F373584

General Info

Members Datasets Scaffolds Average Seq Length
265 172 530 445

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0012594|Ga0496112_0012594_3201_4694
Length 497
Sequence VISLRATTKDLQVTDSRILNHLRSREKQITRPLHRLSRKRMLVRVAAALEVTLLLIATTHLRAQETTPAPPADTTEKEKEERPTGLPKKVNWKFNFDAAWGTFGFANSLYTNVRPDPSGNLSDNWFEGYLKPALSGSIALGESELYGKISGVGERTYGAPPSLVGESASSFKQEDLYIGWRSGKSFSNSDHLFDFTAGRAPYTIGHGFLIWDGAGEGGSRGGFWSNARKAWQYAAIGRFKPKNHTFEGFYLDRDELPENDSGTRLTGVNYEYAPGENSTFGATYAKVYARRNILPLRDGMNVYNLRAYTAPFSGLSDLSFEAEYAYENNRSLMNSTAWTVQGAYKLSKVAWTPKLSYRYAFFEGDNPNTVRNEAFDPLFLGFYDWGTWWQGEIAGEYFLANSNNVSHQARIHMSPSDSLGWGVMGYWFRVPQPATFGDGATSSNVAFEFDSYLDWKINKNFTLSVVGAFADPHQAAQQAFHRTDNFAYGMVYIAYSF

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 2738541276 Cellvibrio sp. YR554 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.75
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 5.66
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 17.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0012594 3300048915 Bacteria 7772
2 rootL2_10178189 3300003322 Bacteria 5056
3 Ga0058861_11995709 3300004800 Bacteria 1699
4 Ga0058862_12841695 3300004803 Bacteria 1934
5 Ga0065707_10148504 3300005295 Bacteria 1685
6 Ga0070676_10025208 3300005328 Bacteria 3359
7 Ga0070683_100010642 3300005329 Bacteria 7908
8 Ga0070683_100117212 3300005329 Bacteria 2514
9 Ga0070690_100100446 3300005330 Unclassified 1918
10 Ga0070670_100056591 3300005331 Bacteria 3365
11 Ga0070670_100098468 3300005331 Bacteria 2516
12 Ga0070670_100129412 3300005331 Bacteria 2179
13 Ga0068869_100001265 3300005334 Bacteria 14952
14 Ga0068869_100033282 3300005334 Bacteria 3638
15 Ga0070680_100021889 3300005336 Bacteria 5085
16 Ga0068868_100037743 3300005338 Bacteria 3747
17 Ga0068868_100156935 3300005338 Unclassified 1877
18 Ga0070660_100057858 3300005339 Bacteria 3005
19 Ga0070689_100020041 3300005340 Bacteria 4957
20 Ga0070661_100015437 3300005344 Bacteria 5391
21 Ga0070692_10024519 3300005345 Unclassified 2965
22 Ga0070668_100055289 3300005347 Bacteria 3063
23 Ga0070669_100017627 3300005353 Bacteria 5094
24 Ga0070675_100065711 3300005354 Bacteria 2999
25 Ga0070673_100121631 3300005364 Bacteria 2178
26 Ga0070688_100012715 3300005365 Unclassified 4724
27 Ga0070659_100145830 3300005366 Bacteria 1928
28 Ga0070709_10000924 3300005434 Bacteria 16265
29 Ga0070713_100004813 3300005436 Bacteria 9146
30 Ga0070713_100014298 3300005436 Bacteria 5889
31 Ga0070701_10008147 3300005438 Bacteria 4515
32 Ga0070705_100009502 3300005440 Bacteria 4836
33 Ga0070694_100015772 3300005444 Bacteria 4752
34 Ga0070694_100023001 3300005444 Bacteria 4002
35 Ga0070694_100045281 3300005444 Unclassified 2948
36 Ga0070694_100062482 3300005444 Unclassified 2544
37 Ga0070663_100055246 3300005455 Bacteria 2841
38 Ga0070681_10017958 3300005458 Bacteria 7070
39 Ga0070681_10022422 3300005458 Bacteria 6341
40 Ga0068867_100178684 3300005459 Unclassified 1686
41 Ga0070685_10037738 3300005466 Bacteria 2738
42 Ga0070679_100015481 3300005530 Bacteria 7330
43 Ga0070684_100079450 3300005535 Bacteria 2900
