F373610

General Info

Members Datasets Scaffolds Average Seq Length
265 147 530 121

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0103113|Ga0501033_0103113_1670_2047
Length 125
Sequence MAAYDSNNIFARILRGEIPCKKVHEDEHVLAFHDINPQAPTHVLIIPKGAYVSFDDFSQNATPAEITAFTRAVGAIARQCGLAPNGDDGGYRILANIGNNGGQEVPHFHVHLFGGRKLGRMIAKD

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
146 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
147 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.38
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 1.13
Rhizosphere 89.43
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0103113 3300049570 Bacteria 2081
2 Ga0070683_101844178 3300005329 Bacteria 581
3 Ga0070680_100003831 3300005336 Bacteria 11249
4 Ga0070680_100031978 3300005336 Bacteria 4232
5 Ga0070680_100043877 3300005336 Bacteria 3633
6 Ga0070680_101407894 3300005336 Bacteria 604
7 Ga0070668_100730205 3300005347 Bacteria 875
8 Ga0070659_100008272 3300005366 Bacteria 7595
9 Ga0070709_10227999 3300005434 Bacteria 1332
10 Ga0070709_10310702 3300005434 Bacteria 1154
11 Ga0070714_100012306 3300005435 Bacteria 6826
12 Ga0070714_100712222 3300005435 Bacteria 969
13 Ga0070714_100793494 3300005435 Bacteria 917
14 Ga0070714_100810645 3300005435 Bacteria 907
15 Ga0070713_100109120 3300005436 Bacteria 2410
16 Ga0070713_100246107 3300005436 Bacteria 1629
17 Ga0070713_100258042 3300005436 Bacteria 1592
18 Ga0070713_100468015 3300005436 Bacteria 1186
19 Ga0070713_100919681 3300005436 Bacteria 842
20 Ga0070713_101577772 3300005436 Bacteria 637
21 Ga0070710_10032289 3300005437 Bacteria 2835
22 Ga0070710_10522477 3300005437 Bacteria 816
23 Ga0070711_100103678 3300005439 Bacteria 2073
24 Ga0070711_100127535 3300005439 Bacteria 1890
25 Ga0070711_100319158 3300005439 Bacteria 1241
26 Ga0070711_101001503 3300005439 Bacteria 717
27 Ga0070711_101238894 3300005439 Bacteria 646
28 Ga0070705_100387828 3300005440 Bacteria 1030
29 Ga0070705_101575767 3300005440 Bacteria 552
30 Ga0070708_100193871 3300005445 Bacteria 1901
31 Ga0070708_100568046 3300005445 Bacteria 1070
32 Ga0070708_100703144 3300005445 Bacteria 951
33 Ga0070681_10000290 3300005458 Bacteria 40569
34 Ga0070681_10024201 3300005458 Bacteria 6113
35 Ga0070681_10034474 3300005458 Bacteria 5082
36 Ga0070681_10191122 3300005458 Bacteria 1967
37 Ga0070681_10569317 3300005458 Bacteria 1047
38 Ga0070681_11615545 3300005458 Bacteria 574
39 Ga0070706_100206810 3300005467 Bacteria 1833
40 Ga0070706_100234022 3300005467 Bacteria 1715
41 Ga0070706_100806809 3300005467 Bacteria 869
42 Ga0070707_100011243 3300005468 Bacteria 8343
43 Ga0070707_100317950 3300005468 Bacteria 1513
44 Ga0070707_101021626 3300005468 Unclassified 792
45 Ga0070698_100012123 3300005471 Bacteria 9135
46 Ga0070698_100099919 3300005471 Bacteria 2874
47 Ga0070679_100006551 3300005530 Bacteria 10853
48 Ga0070679_100066376 3300005530 Bacteria 3597
49 Ga0070679_100122975 3300005530 Bacteria 2579
