F373552

General Info

Members Datasets Scaffolds Average Seq Length
265 159 265 196

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0244183|Ga0495647_0244183_94_735
Length 213
Sequence VSVSASDARGDRTELGPVSRITEKMPLKKFSDSAIATPANFVTVARLVLAVPTLLLIADRGSTWLTVSLWFVLACTDRIDGWLARRDGATRSGAFLDPLADKFLVIGGFCALGYRGDFSWAAVAIVAAREVGISIYRSFAGRRGISLPALEMGKWKAFFQFLAVGIVLLPPTYEWATVHDIILWIAIALTVVSGLDIVRRGWKQQTQRAADAS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 11.32
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100339760 3300005329 Unclassified 1430
2 Ga0070680_100139409 3300005336 Bacteria 2033
3 Ga0070682_100661704 3300005337 Unclassified 833
4 Ga0070682_100724630 3300005337 Bacteria 800
5 Ga0068868_100297202 3300005338 Bacteria 1371
6 Ga0070687_100123924 3300005343 Unclassified 1482
7 Ga0070703_10209284 3300005406 Archaea 770
8 Ga0070713_100184231 3300005436 Bacteria 1878
9 Ga0070713_100337731 3300005436 Bacteria 1395
10 Ga0070711_100341099 3300005439 Bacteria 1202
11 Ga0070705_100006852 3300005440 Bacteria 5599
12 Ga0070708_100045320 3300005445 Bacteria 3873
13 Ga0070708_100090526 3300005445 Bacteria 2785
14 Ga0070678_100729674 3300005456 Bacteria 895
15 Ga0070678_100909196 3300005456 Bacteria 805
16 Ga0070706_100074084 3300005467 Bacteria 3152
17 Ga0070706_100122315 3300005467 Bacteria 2426
18 Ga0070706_100166230 3300005467 Bacteria 2060
19 Ga0070698_100024584 3300005471 Bacteria 6284
20 Ga0070698_100161893 3300005471 Unclassified 2181
21 Ga0070699_100308630 3300005518 Bacteria 1420
22 Ga0070699_100448898 3300005518 Unclassified 1169
23 Ga0070697_100042500 3300005536 Bacteria 3678
24 Ga0070695_100055426 3300005545 Bacteria 2555
25 Ga0070704_100104139 3300005549 Bacteria 2145
26 Ga0070704_100577183 3300005549 Unclassified 986
27 Ga0068855_100606391 3300005563 Bacteria 1180
28 Ga0068863_101280096 3300005841 Bacteria 740
29 Ga0081455_10126210 3300005937 Bacteria 2008
30 Ga0081455_10243554 3300005937 Bacteria 1320
31 Ga0081539_10051003 3300005985 Bacteria 2336
32 Ga0070717_10084764 3300006028 Bacteria 2666
33 Ga0075363_100014980 3300006048 Bacteria 3801
34 Ga0070716_100256903 3300006173 Bacteria 1193
35 Ga0070712_100181075 3300006175 Bacteria 1642
36 Ga0075428_100523991 3300006844 Unclassified 1268
37 Ga0075430_100070150 3300006846 Bacteria 2939
38 Ga0075430_100379147 3300006846 Bacteria 1167
39 Ga0075430_100461995 3300006846 Unclassified 1048
40 Ga0075430_100522342 3300006846 Bacteria 979
41 Ga0075430_100822364 3300006846 Unclassified 765
42 Ga0075431_100045276 3300006847 Bacteria 4536
43 Ga0075431_100179565 3300006847 Unclassified 2172
44 Ga0075431_100258961 3300006847 Bacteria 1766
45 Ga0075431_100474335 3300006847 Unclassified 1245
46 Ga0075433_10011851 3300006852 Bacteria 7023
47 Ga0075434_100045685 3300006871 Bacteria 4345
48 Ga0075434_100442349 3300006871 Bacteria 1321
49 Ga0075429_100011908 3300006880 Bacteria 7541
50 Ga0075429_100272047 3300006880 Unclassified 1484
51 Ga0075436_100006740 3300006914 Bacteria 7863
52 Ga0075436_100260448 3300006914 Bacteria 1237
53 Ga0075435_100031247 3300007076 Bacteria 4193
54 Ga0075435_100212143 3300007076 Bacteria 1643
55 Ga0105240_10761656 3300009093 Unclassified 1052
56 Ga0111539_10062822 3300009094 Bacteria 4395
57 Ga0111539_10085572 3300009094 Bacteria 3705
58 Ga0105245_10101941 3300009098 Bacteria 2658
59 Ga0114129_10114000 3300009147 Bacteria 3727