44 Ga0070672_100015522 3300005543 Bacteria 5426
45 Ga0070686_100043257 3300005544 Unclassified 2826
46 Ga0070695_100074859 3300005545 Bacteria 2226
47 Ga0070696_100054804 3300005546 Bacteria 2780
48 Ga0070693_100035777 3300005547 Bacteria 2757
49 Ga0070693_100151051 3300005547 Unclassified 1471
50 Ga0070704_100002346 3300005549 Bacteria 10618
51 Ga0070704_100090727 3300005549 Unclassified 2277
52 Ga0068855_100118725 3300005563 Bacteria 3028
53 Ga0070664_100016367 3300005564 Bacteria 6079
54 Ga0070664_100105749 3300005564 Bacteria 2451
55 Ga0068856_100125604 3300005614 Bacteria 2569
56 Ga0070702_100070473 3300005615 Unclassified 2064
57 Ga0068852_100076834 3300005616 Bacteria 2949
58 Ga0068859_100115810 3300005617 Bacteria 2745
59 Ga0068859_100216480 3300005617 Unclassified 2003
60 Ga0068859_100273282 3300005617 Unclassified 1782
61 Ga0068864_100017070 3300005618 Bacteria 6050
62 Ga0068861_100008116 3300005719 Bacteria 7223
63 Ga0068851_10019073 3300005834 Bacteria 3314
64 Ga0068851_10027070 3300005834 Bacteria 2823
65 Ga0068870_10105533 3300005840 Unclassified 1600
66 Ga0068863_100064975 3300005841 Bacteria 3452
67 Ga0068863_100084541 3300005841 Bacteria 3007
68 Ga0068858_100018297 3300005842 Bacteria 6560
69 Ga0068860_100052965 3300005843 Bacteria 3859
70 Ga0068860_100059580 3300005843 Unclassified 3629
71 Ga0068862_100013532 3300005844 Bacteria 6758
72 Ga0068862_100070795 3300005844 Bacteria 3011
73 Ga0075365_10098148 3300006038 Unclassified 2003
74 Ga0075364_10109752 3300006051 Bacteria 1840
75 Ga0070715_10047788 3300006163 Unclassified 1826
76 Ga0070716_100015205 3300006173 Bacteria 3950
77 Ga0070716_100022484 3300006173 Unclassified 3333
78 Ga0097621_100027363 3300006237 Unclassified 4483
79 Ga0097621_100044254 3300006237 Bacteria 3592
80 Ga0097621_100101935 3300006237 Bacteria 2416
81 Ga0097621_100144394 3300006237 Unclassified 2036
82 Ga0097621_100159498 3300006237 Unclassified 1938
83 Ga0068871_100006880 3300006358 Bacteria 8095
84 Ga0075428_100032085 3300006844 Bacteria 5804
85 Ga0075428_100077790 3300006844 Bacteria 3621
86 Ga0075428_100111658 3300006844 Unclassified 2978
87 Ga0075428_100215223 3300006844 Unclassified 2076
88 Ga0075431_100012495 3300006847 Bacteria 8574
89 Ga0075431_100049877 3300006847 Bacteria 4316
90 Ga0075433_10018856 3300006852 Bacteria 5741
91 Ga0075433_10030119 3300006852 Bacteria 4629
92 Ga0075433_10076050 3300006852 Bacteria 2956
93 Ga0075433_10153654 3300006852 Bacteria 2047
94 Ga0075434_100011073 3300006871 Bacteria 8485
95 Ga0075434_100026991 3300006871 Bacteria 5635
96 Ga0075434_100147114 3300006871 Unclassified 2376
97 Ga0075429_100014589 3300006880 Bacteria 6809
98 Ga0068865_100012177 3300006881 Bacteria 5410
99 Ga0075436_100003660 3300006914 Bacteria 10527
100 Ga0097620_100115806 3300006931 Bacteria 2745
101 Ga0097620_100216479 3300006931 Unclassified 2003
102 Ga0097620_100273310 3300006931 Unclassified 1782
103 Ga0075435_100047562 3300007076 Bacteria 3445
104 Ga0111539_10008624 3300009094 Bacteria 12949
105 Ga0111539_10052594 3300009094 Bacteria 4848
106 Ga0111539_10097862 3300009094 Bacteria 3447