50 Ga0070679_100970114 3300005530 Bacteria 794
51 Ga0070679_101349905 3300005530 Bacteria 659
52 Ga0070684_100192723 3300005535 Bacteria 1855
53 Ga0070697_100562872 3300005536 Bacteria 1000
54 Ga0070697_100573940 3300005536 Bacteria 990
55 Ga0070695_100932166 3300005545 Bacteria 703
56 Ga0070696_101926973 3300005546 Unclassified 512
57 Ga0070665_101327739 3300005548 Bacteria 729
58 Ga0068855_100664491 3300005563 Bacteria 1118
59 Ga0068855_100842477 3300005563 Bacteria 972
60 Ga0070664_101437289 3300005564 Bacteria 652
61 Ga0068857_100099537 3300005577 Bacteria 2608
62 Ga0068856_101141355 3300005614 Bacteria 796
63 Ga0068856_101931036 3300005614 Bacteria 601
64 Ga0068852_102617693 3300005616 Bacteria 524
65 Ga0068864_100511161 3300005618 Bacteria 1157
66 Ga0068860_101043784 3300005843 Bacteria 836
67 Ga0081540_1012038 3300005983 Bacteria 5726
68 Ga0070717_10002015 3300006028 Bacteria 14209
69 Ga0070717_10095389 3300006028 Bacteria 2518
70 Ga0070715_10123621 3300006163 Bacteria 1237
71 Ga0070716_100516625 3300006173 Bacteria 884
72 Ga0070712_100011034 3300006175 Bacteria 5717
73 Ga0070712_100074436 3300006175 Bacteria 2439
74 Ga0070712_100105734 3300006175 Bacteria 2091
75 Ga0070712_100204286 3300006175 Bacteria 1554
76 Ga0070712_101470436 3300006175 Bacteria 595
77 Ga0097621_100202622 3300006237 Bacteria 1723
78 Ga0068871_100328114 3300006358 Bacteria 1349
79 Ga0068871_100889579 3300006358 Bacteria 825
80 Ga0075436_100397963 3300006914 Bacteria 998
81 Ga0105240_10036942 3300009093 Bacteria 6279
82 Ga0105240_10985503 3300009093 Bacteria 902
83 Ga0105240_11104384 3300009093 Bacteria 844
84 Ga0114129_13291417 3300009147 Bacteria 523
85 Ga0105248_10720534 3300009177 Bacteria 1126
86 Ga0105237_10415909 3300009545 Bacteria 1350
87 Ga0105237_10813608 3300009545 Bacteria 941
88 Ga0105238_10504751 3300009551 Bacteria 1211
89 Ga0105238_10532157 3300009551 Bacteria 1178
90 Ga0105249_12637058 3300009553 Bacteria 575
91 Ga0099796_10003629 3300010159 Bacteria 3614
92 Ga0105239_11284806 3300010375 Bacteria 844
93 Ga0157373_10399721 3300013100 Bacteria 985
94 Ga0157370_10041049 3300013104 Bacteria 4466
95 Ga0157370_10331076 3300013104 Bacteria 1404
96 Ga0157370_10609936 3300013104 Bacteria 999
97 Ga0157369_10001671 3300013105 Bacteria 27057
98 Ga0157378_10620194 3300013297 Bacteria 1095
99 Ga0163162_11246802 3300013306 Bacteria 844
100 Ga0157372_10825520 3300013307 Bacteria 1076
101 Ga0157372_11685010 3300013307 Bacteria 729
102 Ga0157372_13104325 3300013307 Bacteria 530
103 Ga0163163_11207441 3300014325 Bacteria 819
104 Ga0163163_12611231 3300014325 Bacteria 563
105 Ga0157376_10782135 3300014969 Bacteria 966
106 Ga0182007_10068721 3300015262 Bacteria 1160
107 Ga0213873_10069864 3300021358 Bacteria 966
108 Ga0213872_10040175 3300021361 Bacteria 2136
109 Ga0213876_10415935 3300021384 Bacteria 715
110 Ga0213875_10000417 3300021388 Bacteria 37407
111 Ga0213871_10116872 3300021441 Bacteria 792