60 Ga0114129_10257659 3300009147 Bacteria 2339
61 Ga0114129_10273173 3300009147 Bacteria 2261
62 Ga0114129_10308364 3300009147 Unclassified 2108
63 Ga0105242_10009429 3300009176 Bacteria 7481
64 Ga0105242_10401966 3300009176 Bacteria 1279
65 Ga0105242_10581326 3300009176 Bacteria 1079
66 Ga0105237_10418294 3300009545 Bacteria 1346
67 Ga0105238_11155212 3300009551 Bacteria 798
68 Ga0105246_10216108 3300011119 Unclassified 1500
69 Ga0163162_11673564 3300013306 Bacteria 726
70 Ga0163162_11843655 3300013306 Bacteria 692
71 Ga0163163_10650617 3300014325 Unclassified 1117
72 Ga0163163_10839763 3300014325 Bacteria 982
73 Ga0163163_11462070 3300014325 Unclassified 745
74 Ga0157376_10740127 3300014969 Bacteria 991
75 Ga0163161_10324491 3300017792 Bacteria 1218
76 Ga0213876_10119139 3300021384 Bacteria 1401
77 Ga0207707_10007036 3300025912 Bacteria 9807
78 Ga0207695_11134936 3300025913 Unclassified 662
79 Ga0207671_10566646 3300025914 Bacteria 905
80 Ga0207693_10132303 3300025915 Bacteria 1961
81 Ga0207663_10095891 3300025916 Bacteria 1980
82 Ga0207660_10341380 3300025917 Bacteria 1199
83 Ga0207694_10969417 3300025924 Unclassified 719
84 Ga0207700_10974711 3300025928 Bacteria 759
85 Ga0207686_10893672 3300025934 Bacteria 716
86 Ga0207665_10157525 3300025939 Bacteria 1631
87 Ga0207667_10451606 3300025949 Bacteria 1306
88 Ga0207667_10877607 3300025949 Unclassified 890
89 Ga0207668_10518782 3300025972 Bacteria 1028
90 Ga0207677_10259893 3300026023 Bacteria 1415
91 Ga0207678_10621981 3300026067 Unclassified 947
92 Ga0207683_10482537 3300026121 Bacteria 1144
93 Ga0268266_11164391 3300028379 Bacteria 746
94 Ga0268265_10372548 3300028380 Bacteria 1311
95 Ga0265326_10071688 3300028558 Unclassified 979
96 Ga0265334_10018588 3300028573 Bacteria 2865
97 Ga0265338_10000721 3300028800 Bacteria 56528
98 Ga0265338_10023832 3300028800 Bacteria 6275
99 Ga0265338_10400577 3300028800 Bacteria 978
100 Ga0265325_10003452 3300031241 Bacteria 10313
101 Ga0265339_10002869 3300031249 Bacteria 12203
102 Ga0265339_10096812 3300031249 Bacteria 1540
103 Ga0265327_10008048 3300031251 Bacteria 7951
104 Ga0265327_10013887 3300031251 Bacteria 5314
105 Ga0265327_10047547 3300031251 Bacteria 2262
106 Ga0265327_10105380 3300031251 Unclassified 1355
107 Ga0265316_10149440 3300031344 Bacteria 1751
108 Ga0265313_10074103 3300031595 Bacteria 1561
109 Ga0265313_10182740 3300031595 Bacteria 880
110 Ga0265314_10059151 3300031711 Bacteria 2623
111 Ga0265314_10320201 3300031711 Bacteria 863
112 Ga0373939_0015277 3300035114 Bacteria 2007
113 Ga0373943_0170722 3300035170 Bacteria 1190
114 Ga0373946_0268556 3300035171 Bacteria 836
115 Ga0373924_0161415 3300035410 Bacteria 983
116 Ga0373931_0008215 3300035691 Bacteria 4945
117 Ga0373935_0083210 3300035692 Bacteria 2083
118 Ga0373927_0201505 3300035695 Bacteria 1307
119 Ga0373927_0319650 3300035695 Bacteria 1022
120 Ga0373947_0030043 3300035725 Bacteria 3191
121 Ga0373947_0180817 3300035725 Bacteria 1373
122 Ga0373925_0588268 3300037068 Bacteria 916
123 Ga0395901_0682598 3300038443 Unclassified 1027
124 Ga0436365_0578656 3300039437 Bacteria 1524
125 Ga0436365_1063168 3300039437 Bacteria 1011
126 Ga0439439_0003995 3300041406 Bacteria 3291
127 Ga0439439_0032986 3300041406 Bacteria 1324
128 Ga0439465_0075890 3300041413 Bacteria 1133
129 Ga0439434_0110909 3300042435 Bacteria 889
130 Ga0466968_0179988 3300044735 Archaea 983