107 Ga0111539_10146110 3300009094 Bacteria 2768
108 Ga0105245_10000555 3300009098 Bacteria 33866
109 Ga0114129_10098750 3300009147 Bacteria 4041
110 Ga0114129_10144429 3300009147 Unclassified 3260
111 Ga0114129_10197059 3300009147 Bacteria 2730
112 Ga0105242_10070122 3300009176 Bacteria 2905
113 Ga0105248_10034896 3300009177 Bacteria 5629
114 Ga0105248_10049160 3300009177 Bacteria 4730
115 Ga0105248_10051542 3300009177 Bacteria 4618
116 Ga0105248_10060896 3300009177 Bacteria 4237
117 Ga0105248_10079871 3300009177 Bacteria 3676
118 Ga0105249_10001155 3300009553 Bacteria 23363
119 Ga0105249_10081722 3300009553 Bacteria 3004
120 Ga0105249_10396513 3300009553 Unclassified 1409
121 Ga0105239_10009948 3300010375 Bacteria 10679
122 Ga0105239_10101657 3300010375 Bacteria 3180
123 Ga0157371_10017921 3300013102 Bacteria 5250
124 Ga0157369_10029577 3300013105 Bacteria 6053
125 Ga0157374_10004394 3300013296 Bacteria 11860
126 Ga0157378_10000697 3300013297 Bacteria 31510
127 Ga0157378_10019474 3300013297 Bacteria 5966
128 Ga0157378_10057587 3300013297 Bacteria 3464
129 Ga0157378_10095355 3300013297 Bacteria 2710
130 Ga0157378_10222254 3300013297 Unclassified 1796
131 Ga0163162_10031223 3300013306 Bacteria 5283
132 Ga0163162_10047358 3300013306 Bacteria 4309
133 Ga0157372_10286372 3300013307 Bacteria 1916
134 Ga0157375_10002737 3300013308 Bacteria 15240
135 Ga0157375_10024411 3300013308 Bacteria 5595
136 Ga0157375_10452578 3300013308 Unclassified 1449
137 Ga0163163_10000017 3300014325 Bacteria 208781
138 Ga0157380_10010835 3300014326 Bacteria 6572
139 Ga0157377_10021919 3300014745 Bacteria 3366
140 Ga0157379_10027552 3300014968 Bacteria 5059
141 Ga0163161_10007772 3300017792 Bacteria 7418
142 Ga0207697_10009644 3300025315 Bacteria 4158
143 Ga0207656_10013544 3300025321 Bacteria 3120
144 Ga0207647_10031962 3300025904 Unclassified 3385
145 Ga0207699_10082888 3300025906 Unclassified 1993
146 Ga0207645_10003013 3300025907 Bacteria 13015
147 Ga0207643_10003392 3300025908 Bacteria 8588
148 Ga0207693_10001331 3300025915 Bacteria 21829
149 Ga0207693_10005297 3300025915 Bacteria 10780
150 Ga0207660_10026744 3300025917 Bacteria 3931
151 Ga0207657_10091046 3300025919 Unclassified 2544
152 Ga0207652_10027817 3300025921 Bacteria 4715
153 Ga0207652_10082335 3300025921 Bacteria 2816
154 Ga0207681_10003286 3300025923 Bacteria 10121
155 Ga0207650_10020725 3300025925 Bacteria 4640
156 Ga0207650_10061123 3300025925 Bacteria 2812
157 Ga0207659_10068437 3300025926 Bacteria 2582
158 Ga0207687_10014445 3300025927 Bacteria 5166
159 Ga0207700_10080937 3300025928 Bacteria 2534
160 Ga0207700_10082651 3300025928 Bacteria 2512
161 Ga0207690_10033768 3300025932 Bacteria 3292
162 Ga0207690_10053857 3300025932 Bacteria 2702
163 Ga0207706_10007629 3300025933 Bacteria 9999
164 Ga0207670_10075415 3300025936 Bacteria 2344
165 Ga0207665_10014419 3300025939 Bacteria 5204
166 Ga0207665_10023767 3300025939 Bacteria 4037
167 Ga0207691_10000399 3300025940 Bacteria 43442
168 Ga0207691_10015320 3300025940 Bacteria 7293
169 Ga0207711_10026793 3300025941 Bacteria 4838
