F373914

General Info

Members Datasets Scaffolds Average Seq Length
266 162 532 142

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100493739|Ga0070706_1004937391
Length 163
Sequence MTRKKLRKKPGKSARTGIRKPAAVAKKRQTLPRHPTARDPLLAAVKGAERRNIGHVQLEVGRAGAARVKRMIYPAGFRWSVDMKPVVGTDLCMHAHVGFLARGEIHIEYADGCVVEHRAPQIVAIEPGHDGWVVGDEPVVLIEFDFERDTVRRLGMPDVHRHA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 6.39
Rhizosphere 92.11
Stem 0
Stem Tuber 0
Unclassified 25.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100493739 3300005467 Bacteria 1139
2 Ga0065715_10140067 3300005293 Unclassified 1867
3 Ga0070676_10896164 3300005328 Bacteria 660
4 Ga0070690_100026016 3300005330 Bacteria 3607
5 Ga0070690_101333726 3300005330 Bacteria 576
6 Ga0070670_100069740 3300005331 Bacteria 3018
7 Ga0070670_100124668 3300005331 Bacteria 2223
8 Ga0070670_100129843 3300005331 Unclassified 2176
9 Ga0070670_100449306 3300005331 Unclassified 1142
10 Ga0068868_100106729 3300005338 Bacteria 2272
11 Ga0070687_100604804 3300005343 Bacteria 754
12 Ga0070668_100799473 3300005347 Unclassified 838
13 Ga0070669_100061908 3300005353 Bacteria 2750
14 Ga0070669_100366467 3300005353 Bacteria 1173
15 Ga0070675_100071762 3300005354 Bacteria 2873
16 Ga0070675_100611456 3300005354 Bacteria 989
17 Ga0070671_100287961 3300005355 Bacteria 1398
18 Ga0070674_100583792 3300005356 Bacteria 942
19 Ga0070673_101450220 3300005364 Bacteria 647
20 Ga0070688_100285982 3300005365 Bacteria 1187
21 Ga0070688_100842163 3300005365 Bacteria 720
22 Ga0070659_100861609 3300005366 Unclassified 790
23 Ga0070667_100381657 3300005367 Unclassified 1280
24 Ga0070713_100107434 3300005436 Bacteria 2428
25 Ga0070705_100021720 3300005440 Unclassified 3418
26 Ga0070700_100647209 3300005441 Unclassified 834
27 Ga0070694_100001228 3300005444 Bacteria 14815
28 Ga0070694_100020000 3300005444 Bacteria 4264
29 Ga0070694_100383925 3300005444 Bacteria 1096
30 Ga0070678_100022503 3300005456 Bacteria 4179
31 Ga0070678_100306325 3300005456 Bacteria 1352
32 Ga0070707_100157179 3300005468 Bacteria 2215
33 Ga0070707_100497564 3300005468 Bacteria 1181
34 Ga0070707_101512845 3300005468 Bacteria 638
35 Ga0070698_100259646 3300005471 Unclassified 1669
36 Ga0070698_101042051 3300005471 Bacteria 766
37 Ga0070699_100019455 3300005518 Bacteria 5846
38 Ga0070699_100124737 3300005518 Bacteria 2266
39 Ga0070699_100179000 3300005518 Bacteria 1881
40 Ga0070699_100380246 3300005518 Unclassified 1275
41 Ga0070679_100702332 3300005530 Unclassified 954
42 Ga0070684_100181061 3300005535 Unclassified 1916
43 Ga0070684_100199540 3300005535 Bacteria 1822
44 Ga0070684_100244689 3300005535 Bacteria 1639
45 Ga0070697_100043947 3300005536 Bacteria 3618
46 Ga0070697_101871995 3300005536 Unclassified 537
47 Ga0070686_100001805 3300005544 Bacteria 11944
48 Ga0070686_100323504 3300005544 Bacteria 1150
49 Ga0070695_100069374 3300005545 Unclassified 2304
50 Ga0070695_100299317 3300005545 Unclassified 1188
51 Ga0070695_100308309 3300005545 Unclassified 1173
