271647
331 Ga0157369_11147075
332 Ga0157374_10322201
333 Ga0157374_10480236
334 Ga0157374_10890301
335 Ga0157378_11314498
336 Ga0157372_10117686
337 Ga0157372_10124207
338 Ga0157372_10144010
339 Ga0157372_10820472
340 Ga0157372_11592030
341 Ga0157372_13002701
342 Ga0163163_10926399
343 Ga0207705_10662731
344 Ga0207707_10038732
345 Ga0207707_10105137
346 Ga0207695_10001734
347 Ga0207695_10592428
348 Ga0207695_10665029
349 Ga0207695_11267383
350 Ga0207671_10397233
351 Ga0207660_10267298
352 Ga0207660_10596498
353 Ga0207652_10016608
354 Ga0207652_10654620
355 Ga0207694_10449753
356 Ga0207700_10789960
357 Ga0207661_10044348
358 Ga0207661_10098795
359 Ga0207667_10079774
360 Ga0207667_10632086
361 Ga0207667_10824479
362 Ga0207667_11825380
363 Ga0207678_11862467
364 Ga0207702_10037909
365 Ga0207702_10110814
366 Ga0207702_11877355
367 Ga0207641_10201365
368 Ga0207641_10500255
369 Ga0207648_10612004
370 Ga0207676_10272003
371 Ga0207674_10047793
372 Ga0207674_10422525
373 Ga0207698_10050368
374 Ga0268266_10198779
375 Ga0268264_11451221
376 Ga0265337_1001703
377 Ga0265326_10019408
378 Ga0265319_1015571
379 Ga0265334_10012568
380 Ga0265334_10016687
381 Ga0265334_10026642
382 Ga0265334_10078742
383 Ga0265334_10138693
384 Ga0265323_10032860
385 Ga0265323_10248280
386 Ga0265336_10022781
387 Ga0265336_10060171
388 Ga0265336_10120453
389 Ga0265338_10000132
390 Ga0265338_10001670
391 Ga0265338_10039116
392 Ga0265338_10039855
393 Ga0265338_10069080
394 Ga0265338_10093487
395 Ga0265338_10345905
396 Ga0265338_10370483
397 Ga0265338_10736911
398 Ga0265338_10913410
399 Ga0265324_10037661
400 Ga0265324_10056639
401 Ga0265324_10115491
402 Ga0265765_1011629
403 Ga0265332_10017145
404 Ga0265332_10067302
405 Ga0265328_10233501
406 Ga0265320_10000892
407 Ga0265320_10005800
408 Ga0265320_10228372
409 Ga0265320_10307586
410 Ga0265325_10008068
411 Ga0265340_10027936
412 Ga0265340_10090570
413 Ga0265340_10102005
414 Ga0265339_10010853
415 Ga0265339_10142111
416 Ga0265339_10543821
417 Ga0265331_10148765
418 Ga0265327_10000047
419 Ga0265316_10026816
420 Ga0265316_10243806
421 Ga0265313_10001781
422 Ga0265313_10446808
423 Ga0307508_10000027
424 Ga0316579_10077610
425 Ga0265314_10546131
426 Ga0265342_10087685
427 Ga0265342_10193905
428 Ga0265342_10636688
429 Ga0307516_10888156
430 Ga0316583_10034263
431 Ga0316583_10089392
432 Ga0373958_0050689
433 Ga0373940_0262514
434 Ga0373949_0207356
435 Ga0373953_0102451
436 Ga0373954_0049255
437 Ga0373954_0543910
438 Ga0373956_0020651
439 Ga0373956_0151255
440 Ga0316574_0066160
441 Ga0373924_0223707
442 Ga0373931_0324314
443 Ga0373935_1498963
444 Ga0373933_0134521
445 Ga0373933_0475812
446 Ga0373933_0621821
447 Ga0373947_0469070
448 Ga0373937_0017831
449 Ga0373937_0038887
450 Ga0373937_1760070
451 Ga0316582_0194002
452 Ga0316581_0137866
453 Ga0451787_468213
454 Ga0451791_1570895
455 Ga0451807_2365347
456 Ga0451833_1261193
457 Ga0451835_0330188
458 Ga0451853_2553286