131 Ga0466958_0120425 3300045836 Bacteria 1643
132 Ga0495603_0070530 3300046455 Bacteria 2054
133 Ga0495603_0205914 3300046455 Bacteria 1137
134 Ga0495651_0417423 3300046462 Bacteria 873
135 Ga0495653_0030385 3300046463 Bacteria 4304
136 Ga0495653_0039987 3300046463 Bacteria 3669
137 Ga0495653_0093633 3300046463 Bacteria 2191
138 Ga0495584_0119764 3300046491 Bacteria 1333
139 Ga0495608_0096726 3300046511 Bacteria 1907
140 Ga0495618_0011511 3300046514 Bacteria 5366
141 Ga0495628_0077031 3300046516 Bacteria 2594
142 Ga0495628_0223929 3300046516 Bacteria 1412
143 Ga0495628_0330309 3300046516 Bacteria 1124
144 Ga0495630_0016452 3300046517 Bacteria 5406
145 Ga0495630_0039683 3300046517 Bacteria 3519
146 Ga0495630_0051814 3300046517 Bacteria 3072
147 Ga0495630_0066378 3300046517 Bacteria 2712
148 Ga0495630_0077737 3300046517 Bacteria 2502
149 Ga0495630_0293516 3300046517 Bacteria 1242
150 Ga0495666_0107701 3300046526 Bacteria 1310
151 Ga0495665_0110815 3300046531 Bacteria 1440
152 Ga0495665_0136367 3300046531 Bacteria 1284
153 Ga0495640_0028842 3300046533 Bacteria 3991
154 Ga0495640_0215065 3300046533 Bacteria 1214
155 Ga0495640_0438696 3300046533 Bacteria 799
156 Ga0495645_0060561 3300046543 Bacteria 2744
157 Ga0495645_0589459 3300046543 Bacteria 685
158 Ga0495667_0063558 3300046559 Bacteria 2416
159 Ga0495667_0190559 3300046559 Bacteria 1314
160 Ga0495634_0276845 3300046642 Bacteria 1020
161 Ga0495635_0692020 3300046663 Bacteria 661
162 Ga0495657_0100664 3300046675 Bacteria 1842
163 Ga0495657_0117524 3300046675 Bacteria 1678
164 Ga0495657_0126591 3300046675 Bacteria 1604
165 Ga0495657_0185929 3300046675 Bacteria 1272
166 Ga0495657_0249966 3300046675 Bacteria 1068
167 Ga0495623_0436164 3300046679 Bacteria 700
168 Ga0495646_0061229 3300046680 Bacteria 2242
169 Ga0495647_0023324 3300046681 Bacteria 2243
170 Ga0495647_0244183 3300046681 Bacteria 798
171 Ga0495658_0011935 3300046683 Bacteria 4384
172 Ga0495658_0599137 3300046683 Bacteria 706
173 Ga0495624_0217015 3300046690 Bacteria 1160
174 Ga0495604_0334007 3300047317 Bacteria 1010
175 Ga0495604_0628876 3300047317 Bacteria 686
176 Ga0495674_0039812 3300047319 Bacteria 4210
177 Ga0495674_0326878 3300047319 Unclassified 1248
178 Ga0495674_0402976 3300047319 Bacteria 1104
179 Ga0495674_0980643 3300047319 Unclassified 649
180 Ga0495676_0080708 3300047321 Bacteria 2469
181 Ga0495680_0033624 3300047322 Bacteria 4149
182 Ga0495680_0050946 3300047322 Bacteria 3236
183 Ga0495680_0178888 3300047322 Bacteria 1532
184 Ga0495680_0241075 3300047322 Bacteria 1284
185 Ga0495675_0030123 3300047444 Bacteria 3463
186 Ga0495684_0565858 3300047471 Bacteria 772
187 Ga0496100_0003371 3300048903 Bacteria 8321
188 Ga0496101_0009938 3300048904 Bacteria 6270
189 Ga0496102_0047605 3300048905 Bacteria 3898
190 Ga0496102_1141657 3300048905 Unclassified 699
191 Ga0496103_0045155 3300048906 Bacteria 2718
192 Ga0496104_0010012 3300048907 Bacteria 8462
193 Ga0496104_0139549 3300048907 Bacteria 2329
194 Ga0496104_0261859 3300048907 Unclassified 1642
195 Ga0496104_0308856 3300048907 Bacteria 1494
196 Ga0496104_0698931 3300048907 Unclassified 922
197 Ga0496105_0034238 3300048908 Bacteria 4176
198 Ga0496105_0141903 3300048908 Bacteria 1977
199 Ga0496105_0692031 3300048908 Unclassified 783
200 Ga0496106_0027064 3300048909 Bacteria 4270
201 Ga0496108_0034177 3300048911 Bacteria 4223
202 Ga0496109_0005969 3300048912 Bacteria 10227