112 Ga0207692_10264806 3300025898 Bacteria 1035
113 Ga0207685_10415939 3300025905 Bacteria 692
114 Ga0207699_10079335 3300025906 Bacteria 2030
115 Ga0207699_10531346 3300025906 Bacteria 851
116 Ga0207705_10124331 3300025909 Bacteria 1916
117 Ga0207684_10200410 3300025910 Bacteria 1722
118 Ga0207707_10005011 3300025912 Bacteria 11631
119 Ga0207707_10052631 3300025912 Bacteria 3544
120 Ga0207707_10110241 3300025912 Bacteria 2405
121 Ga0207707_10221826 3300025912 Bacteria 1646
122 Ga0207695_10054956 3300025913 Bacteria 4153
123 Ga0207693_10003042 3300025915 Bacteria 14489
124 Ga0207693_10039365 3300025915 Bacteria 3722
125 Ga0207693_10161077 3300025915 Bacteria 1765
126 Ga0207693_10392425 3300025915 Bacteria 1085
127 Ga0207663_10203274 3300025916 Bacteria 1430
128 Ga0207663_10322770 3300025916 Bacteria 1161
129 Ga0207663_10399659 3300025916 Bacteria 1051
130 Ga0207663_11208417 3300025916 Bacteria 609
131 Ga0207660_10242057 3300025917 Bacteria 1421
132 Ga0207660_10339057 3300025917 Bacteria 1203
133 Ga0207660_10842710 3300025917 Bacteria 748
134 Ga0207652_10017532 3300025921 Bacteria 5860
135 Ga0207652_10032511 3300025921 Bacteria 4387
136 Ga0207652_10146723 3300025921 Bacteria 2112
137 Ga0207652_11200679 3300025921 Bacteria 660
138 Ga0207646_10027835 3300025922 Bacteria 5153
139 Ga0207646_10734612 3300025922 Bacteria 881
140 Ga0207646_11290825 3300025922 Bacteria 638
141 Ga0207694_10698322 3300025924 Bacteria 856
142 Ga0207700_10233735 3300025928 Bacteria 1564
143 Ga0207700_10847833 3300025928 Bacteria 818
144 Ga0207664_10215764 3300025929 Bacteria 1662
145 Ga0207690_10027284 3300025932 Bacteria 3608
146 Ga0207665_10557946 3300025939 Bacteria 891
147 Ga0207665_10822118 3300025939 Bacteria 735
148 Ga0207665_11125295 3300025939 Bacteria 626
149 Ga0207667_10500485 3300025949 Bacteria 1233
150 Ga0207667_10677392 3300025949 Bacteria 1035
151 Ga0207640_11385727 3300025981 Bacteria 630
152 Ga0207648_11079049 3300026089 Bacteria 753
153 Ga0207676_10822639 3300026095 Bacteria 907
154 Ga0207674_10439623 3300026116 Bacteria 1261
155 Ga0207675_100928044 3300026118 Bacteria 887
156 Ga0268266_10730830 3300028379 Bacteria 955
157 Ga0265338_10326631 3300028800 Bacteria 1109
158 Ga0310981_1078155 3300029285 Bacteria 544
159 Ga0265328_10318054 3300031239 Unclassified 603
160 Ga0265340_10321496 3300031247 Bacteria 685
161 Ga0265327_10000703 3300031251 Bacteria 53052
162 Ga0265316_10018469 3300031344 Bacteria 5991
163 Ga0307408_100084191 3300031548 Unclassified 2385
164 Ga0307408_100783838 3300031548 Bacteria 864
165 Ga0265314_10027077 3300031711 Bacteria 4297
166 Ga0316577_10484172 3300031733 Bacteria 703
167 Ga0307406_12064869 3300031901 Bacteria 510
168 Ga0307412_10770964 3300031911 Unclassified 832
169 Ga0307409_100115314 3300031995 Bacteria 2262
170 Ga0307411_10082194 3300032005 Bacteria 2220
171 Ga0373923_0213878 3300035111 Bacteria 894
172 Ga0373953_0033695 3300035117 Bacteria 2004
173 Ga0373956_0088503 3300035119 Bacteria 1427