170 Ga0207711_10027339 3300025941 Bacteria 4791
171 Ga0207711_10051673 3300025941 Bacteria 3521
172 Ga0207711_10068905 3300025941 Unclassified 3065
173 Ga0207711_10071114 3300025941 Bacteria 3018
174 Ga0207689_10003425 3300025942 Bacteria 14482
175 Ga0207689_10028057 3300025942 Bacteria 4709
176 Ga0207661_10057050 3300025944 Bacteria 3138
177 Ga0207679_10023362 3300025945 Unclassified 4226
178 Ga0207679_10079696 3300025945 Bacteria 2498
179 Ga0207712_10000951 3300025961 Bacteria 20886
180 Ga0207712_10012175 3300025961 Bacteria 5495
181 Ga0207677_10004675 3300026023 Bacteria 7377
182 Ga0207703_10008390 3300026035 Bacteria 8170
183 Ga0207639_10010762 3300026041 Bacteria 6340
184 Ga0207678_10028466 3300026067 Bacteria 4878
185 Ga0207678_10115939 3300026067 Bacteria 2285
186 Ga0207708_10019359 3300026075 Bacteria 5130
187 Ga0207708_10020816 3300026075 Bacteria 4949
188 Ga0207641_10051787 3300026088 Bacteria 3477
189 Ga0207641_10127607 3300026088 Bacteria 2279
190 Ga0207648_10143169 3300026089 Unclassified 2108
191 Ga0207674_10000413 3300026116 Bacteria 55635
192 Ga0207674_10079631 3300026116 Bacteria 3280
193 Ga0207675_100000844 3300026118 Bacteria 30460
194 Ga0207675_100036788 3300026118 Unclassified 4566
195 Ga0207675_100080137 3300026118 Bacteria 3061
196 Ga0268265_10013077 3300028380 Bacteria 5635
197 Ga0268264_10044643 3300028381 Bacteria 3676
198 Ga0268264_10045313 3300028381 Unclassified 3651
199 Ga0268264_10107070 3300028381 Bacteria 2442
200 Ga0307408_100004766 3300031548 Bacteria 9145
201 Ga0307406_10002475 3300031901 Bacteria 10070
202 Ga0307406_10065095 3300031901 Unclassified 2368
203 Ga0307416_100078792 3300032002 Unclassified 2774
204 Ga0307416_100166615 3300032002 Bacteria 2045
205 Ga0307415_100047357 3300032126 Unclassified 2894
206 Ga0373955_0028929 3300035172 Bacteria 2878
207 Ga0373933_0025079 3300035724 Bacteria 3417
208 Ga0373937_0007808 3300036401 Bacteria 9277
209 Ga0451576_0006895 3300045051 Bacteria 13754
210 Ga0451576_0013259 3300045051 Bacteria 9224
211 Ga0451576_0038524 3300045051 Bacteria 5058
212 Ga0495580_0005340 3300046472 Bacteria 10644
213 Ga0495580_0011338 3300046472 Bacteria 6898
214 Ga0495594_0030684 3300046499 Bacteria 2911
215 Ga0495628_0022781 3300046516 Bacteria 5144
216 Ga0495652_0085867 3300046529 Bacteria 2585
217 Ga0495621_0012288 3300046539 Unclassified 2667
218 Ga0495645_0019873 3300046543 Bacteria 4841
219 Ga0495645_0071462 3300046543 Bacteria 2502
220 Ga0495635_0051688 3300046663 Bacteria 2831
221 Ga0495599_0022175 3300046678 Bacteria 3964
222 Ga0495599_0043743 3300046678 Bacteria 2811
223 Ga0495623_0064348 3300046679 Bacteria 2295
224 Ga0495613_0086773 3300046689 Bacteria 2269
225 Ga0495604_0040643 3300047317 Bacteria 3651
226 Ga0495684_0082361 3300047471 Bacteria 2441
227 Ga0496102_0005595 3300048905 Bacteria 10668
228 Ga0496102_0285641 3300048905 Unclassified 1555
229 Ga0496103_0121847 3300048906 Bacteria 1661
230 Ga0496104_0106166 3300048907 Bacteria 2691
231 Ga0496105_0040367 3300048908 Bacteria 3848
232 Ga0496106_0133146 3300048909 Unclassified 1951