52 Ga0070695_100458785 3300005545 Bacteria 978
53 Ga0070696_100008917 3300005546 Bacteria 6712
54 Ga0070696_100367487 3300005546 Bacteria 1118
55 Ga0070696_100860068 3300005546 Bacteria 750
56 Ga0070696_101173771 3300005546 Unclassified 648
57 Ga0070693_100069794 3300005547 Bacteria 2066
58 Ga0070693_100505565 3300005547 Unclassified 858
59 Ga0070704_100002706 3300005549 Bacteria 10021
60 Ga0070704_100188503 3300005549 Unclassified 1656
61 Ga0068855_100343933 3300005563 Bacteria 1644
62 Ga0070664_100033047 3300005564 Bacteria 4330
63 Ga0070664_100389553 3300005564 Bacteria 1273
64 Ga0068859_100109961 3300005617 Bacteria 2818
65 Ga0068864_100006150 3300005618 Bacteria 9844
66 Ga0068861_100900873 3300005719 Unclassified 838
67 Ga0068870_10033995 3300005840 Bacteria 2606
68 Ga0068870_10285802 3300005840 Bacteria 1036
69 Ga0068863_100003214 3300005841 Bacteria 16177
70 Ga0068863_100224402 3300005841 Bacteria 1811
71 Ga0068858_100049195 3300005842 Bacteria 3904
72 Ga0068858_101048331 3300005842 Unclassified 800
73 Ga0068858_101541464 3300005842 Unclassified 656
74 Ga0068860_100017886 3300005843 Bacteria 6903
75 Ga0068862_100007007 3300005844 Bacteria 9356
76 Ga0068862_101619670 3300005844 Unclassified 655
77 Ga0081539_10010160 3300005985 Bacteria 7715
78 Ga0070717_10147109 3300006028 Bacteria 2036
79 Ga0075368_10069690 3300006042 Unclassified 1418
80 Ga0075363_100201788 3300006048 Bacteria 1136
81 Ga0075364_10117474 3300006051 Bacteria 1778
82 Ga0075432_10337807 3300006058 Bacteria 635
83 Ga0070716_100817671 3300006173 Unclassified 723
84 Ga0075367_10089594 3300006178 Unclassified 1870
85 Ga0097621_100120846 3300006237 Bacteria 2222
86 Ga0097621_100563828 3300006237 Bacteria 1038
87 Ga0097621_101074257 3300006237 Unclassified 755
88 Ga0068871_100158390 3300006358 Bacteria 1935
89 Ga0075428_100113624 3300006844 Bacteria 2950
90 Ga0075430_100051856 3300006846 Unclassified 3455
91 Ga0075431_100043587 3300006847 Bacteria 4628
92 Ga0075431_100186278 3300006847 Bacteria 2128
93 Ga0075433_10080171 3300006852 Bacteria 2877
94 Ga0075433_10206976 3300006852 Unclassified 1744
95 Ga0075433_10485536 3300006852 Bacteria 1088
96 Ga0075434_100245143 3300006871 Bacteria 1812
97 Ga0075434_100308622 3300006871 Bacteria 1602
98 Ga0075434_100469550 3300006871 Unclassified 1279
99 Ga0075434_101098536 3300006871 Bacteria 809
100 Ga0075429_100021762 3300006880 Bacteria 5560
101 Ga0075429_100882504 3300006880 Unclassified 783
102 Ga0068865_100318123 3300006881 Bacteria 1251
103 Ga0075436_100317757 3300006914 Unclassified 1118
104 Ga0075436_100653321 3300006914 Unclassified 777
105 Ga0097620_100109959 3300006931 Bacteria 2818
106 Ga0097620_100133287 3300006931 Bacteria 2556
107 Ga0075435_100005472 3300007076 Bacteria 8873
108 Ga0075435_100037125 3300007076 Bacteria 3878
109 Ga0075435_100259806 3300007076 Bacteria 1479
110 Ga0075435_100692538 3300007076 Bacteria 886
111 Ga0111539_10063383 3300009094 Bacteria 4374
112 Ga0111539_10068558 3300009094 Bacteria 4188
113 Ga0111539_10119308 3300009094 Bacteria 3091