174 Ga0373957_0012907 3300035120 Bacteria 2823
175 Ga0373955_0108539 3300035172 Bacteria 1602
176 Ga0316574_0440467 3300035398 Bacteria 817
177 Ga0373935_1015569 3300035692 Bacteria 616
178 Ga0373933_0001204 3300035724 Bacteria 15332
179 Ga0373933_0955707 3300035724 Unclassified 564
180 Ga0373937_0016396 3300036401 Bacteria 6580
181 Ga0373937_0200801 3300036401 Bacteria 1874
182 Ga0373937_0428580 3300036401 Bacteria 1255
183 Ga0316584_0046849 3300036712 Bacteria 3229
184 Ga0373925_0594707 3300037068 Bacteria 911
185 Ga0436364_0157955 3300037853 Bacteria 52897
186 Ga0436364_0263946 3300037853 Bacteria 1291
187 Ga0436364_1348565 3300037853 Bacteria 28540
188 Ga0436364_1350314 3300037853 Bacteria 3314
189 Ga0436364_1364332 3300037853 Bacteria 1347
190 Ga0400483_072440 3300039062 Bacteria 5334
191 Ga0400483_228929 3300039062 Bacteria 58877
192 Ga0400483_248804 3300039062 Bacteria 4886
193 Ga0400483_278516 3300039062 Bacteria 2040
194 Ga0436365_0077810 3300039437 Bacteria 951
195 Ga0436365_0357761 3300039437 Bacteria 2643
196 Ga0436365_1260090 3300039437 Bacteria 5517
197 Ga0436365_1271631 3300039437 Bacteria 713
198 Ga0436360_0069950 3300039438 Bacteria 1353
199 Ga0436360_0311086 3300039438 Bacteria 1563
200 Ga0436360_0335940 3300039438 Bacteria 975
201 Ga0436360_0816734 3300039438 Bacteria 1640
202 Ga0436360_0863251 3300039438 Bacteria 863
203 Ga0436360_1356749 3300039438 Bacteria 1539
204 Ga0436361_0068941 3300039447 Bacteria 579
205 Ga0436361_0491119 3300039447 Bacteria 575
206 Ga0436361_0531772 3300039447 Bacteria 933
207 Ga0436361_0714999 3300039447 Bacteria 968
208 Ga0436361_0718481 3300039447 Bacteria 2155
209 Ga0436361_0853495 3300039447 Bacteria 6292
210 Ga0436361_0904909 3300039447 Bacteria 2370
211 Ga0436363_0245692 3300039450 Bacteria 2187
212 Ga0436363_0356309 3300039450 Bacteria 1935
213 Ga0436363_0541252 3300039450 Bacteria 913
214 Ga0436363_0752828 3300039450 Bacteria 729
215 Ga0436363_1029757 3300039450 Bacteria 1271
216 Ga0436363_1131176 3300039450 Bacteria 522
217 Ga0436362_0005590 3300039453 Bacteria 3872
218 Ga0436362_0672817 3300039453 Bacteria 529
219 Ga0436362_0866112 3300039453 Bacteria 2188
220 Ga0436362_0957854 3300039453 Bacteria 535
221 Ga0436362_1130143 3300039453 Bacteria 1758
222 Ga0466963_0128341 3300044694 Bacteria 1750
223 Ga0466963_1076478 3300044694 Bacteria 566
224 Ga0453684_0009982 3300044712 Bacteria 16365
225 Ga0451576_0000402 3300045051 Bacteria 100964
226 Ga0495592_0032104 3300046454 Bacteria 3966
227 Ga0495662_0016454 3300046476 Bacteria 3582
228 Ga0495628_0623821 3300046516 Bacteria 768
229 Ga0495640_0442417 3300046533 Bacteria 795
230 Ga0495640_0676005 3300046533 Bacteria 620
231 Ga0495586_0054005 3300046535 Bacteria 2177
232 Ga0495667_0018735 3300046559 Bacteria 4673
233 Ga0495634_0172822 3300046642 Bacteria 1357
234 Ga0495635_0009495 3300046663 Bacteria 6799
235 Ga0495599_0112141 3300046678 Bacteria 1698