233 Ga0496108_0062621 3300048911 Bacteria 3132
234 Ga0496108_0123174 3300048911 Bacteria 2225
235 Ga0496109_0020804 3300048912 Bacteria 5796
236 Ga0496110_0010080 3300048913 Bacteria 7672
237 Ga0496111_0035924 3300048914 Bacteria 3543
238 Ga0496111_0049691 3300048914 Bacteria 3024
239 Ga0496112_0030926 3300048915 Bacteria 5187
240 Ga0496114_0000561 3300048917 Bacteria 27542
241 Ga0501036_0008560 3300049572 Bacteria 8391
242 Ga0501039_0138846 3300049575 Bacteria 1909
243 Ga0501071_0005003 3300049587 Bacteria 8473
244 Ga0501074_0076251 3300049590 Bacteria 2407
245 Ga0501075_0007973 3300049591 Bacteria 7359
246 Ga0501076_0006282 3300049592 Bacteria 8610
247 Ga0501076_0006920 3300049592 Bacteria 8240
248 Ga0501045_0107631 3300049824 Bacteria 2066
249 Ga0501212_003395 3300049851 Unclassified 1996
250 nmdc:mga0yw44_20617_c1 3300050492 Bacteria 3662
251 nmdc:mga05p37_16961_c1 3300050507 Bacteria 8784
252 nmdc:mga09592_73175_c1 3300050508 Unclassified 2911
253 nmdc:mga0qj67_80536_c1 3300050509 Bacteria 2609
254 nmdc:mga08y16_38002_c1 3300050511 Bacteria 5054
255 nmdc:mga08y16_97566_c1 3300050511 Bacteria 3060
256 nmdc:mga0n895_13481_c1 3300050512 Bacteria 7377
257 nmdc:mga0n895_297486_c1 3300050512 Unclassified 1636
258 nmdc:mga0n895_37651_c1 3300050512 Bacteria 4681
259 nmdc:mga0n895_68279_c1 3300050512 Bacteria 3522
260 nmdc:mga0rr50_61314_c1 3300050513 Bacteria 2833
261 nmdc:mga08x19_34905_c1 3300050514 Bacteria 3181
262 nmdc:mga0a205_10116_c1 3300050515 Bacteria 8657
263 nmdc:mga0a205_169811_c1 3300050515 Bacteria 2077
264 Ga0501082_0170898 3300060353 Bacteria 1890
265 2738716857 2738541276 Bacteria 4690596
266 Ga0496112_0012594
267 rootL2_10178189
268 Ga0058861_11995709
269 Ga0058862_12841695
270 Ga0065707_10148504
271 Ga0070676_10025208
272 Ga0070683_100010642
273 Ga0070683_100117212
274 Ga0070690_100100446
275 Ga0070670_100056591
276 Ga0070670_100098468
277 Ga0070670_100129412
278 Ga0068869_100001265
279 Ga0068869_100033282
280 Ga0070680_100021889
281 Ga0068868_100037743
282 Ga0068868_100156935
283 Ga0070660_100057858
284 Ga0070689_100020041
285 Ga0070661_100015437
286 Ga0070692_10024519
287 Ga0070668_100055289
288 Ga0070669_100017627
289 Ga0070675_100065711
290 Ga0070673_100121631
291 Ga0070688_100012715
292 Ga0070659_100145830
293 Ga0070709_10000924
294 Ga0070713_100004813
295 Ga0070713_100014298
296 Ga0070701_10008147
297 Ga0070705_100009502
298 Ga0070694_100015772
299 Ga0070694_100023001
300 Ga0070694_100045281
301 Ga0070694_100062482
302 Ga0070663_100055246
303 Ga0070681_10017958
304 Ga0070681_10022422
305 Ga0068867_100178684
306 Ga0070685_10037738
307 Ga0070679_100015481
308 Ga0070684_100079450
309 Ga0070672_100015522
310 Ga0070686_100043257
311 Ga0070695_100074859
312 Ga0070696_100054804
313 Ga0070693_100035777
314 Ga0070693_100151051
315 Ga0070704_100002346
316 Ga0070704_100090727
317 Ga0068855_100118725
318 Ga0070664_100016367
319 Ga0070664_100105749
320 Ga0068856_100125604
321 Ga0070702_100070473
322 Ga0068852_100076834
323 Ga0068859_100115810
324 Ga0068859_100216480
325 Ga0068859_100273282
326 Ga0068864_100017070