114 Ga0111539_10258459 3300009094 Bacteria 2027
115 Ga0105245_11784917 3300009098 Bacteria 668
116 Ga0105245_11823712 3300009098 Bacteria 661
117 Ga0105247_10013609 3300009101 Bacteria 4880
118 Ga0105247_10607754 3300009101 Unclassified 812
119 Ga0114129_10013283 3300009147 Bacteria 11734
120 Ga0114129_10023008 3300009147 Bacteria 8841
121 Ga0114129_10127134 3300009147 Bacteria 3504
122 Ga0114129_10348610 3300009147 Unclassified 1962
123 Ga0105243_11401487 3300009148 Bacteria 719
124 Ga0105248_10007449 3300009177 Bacteria 12008
125 Ga0105248_10093858 3300009177 Bacteria 3379
126 Ga0105248_10157556 3300009177 Bacteria 2562
127 Ga0105248_10346226 3300009177 Bacteria 1673
128 Ga0105248_10346767 3300009177 Bacteria 1672
129 Ga0105248_10444293 3300009177 Unclassified 1461
130 Ga0105248_11246954 3300009177 Unclassified 841
131 Ga0105249_10459923 3300009553 Bacteria 1312
132 Ga0105249_10657208 3300009553 Bacteria 1106
133 Ga0105239_10878167 3300010375 Bacteria 1029
134 Ga0105246_10466951 3300011119 Bacteria 1064
135 Ga0163162_10540111 3300013306 Bacteria 1294
136 Ga0157375_11217974 3300013308 Bacteria 883
137 Ga0157375_11241984 3300013308 Bacteria 875
138 Ga0157375_12021126 3300013308 Bacteria 685
139 Ga0163163_10000915 3300014325 Bacteria 25032
140 Ga0163163_10092511 3300014325 Bacteria 3039
141 Ga0157380_10052128 3300014326 Bacteria 3239
142 Ga0157380_10212984 3300014326 Bacteria 1723
143 Ga0157377_10105063 3300014745 Bacteria 1690
144 Ga0157379_10038033 3300014968 Bacteria 4293
145 Ga0157379_11485295 3300014968 Unclassified 659
146 Ga0157376_10069984 3300014969 Bacteria 2977
147 Ga0207697_10000181 3300025315 Bacteria 32579
148 Ga0207680_10227506 3300025903 Bacteria 1281
149 Ga0207680_10384980 3300025903 Bacteria 989
150 Ga0207699_10453339 3300025906 Bacteria 920
151 Ga0207645_10123892 3300025907 Bacteria 1679
152 Ga0207645_10198662 3300025907 Bacteria 1319
153 Ga0207643_10169904 3300025908 Bacteria 1315
154 Ga0207705_10671161 3300025909 Bacteria 806
155 Ga0207663_10403869 3300025916 Bacteria 1045
156 Ga0207662_10032964 3300025918 Unclassified 3017
157 Ga0207681_10023097 3300025923 Bacteria 3973
158 Ga0207694_10662069 3300025924 Unclassified 880
159 Ga0207650_10166547 3300025925 Bacteria 1749
160 Ga0207650_10309308 3300025925 Unclassified 1292
161 Ga0207659_10064242 3300025926 Bacteria 2655
162 Ga0207659_10069928 3300025926 Bacteria 2559
163 Ga0207700_10201529 3300025928 Unclassified 1677
164 Ga0207644_10418646 3300025931 Bacteria 1097
165 Ga0207690_10742039 3300025932 Unclassified 809
166 Ga0207706_10053215 3300025933 Bacteria 3574
167 Ga0207670_10514316 3300025936 Unclassified 974
168 Ga0207670_10969617 3300025936 Unclassified 714
169 Ga0207669_11616688 3300025937 Bacteria 553
170 Ga0207691_10457442 3300025940 Bacteria 1086
171 Ga0207711_10020757 3300025941 Bacteria 5481
172 Ga0207711_10045261 3300025941 Bacteria 3761
173 Ga0207711_10711032 3300025941 Bacteria 937
174 Ga0207661_10205396 3300025944 Bacteria 1734
175 Ga0207679_10100088 3300025945 Bacteria 2265