236 Ga0495600_0027867 3300046809 Bacteria 3653
237 Ga0495600_0329047 3300046809 Bacteria 960
238 Ga0495676_0827582 3300047321 Bacteria 595
239 Ga0496112_0486690 3300048915 Bacteria 1170
240 Ga0496115_1205037 3300048918 Bacteria 569
241 Ga0496115_1343355 3300048918 Bacteria 530
242 Ga0501034_0176247 3300049571 Bacteria 2104
243 Ga0501034_0645171 3300049571 Bacteria 961
244 Ga0501047_0163757 3300049581 Bacteria 2095
245 Ga0501067_0193506 3300049583 Bacteria 1133
246 Ga0501070_0022882 3300049586 Bacteria 5231
247 Ga0501070_0598256 3300049586 Bacteria 879
248 Ga0501074_1147140 3300049590 Bacteria 545
249 Ga0501080_0243142 3300049742 Bacteria 1642
250 Ga0501080_0515688 3300049742 Bacteria 1067
251 Ga0501080_0984529 3300049742 Bacteria 732
252 Ga0501035_0361589 3300049822 Bacteria 1213
253 Ga0501044_0727303 3300049823 Bacteria 876
254 Ga0495601_0018350 3300053077 Bacteria 4256
255 Ga0495595_0004136 3300053084 Bacteria 5825
256 Ga0495595_0382282 3300053084 Bacteria 712
257 Ga0495619_0002580 3300053085 Bacteria 11834
258 Ga0495619_0075196 3300053085 Bacteria 2266
259 Ga0495619_0138581 3300053085 Bacteria 1674
260 Ga0500643_070840 3300053087 Unclassified 967
261 Ga0501082_0424339 3300060353 Bacteria 1161
262 Ga0530510_0916380 3300061734 Bacteria 670
263 2909399991 2909399089 Bacteria 3922598
264 2929200124 2929199973 Bacteria 7260745
265 8055912240 8055909800 Bacteria 7278581
266 Ga0501033_0103113
267 Ga0070683_101844178
268 Ga0070680_100003831
269 Ga0070680_100031978
270 Ga0070680_100043877
271 Ga0070680_101407894
272 Ga0070668_100730205
273 Ga0070659_100008272
274 Ga0070709_10227999
275 Ga0070709_10310702
276 Ga0070714_100012306
277 Ga0070714_100712222
278 Ga0070714_100793494
279 Ga0070714_100810645
280 Ga0070713_100109120
281 Ga0070713_100246107
282 Ga0070713_100258042
283 Ga0070713_100468015
284 Ga0070713_100919681
285 Ga0070713_101577772
286 Ga0070710_10032289
287 Ga0070710_10522477
288 Ga0070711_100103678
289 Ga0070711_100127535
290 Ga0070711_100319158
291 Ga0070711_101001503
292 Ga0070711_101238894
293 Ga0070705_100387828
294 Ga0070705_101575767
295 Ga0070708_100193871
296 Ga0070708_100568046
297 Ga0070708_100703144
298 Ga0070681_10000290
299 Ga0070681_10024201
300 Ga0070681_10034474
301 Ga0070681_10191122
302 Ga0070681_10569317
303 Ga0070681_11615545
304 Ga0070706_100206810
305 Ga0070706_100234022
306 Ga0070706_100806809
307 Ga0070707_100011243
308 Ga0070707_100317950
309 Ga0070707_101021626
310 Ga0070698_100012123
311 Ga0070698_100099919
312 Ga0070679_100006551
313 Ga0070679_100066376
314 Ga0070679_100122975
315 Ga0070679_100970114
316 Ga0070679_101349905
317 Ga0070684_100192723
318 Ga0070697_100562872
319 Ga0070697_100573940
320 Ga0070695_100932166
321 Ga0070696_101926973
322 Ga0070665_101327739
323 Ga0068855_100664491
324 Ga0068855_100842477
325 Ga0070664_101437289
326 Ga0068857_100099537
327 Ga0068856_101141355
328 Ga0068856_101931036
329 Ga0068852_102617693
330 Ga0068864_100511161