459 Ga0451577_0000524
460 Ga0451577_0012996
461 Ga0451577_0021108
462 Ga0453683_0002185
463 Ga0466966_0050837
464 Ga0453684_0034159
465 Ga0453684_0080998
466 Ga0453684_0344695
467 Ga0453684_0640362
468 Ga0466957_0499291
469 Ga0451576_0016231
470 Ga0451576_0068563
471 Ga0451576_0685210
472 Ga0451576_0784632
473 Ga0451576_1110858
474 Ga0451576_1707262
475 Ga0451576_2360998
476 Ga0495592_0429694
477 Ga0495629_0500347
478 Ga0495651_0527428
479 Ga0495653_0435834
480 Ga0495582_0019305
481 Ga0495582_0116052
482 Ga0495662_0078281
483 Ga0495618_0030566
484 Ga0495628_0785317
485 Ga0495628_0797546
486 Ga0495630_0012333
487 Ga0495630_0033151
488 Ga0495630_0112079
489 Ga0495630_0114428
490 Ga0495630_0445317
491 Ga0495666_0046057
492 Ga0495666_0190583
493 Ga0495640_0279738
494 Ga0495640_0299814
495 Ga0495586_0000499
496 Ga0495586_0002640
497 Ga0495586_0111737
498 Ga0495586_0670824
499 Ga0495645_0083526
500 Ga0495645_0361194
501 Ga0495667_0046088
502 Ga0495667_0070349
503 Ga0495634_0001667
504 Ga0495634_0004477
505 Ga0495634_0080415
506 Ga0495634_0264289
507 Ga0495634_0840248
508 Ga0495635_0232185
509 Ga0495647_0187911
510 Ga0495647_0442482
511 Ga0495658_0004565
512 Ga0495658_0252937
513 Ga0495613_0000896
514 Ga0495604_0183085
515 Ga0495674_0027182
516 Ga0495674_1310140
517 Ga0495676_0043012
518 Ga0495676_1039756
519 Ga0495680_0003875
520 Ga0495675_0035400
521 Ga0495675_0139350
522 Ga0495675_0389590
523 Ga0495675_0405824
524 Ga0495684_0514443
525 Ga0495684_0648674
526 Ga0495684_0682950
527 Ga0495682_0043472
528 Ga0501070_0326171
529 nmdc:mga0rr50_430155_c1
530 Ga0495619_0925096
531 Ga0500650_0008823
532 Ga0500568_0021748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jou-assembly1.cif.gz_A bacteroides ovatus xyloglucan pul gh31 0.8107 44 68
6j49-assembly1.cif.gz_O grafting vladv sequence into ospasm1 0.8057 32 68
3o4j-assembly2.cif.gz_D structure and catalysis of acylaminoacyl peptidase 0.7853 38 65
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.7642 36 67
2oyb-assembly1.cif.gz_O the crystal structure of ospa mutant 0.752 33 68
ID Description Score Start End Superfamily
af_A1XQX2_24_198_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.9029 45 68 2.60.120.200
af_M9PE65_1337_1526_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8336 45 66 2.60.120.200
5jouA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.8107 44 68 2.60.40.1760
af_Q9TXM9_81_150_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8065 36 68 2.40.50.100
af_A0A5S9MNN1_63_201_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7932 36 68 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A2X1PM78-F1-model_v4 Uncharacterized protein 0.9395 38 66
AF-A0A1H3GF70-F1-model_v4 Uncharacterized protein 0.9301 36 68
AF-X1SGR9-F1-model_v4 Uncharacterized protein 0.9252 35 68
AF-X1V566-F1-model_v4 Uncharacterized protein 0.9026 35 68
AF-A0A0F9BDI2-F1-model_v4 Uncharacterized protein 0.8985 33 68

Map