176 Ga0207679_10165685 3300025945 Bacteria 1814
177 Ga0207651_10051491 3300025960 Bacteria 2802
178 Ga0207651_10941924 3300025960 Unclassified 770
179 Ga0207712_11196842 3300025961 Bacteria 678
180 Ga0207668_10153696 3300025972 Bacteria 1785
181 Ga0207677_10095784 3300026023 Bacteria 2170
182 Ga0207677_10144400 3300026023 Unclassified 1827
183 Ga0207703_10057064 3300026035 Bacteria 3182
184 Ga0207678_10312243 3300026067 Bacteria 1352
185 Ga0207708_10059183 3300026075 Unclassified 2924
186 Ga0207708_10501946 3300026075 Unclassified 1017
187 Ga0207641_10000636 3300026088 Bacteria 38316
188 Ga0207641_10080396 3300026088 Bacteria 2828
189 Ga0207648_10846043 3300026089 Unclassified 853
190 Ga0207676_10046864 3300026095 Bacteria 3347
191 Ga0207674_10002736 3300026116 Bacteria 21988
192 Ga0207683_10025987 3300026121 Bacteria 5055
193 Ga0207683_10307675 3300026121 Bacteria 1450
194 Ga0207428_11216695 3300027907 Bacteria 524
195 Ga0268265_11235923 3300028380 Unclassified 745
196 Ga0268264_10060706 3300028381 Bacteria 3169
197 Ga0268264_10444553 3300028381 Bacteria 1255
198 Ga0307408_100090693 3300031548 Bacteria 2307
199 Ga0307408_100344579 3300031548 Bacteria 1262
200 Ga0307405_10050846 3300031731 Unclassified 2569
201 Ga0307405_10150262 3300031731 Bacteria 1637
202 Ga0307413_10615184 3300031824 Bacteria 891
203 Ga0307406_10090629 3300031901 Bacteria 2058
204 Ga0307407_10035598 3300031903 Bacteria 2737
205 Ga0307416_100015046 3300032002 Bacteria 5327
206 Ga0307416_100087256 3300032002 Unclassified 2663
207 Ga0307411_10153421 3300032005 Bacteria 1715
208 Ga0307415_100164826 3300032126 Unclassified 1722
209 Ga0373935_0383724 3300035692 Bacteria 1006
210 Ga0373933_0075202 3300035724 Bacteria 2062
211 Ga0373937_0026408 3300036401 Bacteria 5248
212 Ga0439435_0012700 3300042436 Bacteria 2047
213 Ga0495640_0111282 3300046533 Bacteria 1790
214 Ga0495586_0471241 3300046535 Unclassified 724
215 Ga0495609_0106825 3300046538 Bacteria 1210
216 Ga0495621_0244829 3300046539 Bacteria 731
217 Ga0495659_0095378 3300046664 Bacteria 1146
218 Ga0495658_0211743 3300046683 Bacteria 1211
219 Ga0495613_0504307 3300046689 Unclassified 814
220 Ga0495600_0050145 3300046809 Bacteria 2724
221 Ga0495636_0046380 3300047318 Bacteria 1812
222 Ga0495677_0132092 3300047445 Bacteria 956
223 Ga0495685_140713 3300047447 Unclassified 786
224 Ga0496102_0016648 3300048905 Bacteria 6429
225 Ga0496102_1021696 3300048905 Unclassified 747
226 Ga0496102_1681583 3300048905 Unclassified 553
227 Ga0496103_0204370 3300048906 Bacteria 1270
228 Ga0496104_0036913 3300048907 Bacteria 4569
229 Ga0496104_0088101 3300048907 Bacteria 2965
230 Ga0496104_0874714 3300048907 Unclassified 804
231 Ga0496106_0107944 3300048909 Bacteria 2165
232 Ga0496108_0053722 3300048911 Bacteria 3379
233 Ga0496109_0261295 3300048912 Bacteria 1631
234 Ga0496110_0077742 3300048913 Bacteria 2953
235 Ga0496112_0106578 3300048915 Bacteria 2772
236 Ga0496112_0114918 3300048915 Unclassified 2662
237 Ga0496113_0005067 3300048916 Bacteria 8179