331 Ga0068860_101043784
332 Ga0081540_1012038
333 Ga0070717_10002015
334 Ga0070717_10095389
335 Ga0070715_10123621
336 Ga0070716_100516625
337 Ga0070712_100011034
338 Ga0070712_100074436
339 Ga0070712_100105734
340 Ga0070712_100204286
341 Ga0070712_101470436
342 Ga0097621_100202622
343 Ga0068871_100328114
344 Ga0068871_100889579
345 Ga0075436_100397963
346 Ga0105240_10036942
347 Ga0105240_10985503
348 Ga0105240_11104384
349 Ga0114129_13291417
350 Ga0105248_10720534
351 Ga0105237_10415909
352 Ga0105237_10813608
353 Ga0105238_10504751
354 Ga0105238_10532157
355 Ga0105249_12637058
356 Ga0099796_10003629
357 Ga0105239_11284806
358 Ga0157373_10399721
359 Ga0157370_10041049
360 Ga0157370_10331076
361 Ga0157370_10609936
362 Ga0157369_10001671
363 Ga0157378_10620194
364 Ga0163162_11246802
365 Ga0157372_10825520
366 Ga0157372_11685010
367 Ga0157372_13104325
368 Ga0163163_11207441
369 Ga0163163_12611231
370 Ga0157376_10782135
371 Ga0182007_10068721
372 Ga0213873_10069864
373 Ga0213872_10040175
374 Ga0213876_10415935
375 Ga0213875_10000417
376 Ga0213871_10116872
377 Ga0207692_10264806
378 Ga0207685_10415939
379 Ga0207699_10079335
380 Ga0207699_10531346
381 Ga0207705_10124331
382 Ga0207684_10200410
383 Ga0207707_10005011
384 Ga0207707_10052631
385 Ga0207707_10110241
386 Ga0207707_10221826
387 Ga0207695_10054956
388 Ga0207693_10003042
389 Ga0207693_10039365
390 Ga0207693_10161077
391 Ga0207693_10392425
392 Ga0207663_10203274
393 Ga0207663_10322770
394 Ga0207663_10399659
395 Ga0207663_11208417
396 Ga0207660_10242057
397 Ga0207660_10339057
398 Ga0207660_10842710
399 Ga0207652_10017532
400 Ga0207652_10032511
401 Ga0207652_10146723
402 Ga0207652_11200679
403 Ga0207646_10027835
404 Ga0207646_10734612
405 Ga0207646_11290825
406 Ga0207694_10698322
407 Ga0207700_10233735
408 Ga0207700_10847833
409 Ga0207664_10215764
410 Ga0207690_10027284
411 Ga0207665_10557946
412 Ga0207665_10822118
413 Ga0207665_11125295
414 Ga0207667_10500485
415 Ga0207667_10677392
416 Ga0207640_11385727
417 Ga0207648_11079049
418 Ga0207676_10822639
419 Ga0207674_10439623
420 Ga0207675_100928044
421 Ga0268266_10730830
422 Ga0265338_10326631
423 Ga0310981_1078155
424 Ga0265328_10318054
425 Ga0265340_10321496
426 Ga0265327_10000703
427 Ga0265316_10018469
428 Ga0307408_100084191
429 Ga0307408_100783838
430 Ga0265314_10027077
431 Ga0316577_10484172
432 Ga0307406_12064869
433 Ga0307412_10770964
434 Ga0307409_100115314
435 Ga0307411_10082194
436 Ga0373923_0213878
437 Ga0373953_0033695
438 Ga0373956_0088503
439 Ga0373957_0012907
440 Ga0373955_0108539
441 Ga0316574_0440467
442 Ga0373935_1015569
443 Ga0373933_0001204
444 Ga0373933_0955707
445 Ga0373937_0016396
446 Ga0373937_0200801
447 Ga0373937_0428580
448 Ga0316584_0046849
449 Ga0373925_0594707
450 Ga0436364_0157955
451 Ga0436364_0263946
452 Ga0436364_1348565
453 Ga0436364_1350314
454 Ga0436364_1364332
455 Ga0400483_072440
456 Ga0400483_228929
457 Ga0400483_248804
458 Ga0400483_278516
459 Ga0436365_0077810