327 Ga0068861_100008116
328 Ga0068851_10019073
329 Ga0068851_10027070
330 Ga0068870_10105533
331 Ga0068863_100064975
332 Ga0068863_100084541
333 Ga0068858_100018297
334 Ga0068860_100052965
335 Ga0068860_100059580
336 Ga0068862_100013532
337 Ga0068862_100070795
338 Ga0075365_10098148
339 Ga0075364_10109752
340 Ga0070715_10047788
341 Ga0070716_100015205
342 Ga0070716_100022484
343 Ga0097621_100027363
344 Ga0097621_100044254
345 Ga0097621_100101935
346 Ga0097621_100144394
347 Ga0097621_100159498
348 Ga0068871_100006880
349 Ga0075428_100032085
350 Ga0075428_100077790
351 Ga0075428_100111658
352 Ga0075428_100215223
353 Ga0075431_100012495
354 Ga0075431_100049877
355 Ga0075433_10018856
356 Ga0075433_10030119
357 Ga0075433_10076050
358 Ga0075433_10153654
359 Ga0075434_100011073
360 Ga0075434_100026991
361 Ga0075434_100147114
362 Ga0075429_100014589
363 Ga0068865_100012177
364 Ga0075436_100003660
365 Ga0097620_100115806
366 Ga0097620_100216479
367 Ga0097620_100273310
368 Ga0075435_100047562
369 Ga0111539_10008624
370 Ga0111539_10052594
371 Ga0111539_10097862
372 Ga0111539_10146110
373 Ga0105245_10000555
374 Ga0114129_10098750
375 Ga0114129_10144429
376 Ga0114129_10197059
377 Ga0105242_10070122
378 Ga0105248_10034896
379 Ga0105248_10049160
380 Ga0105248_10051542
381 Ga0105248_10060896
382 Ga0105248_10079871
383 Ga0105249_10001155
384 Ga0105249_10081722
385 Ga0105249_10396513
386 Ga0105239_10009948
387 Ga0105239_10101657
388 Ga0157371_10017921
389 Ga0157369_10029577
390 Ga0157374_10004394
391 Ga0157378_10000697
392 Ga0157378_10019474
393 Ga0157378_10057587
394 Ga0157378_10095355
395 Ga0157378_10222254
396 Ga0163162_10031223
397 Ga0163162_10047358
398 Ga0157372_10286372
399 Ga0157375_10002737
400 Ga0157375_10024411
401 Ga0157375_10452578
402 Ga0163163_10000017
403 Ga0157380_10010835
404 Ga0157377_10021919
405 Ga0157379_10027552
406 Ga0163161_10007772
407 Ga0207697_10009644
408 Ga0207656_10013544
409 Ga0207647_10031962
410 Ga0207699_10082888
411 Ga0207645_10003013
412 Ga0207643_10003392
413 Ga0207693_10001331
414 Ga0207693_10005297
415 Ga0207660_10026744
416 Ga0207657_10091046
417 Ga0207652_10027817
418 Ga0207652_10082335
419 Ga0207681_10003286
420 Ga0207650_10020725
421 Ga0207650_10061123
422 Ga0207659_10068437
423 Ga0207687_10014445
424 Ga0207700_10080937
425 Ga0207700_10082651
426 Ga0207690_10033768
427 Ga0207690_10053857
428 Ga0207706_10007629
429 Ga0207670_10075415
430 Ga0207665_10014419
431 Ga0207665_10023767
432 Ga0207691_10000399
433 Ga0207691_10015320
434 Ga0207711_10026793
435 Ga0207711_10027339
436 Ga0207711_10051673
437 Ga0207711_10068905
438 Ga0207711_10071114
439 Ga0207689_10003425
440 Ga0207689_10028057
441 Ga0207661_10057050
442 Ga0207679_10023362
443 Ga0207679_10079696
444 Ga0207712_10000951
445 Ga0207712_10012175
446 Ga0207677_10004675
447 Ga0207703_10008390
448 Ga0207639_10010762
449 Ga0207678_10028466
450 Ga0207678_10115939
451 Ga0207708_10019359
452 Ga0207708_10020816
453 Ga0207641_10051787
454 Ga0207641_10127607
455 Ga0207648_10143169
456 Ga0207674_10000413
457 Ga0207674_10079631
458 Ga0207675_100000844