238 Ga0496114_0025943 3300048917 Bacteria 4795
239 Ga0496114_0163126 3300048917 Bacteria 1939
240 Ga0496115_0241521 3300048918 Bacteria 1488
241 Ga0501067_0776283 3300049583 Unclassified 539
242 Ga0501069_0620015 3300049585 Bacteria 650
243 Ga0501075_0677518 3300049591 Unclassified 786
244 nmdc:mga05p37_1095680_c1 3300050507 Bacteria 835
245 nmdc:mga05p37_1631_c1 3300050507 Bacteria 26000
246 nmdc:mga05p37_21899_c1 3300050507 Bacteria 7744
247 nmdc:mga05p37_22577_c1 3300050507 Bacteria 7630
248 nmdc:mga05p37_5360_c1 3300050507 Bacteria 15078
249 nmdc:mga05p37_57317_c1 3300050507 Bacteria 4798
250 nmdc:mga09592_578515_c1 3300050508 Bacteria 963
251 nmdc:mga06r32_158556_c1 3300050510 Bacteria 2245
252 nmdc:mga08y16_284796_c1 3300050511 Bacteria 1704
253 nmdc:mga08y16_316384_c1 3300050511 Bacteria 1607
254 nmdc:mga08y16_57335_c1 3300050511 Bacteria 4070
255 nmdc:mga0n895_1061970_c1 3300050512 Unclassified 789
256 nmdc:mga0n895_1150485_c1 3300050512 Bacteria 752
257 nmdc:mga0n895_54783_c2 3300050512 Unclassified 2129
258 nmdc:mga0rr50_29114_c1 3300050513 Bacteria 3891
259 nmdc:mga0rr50_308360_c1 3300050513 Unclassified 1325
260 nmdc:mga0rr50_402850_c1 3300050513 Bacteria 1156
261 nmdc:mga08x19_191974_c1 3300050514 Unclassified 1398
262 nmdc:mga08x19_239206_c1 3300050514 Bacteria 1251
263 nmdc:mga08x19_861681_c1 3300050514 Bacteria 643
264 nmdc:mga0a205_53801_c1 3300050515 Bacteria 3886
265 Ga0495619_0298837 3300053085 Bacteria 1115
266 Ga0530510_0675018 3300061734 Bacteria 787
267 Ga0070706_100493739
268 Ga0065715_10140067
269 Ga0070676_10896164
270 Ga0070690_100026016
271 Ga0070690_101333726
272 Ga0070670_100069740
273 Ga0070670_100124668
274 Ga0070670_100129843
275 Ga0070670_100449306
276 Ga0068868_100106729
277 Ga0070687_100604804
278 Ga0070668_100799473
279 Ga0070669_100061908
280 Ga0070669_100366467
281 Ga0070675_100071762
282 Ga0070675_100611456
283 Ga0070671_100287961
284 Ga0070674_100583792
285 Ga0070673_101450220
286 Ga0070688_100285982
287 Ga0070688_100842163
288 Ga0070659_100861609
289 Ga0070667_100381657
290 Ga0070713_100107434
291 Ga0070705_100021720
292 Ga0070700_100647209
293 Ga0070694_100001228
294 Ga0070694_100020000
295 Ga0070694_100383925
296 Ga0070678_100022503
297 Ga0070678_100306325
298 Ga0070707_100157179
299 Ga0070707_100497564
300 Ga0070707_101512845
301 Ga0070698_100259646
302 Ga0070698_101042051
303 Ga0070699_100019455
304 Ga0070699_100124737
305 Ga0070699_100179000
306 Ga0070699_100380246
307 Ga0070679_100702332
308 Ga0070684_100181061
309 Ga0070684_100199540
310 Ga0070684_100244689
311 Ga0070697_100043947
312 Ga0070697_101871995
313 Ga0070686_100001805
314 Ga0070686_100323504
315 Ga0070695_100069374
316 Ga0070695_100299317
317 Ga0070695_100308309
318 Ga0070695_100458785
319 Ga0070696_100008917
320 Ga0070696_100367487
321 Ga0070696_100860068
322 Ga0070696_101173771
323 Ga0070693_100069794
324 Ga0070693_100505565
325 Ga0070704_100002706
326 Ga0070704_100188503
327 Ga0068855_100343933
328 Ga0070664_100033047
329 Ga0070664_100389553