460 Ga0436365_0357761
461 Ga0436365_1260090
462 Ga0436365_1271631
463 Ga0436360_0069950
464 Ga0436360_0311086
465 Ga0436360_0335940
466 Ga0436360_0816734
467 Ga0436360_0863251
468 Ga0436360_1356749
469 Ga0436361_0068941
470 Ga0436361_0491119
471 Ga0436361_0531772
472 Ga0436361_0714999
473 Ga0436361_0718481
474 Ga0436361_0853495
475 Ga0436361_0904909
476 Ga0436363_0245692
477 Ga0436363_0356309
478 Ga0436363_0541252
479 Ga0436363_0752828
480 Ga0436363_1029757
481 Ga0436363_1131176
482 Ga0436362_0005590
483 Ga0436362_0672817
484 Ga0436362_0866112
485 Ga0436362_0957854
486 Ga0436362_1130143
487 Ga0466963_0128341
488 Ga0466963_1076478
489 Ga0453684_0009982
490 Ga0451576_0000402
491 Ga0495592_0032104
492 Ga0495662_0016454
493 Ga0495628_0623821
494 Ga0495640_0442417
495 Ga0495640_0676005
496 Ga0495586_0054005
497 Ga0495667_0018735
498 Ga0495634_0172822
499 Ga0495635_0009495
500 Ga0495599_0112141
501 Ga0495600_0027867
502 Ga0495600_0329047
503 Ga0495676_0827582
504 Ga0496112_0486690
505 Ga0496115_1205037
506 Ga0496115_1343355
507 Ga0501034_0176247
508 Ga0501034_0645171
509 Ga0501047_0163757
510 Ga0501067_0193506
511 Ga0501070_0022882
512 Ga0501070_0598256
513 Ga0501074_1147140
514 Ga0501080_0243142
515 Ga0501080_0515688
516 Ga0501080_0984529
517 Ga0501035_0361589
518 Ga0501044_0727303
519 Ga0495601_0018350
520 Ga0495595_0004136
521 Ga0495595_0382282
522 Ga0495619_0002580
523 Ga0495619_0075196
524 Ga0495619_0138581
525 Ga0500643_070840
526 Ga0501082_0424339
527 Ga0530510_0916380
528 2909399991
529 2929200124
530 8055912240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

15

118

0.92

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

7

122

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgl-assembly2.cif.gz_D hit like protein 0.9332 7 111
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9323 6 114
3o1c-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine 0.9195 6 114
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9182 6 114
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.9172 8 120
ID Description Score Start End Superfamily
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9456 7 111 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9279 7 111 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9172 6 117 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9082 1 114 3.30.428.10
3n1sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9079 8 119 3.30.428.10
ID Description Score Start End GO Terms
AF-A3K922-F1-model_v4 Possible Histidine triad (HIT) protein 0.9962 2 118 GO:0003824
AF-A0A2A2K750-F1-model_v4 HIT domain-containing protein 0.9943 1 117 GO:0003824
GO:0015171
GO:0016020
AF-A0A845S519-F1-model_v4 Histidine triad nucleotide-binding protein 0.9938 2 106 GO:0003824
AF-A0A2H6B0R7-F1-model_v4 Putative HIT-like protein 0.9935 1 120 GO:0003824
AF-A0A7X4CWU7-F1-model_v4 Histidine triad nucleotide-binding protein 0.993 1 109 GO:0003824

Map