459 Ga0207675_100036788
460 Ga0207675_100080137
461 Ga0268265_10013077
462 Ga0268264_10044643
463 Ga0268264_10045313
464 Ga0268264_10107070
465 Ga0307408_100004766
466 Ga0307406_10002475
467 Ga0307406_10065095
468 Ga0307416_100078792
469 Ga0307416_100166615
470 Ga0307415_100047357
471 Ga0373955_0028929
472 Ga0373933_0025079
473 Ga0373937_0007808
474 Ga0451576_0006895
475 Ga0451576_0013259
476 Ga0451576_0038524
477 Ga0495580_0005340
478 Ga0495580_0011338
479 Ga0495594_0030684
480 Ga0495628_0022781
481 Ga0495652_0085867
482 Ga0495621_0012288
483 Ga0495645_0019873
484 Ga0495645_0071462
485 Ga0495635_0051688
486 Ga0495599_0022175
487 Ga0495599_0043743
488 Ga0495623_0064348
489 Ga0495613_0086773
490 Ga0495604_0040643
491 Ga0495684_0082361
492 Ga0496102_0005595
493 Ga0496102_0285641
494 Ga0496103_0121847
495 Ga0496104_0106166
496 Ga0496105_0040367
497 Ga0496106_0133146
498 Ga0496108_0062621
499 Ga0496108_0123174
500 Ga0496109_0020804
501 Ga0496110_0010080
502 Ga0496111_0035924
503 Ga0496111_0049691
504 Ga0496112_0030926
505 Ga0496114_0000561
506 Ga0501036_0008560
507 Ga0501039_0138846
508 Ga0501071_0005003
509 Ga0501074_0076251
510 Ga0501075_0007973
511 Ga0501076_0006282
512 Ga0501076_0006920
513 Ga0501045_0107631
514 Ga0501212_003395
515 nmdc:mga0yw44_20617_c1
516 nmdc:mga05p37_16961_c1
517 nmdc:mga09592_73175_c1
518 nmdc:mga0qj67_80536_c1
519 nmdc:mga08y16_38002_c1
520 nmdc:mga08y16_97566_c1
521 nmdc:mga0n895_13481_c1
522 nmdc:mga0n895_297486_c1
523 nmdc:mga0n895_37651_c1
524 nmdc:mga0n895_68279_c1
525 nmdc:mga0rr50_61314_c1
526 nmdc:mga08x19_34905_c1
527 nmdc:mga0a205_10116_c1
528 nmdc:mga0a205_169811_c1
529 Ga0501082_0170898
530 2738716857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t20-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa occk5 (opdh) 0.7583 39 441
3t20-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa occk5 (opdh) 0.7375 39 441
8pz4-assembly1.cif.gz_A structure of alginate transporter, alge, solved at wavelength 2.755 a 0.7063 41 442
7acg-assembly1.cif.gz_A in meso structure of the alginate exporter, alge, from pseudomonas aeruginosa in 9.8 monoacylglycerol 0.7054 41 442
3sy9-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa occd2 (opdc) 0.701 39 442
ID Description Score Start End Superfamily
af_Q9M2W6_94_225_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.7217 181 306 2.40.160.10
1nrfA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6969 391 439 3.40.710.10
3rbhB00 Mainly Beta;Beta Barrel;Porin; 0.671 41 442 2.40.160.100
3sybA00 Mainly Beta;Beta Barrel;Porin;Porin 0.6676 39 442 2.40.160.10
3sy9C01 Mainly Beta;Beta Barrel;Porin;Porin 0.6671 40 442 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A0Q6A8Z3-F1-model_v4 Alginate export domain-containing protein 0.9137 34 442
AF-A0A2N5F6X9-F1-model_v4 Alginate export domain-containing protein 0.9036 33 442
AF-A0A5S9P2D5-F1-model_v4 Alginate export domain-containing protein 0.8887 17 442
AF-A0A2S0XER1-F1-model_v4 Alginate export domain-containing protein 0.8871 3 442 GO:0016020
AF-A0A808FSM6-F1-model_v4 deleted 0.8853 37 442

Map