330 Ga0068859_100109961
331 Ga0068864_100006150
332 Ga0068861_100900873
333 Ga0068870_10033995
334 Ga0068870_10285802
335 Ga0068863_100003214
336 Ga0068863_100224402
337 Ga0068858_100049195
338 Ga0068858_101048331
339 Ga0068858_101541464
340 Ga0068860_100017886
341 Ga0068862_100007007
342 Ga0068862_101619670
343 Ga0081539_10010160
344 Ga0070717_10147109
345 Ga0075368_10069690
346 Ga0075363_100201788
347 Ga0075364_10117474
348 Ga0075432_10337807
349 Ga0070716_100817671
350 Ga0075367_10089594
351 Ga0097621_100120846
352 Ga0097621_100563828
353 Ga0097621_101074257
354 Ga0068871_100158390
355 Ga0075428_100113624
356 Ga0075430_100051856
357 Ga0075431_100043587
358 Ga0075431_100186278
359 Ga0075433_10080171
360 Ga0075433_10206976
361 Ga0075433_10485536
362 Ga0075434_100245143
363 Ga0075434_100308622
364 Ga0075434_100469550
365 Ga0075434_101098536
366 Ga0075429_100021762
367 Ga0075429_100882504
368 Ga0068865_100318123
369 Ga0075436_100317757
370 Ga0075436_100653321
371 Ga0097620_100109959
372 Ga0097620_100133287
373 Ga0075435_100005472
374 Ga0075435_100037125
375 Ga0075435_100259806
376 Ga0075435_100692538
377 Ga0111539_10063383
378 Ga0111539_10068558
379 Ga0111539_10119308
380 Ga0111539_10258459
381 Ga0105245_11784917
382 Ga0105245_11823712
383 Ga0105247_10013609
384 Ga0105247_10607754
385 Ga0114129_10013283
386 Ga0114129_10023008
387 Ga0114129_10127134
388 Ga0114129_10348610
389 Ga0105243_11401487
390 Ga0105248_10007449
391 Ga0105248_10093858
392 Ga0105248_10157556
393 Ga0105248_10346226
394 Ga0105248_10346767
395 Ga0105248_10444293
396 Ga0105248_11246954
397 Ga0105249_10459923
398 Ga0105249_10657208
399 Ga0105239_10878167
400 Ga0105246_10466951
401 Ga0163162_10540111
402 Ga0157375_11217974
403 Ga0157375_11241984
404 Ga0157375_12021126
405 Ga0163163_10000915
406 Ga0163163_10092511
407 Ga0157380_10052128
408 Ga0157380_10212984
409 Ga0157377_10105063
410 Ga0157379_10038033
411 Ga0157379_11485295
412 Ga0157376_10069984
413 Ga0207697_10000181
414 Ga0207680_10227506
415 Ga0207680_10384980
416 Ga0207699_10453339
417 Ga0207645_10123892
418 Ga0207645_10198662
419 Ga0207643_10169904
420 Ga0207705_10671161
421 Ga0207663_10403869
422 Ga0207662_10032964
423 Ga0207681_10023097
424 Ga0207694_10662069
425 Ga0207650_10166547
426 Ga0207650_10309308
427 Ga0207659_10064242
428 Ga0207659_10069928
429 Ga0207700_10201529
430 Ga0207644_10418646
431 Ga0207690_10742039
432 Ga0207706_10053215
433 Ga0207670_10514316
434 Ga0207670_10969617
435 Ga0207669_11616688
436 Ga0207691_10457442
437 Ga0207711_10020757
438 Ga0207711_10045261
439 Ga0207711_10711032
440 Ga0207661_10205396
441 Ga0207679_10100088
442 Ga0207679_10165685
443 Ga0207651_10051491
444 Ga0207651_10941924
445 Ga0207712_11196842
446 Ga0207668_10153696
447 Ga0207677_10095784
448 Ga0207677_10144400
449 Ga0207703_10057064
450 Ga0207678_10312243
451 Ga0207708_10059183
452 Ga0207708_10501946
453 Ga0207641_10000636
454 Ga0207641_10080396
455 Ga0207648_10846043
456 Ga0207676_10046864
457 Ga0207674_10002736
458 Ga0207683_10025987
459 Ga0207683_10307675
460 Ga0207428_11216695
461 Ga0268265_11235923
462 Ga0268264_10060706
463 Ga0268264_10444553
464 Ga0307408_100090693
465 Ga0307408_100344579
466 Ga0307405_10050846
467 Ga0307405_10150262
468 Ga0307413_10615184
469 Ga0307406_10090629
470 Ga0307407_10035598
471 Ga0307416_100015046
472 Ga0307416_100087256
473 Ga0307411_10153421
474 Ga0307415_100164826
475 Ga0373935_0383724
476 Ga0373933_0075202
477 Ga0373937_0026408
478 Ga0439435_0012700
479 Ga0495640_0111282
480 Ga0495586_0471241
481 Ga0495609_0106825
482 Ga0495621_0244829
483 Ga0495659_0095378
484 Ga0495658_0211743
485 Ga0495613_0504307
486 Ga0495600_0050145
487 Ga0495636_0046380
488 Ga0495677_0132092
489 Ga0495685_140713
490 Ga0496102_0016648
491 Ga0496102_1021696
492 Ga0496102_1681583
493 Ga0496103_0204370
494 Ga0496104_0036913
495 Ga0496104_0088101
496 Ga0496104_0874714
497 Ga0496106_0107944
498 Ga0496108_0053722
499 Ga0496109_0261295
500 Ga0496110_0077742
501 Ga0496112_0106578
502 Ga0496112_0114918
503 Ga0496113_0005067
504 Ga0496114_0025943
505 Ga0496114_0163126
506 Ga0496115_0241521
507 Ga0501067_0776283
508 Ga0501069_0620015
509 Ga0501075_0677518
510 nmdc:mga05p37_1095680_c1
511 nmdc:mga05p37_1631_c1
512 nmdc:mga05p37_21899_c1
513 nmdc:mga05p37_22577_c1
514 nmdc:mga05p37_5360_c1
515 nmdc:mga05p37_57317_c1
516 nmdc:mga09592_578515_c1
517 nmdc:mga06r32_158556_c1
518 nmdc:mga08y16_284796_c1
519 nmdc:mga08y16_316384_c1
520 nmdc:mga08y16_57335_c1
521 nmdc:mga0n895_1061970_c1
522 nmdc:mga0n895_1150485_c1
523 nmdc:mga0n895_54783_c2
524 nmdc:mga0rr50_29114_c1
525 nmdc:mga0rr50_308360_c1
526 nmdc:mga0rr50_402850_c1
527 nmdc:mga08x19_191974_c1
528 nmdc:mga08x19_239206_c1
529 nmdc:mga08x19_861681_c1
530 nmdc:mga0a205_53801_c1
531 Ga0495619_0298837
532 Ga0530510_0675018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rpx-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.821 36 63
6szw-assembly1.cif.gz_B asymmetric complex of factor xii and kininogen with gc1qr/c1qbp/p32 is governed by allostery 0.7762 36 60
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.7549 59 136
2i45-assembly1.cif.gz_A crystal structure of protein nmb1881 from neisseria meningitidis 0.7515 47 136
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7476 54 132
ID Description Score Start End Superfamily
3rpxC00 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.83 36 60 3.10.280.10
af_P77154_664_736_2.60.420.10 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.8055 37 63 2.60.420.10
3lwcA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7603 47 137 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.755 47 136 2.60.120.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7549 59 136 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1G3XR06-F1-model_v4 Cupin 0.9738 38 133
AF-D0J0C6-F1-model_v4 deleted 0.9733 48 133
AF-A0A382FK91-F1-model_v4 Cupin type-2 domain-containing protein 0.973 57 132
AF-A0A3C2BTZ6-F1-model_v4 Cupin 0.9704 78 132
AF-W8F0P9-F1-model_v4 Uncharacterized protein 0.9698 34 117

Map