203 Ga0496109_0264894 3300048912 Bacteria 1619
204 Ga0496110_0020055 3300048913 Bacteria 5638
205 Ga0496110_0047345 3300048913 Bacteria 3765
206 Ga0496111_0140574 3300048914 Unclassified 1789
207 Ga0496111_0240321 3300048914 Bacteria 1345
208 Ga0496112_0000800 3300048915 Bacteria 22208
209 Ga0496112_0004313 3300048915 Bacteria 12020
210 Ga0496112_0523203 3300048915 Bacteria 1121
211 Ga0496112_0696294 3300048915 Bacteria 944
212 Ga0496114_0386210 3300048917 Bacteria 1240
213 Ga0496114_0749175 3300048917 Bacteria 854
214 Ga0496114_0757895 3300048917 Bacteria 848
215 Ga0496115_0000992 3300048918 Bacteria 20551
216 Ga0496115_0073549 3300048918 Bacteria 2774
217 Ga0501034_0195366 3300049571 Bacteria 1983
218 Ga0501036_0082763 3300049572 Bacteria 2713
219 Ga0501037_0222925 3300049573 Bacteria 1326
220 Ga0501039_0220778 3300049575 Bacteria 1490
221 Ga0501043_0035302 3300049579 Bacteria 3933
222 Ga0501046_0193506 3300049580 Bacteria 1516
223 Ga0501047_0253933 3300049581 Bacteria 1606
224 Ga0501048_0134480 3300049582 Bacteria 1747
225 Ga0501070_0012237 3300049586 Bacteria 7240
226 Ga0501071_0453188 3300049587 Bacteria 982
227 Ga0501076_0399627 3300049592 Bacteria 1130
228 Ga0501076_0407640 3300049592 Bacteria 1118
229 Ga0501077_0458605 3300049593 Bacteria 816
230 Ga0501080_0171792 3300049742 Bacteria 1999
231 Ga0501080_0825837 3300049742 Bacteria 812
232 Ga0501081_0320653 3300049743 Bacteria 1139
233 Ga0501083_0324097 3300049744 Bacteria 1002
234 nmdc:mga03n38_69630_c1 3300050490 Bacteria 1625
235 nmdc:mga03n38_94038_c1 3300050490 Bacteria 1433
236 nmdc:mga05p37_210448_c1 3300050507 Unclassified 2351
237 nmdc:mga05p37_398054_c1 3300050507 Unclassified 1609
238 nmdc:mga09592_47275_c1 3300050508 Bacteria 3627
239 nmdc:mga0qj67_359572_c1 3300050509 Bacteria 1176
240 nmdc:mga0qj67_377709_c1 3300050509 Unclassified 1145
241 nmdc:mga06r32_175450_c1 3300050510 Bacteria 2127
242 nmdc:mga06r32_230546_c1 3300050510 Bacteria 1840
243 nmdc:mga06r32_732603_c1 3300050510 Unclassified 953
244 nmdc:mga06r32_92882_c1 3300050510 Bacteria 2951
245 nmdc:mga08y16_247449_c1 3300050511 Bacteria 1842
246 nmdc:mga08y16_85479_c1 3300050511 Bacteria 3287
247 nmdc:mga0n895_396898_c1 3300050512 Bacteria 1395
248 nmdc:mga0n895_517110_c1 3300050512 Unclassified 1201
249 nmdc:mga0rr50_32284_c1 3300050513 Bacteria 3730
250 nmdc:mga08x19_173248_c1 3300050514 Bacteria 1470
251 nmdc:mga0a205_23346_c2 3300050515 Bacteria 3878
252 Ga0495601_0110438 3300053077 Bacteria 1781
253 Ga0495601_0228593 3300053077 Bacteria 1215
254 Ga0495595_0027096 3300053084 Bacteria 2551
255 Ga0495595_0155630 3300053084 Unclassified 1126
256 Ga0495595_0279598 3300053084 Bacteria 838
257 Ga0495619_0011190 3300053085 Bacteria 5643
258 Ga0495619_0153416 3300053085 Bacteria 1589
259 Ga0495619_0154544 3300053085 Bacteria 1583
260 Ga0495619_0306450 3300053085 Bacteria 1100
261 Ga0495619_0322653 3300053085 Bacteria 1069
262 Ga0501084_0214530 3300054114 Bacteria 1624
263 Ga0501084_0240919 3300054114 Bacteria 1527
264 Ga0501084_0762195 3300054114 Bacteria 815
265 Ga0530510_0031247 3300061734 Bacteria 3828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046679 Ga0495623_0436164 Ga0495623_0436164_43_585 178
2 3300048917 Ga0496114_0749175 Ga0496114_0749175_202_777 182
3 3300009147 Ga0114129_10273173 Ga0114129_102731732 183
4 3300005563 Ga0068855_100606391 Ga0068855_1006063912 184
5 3300009093 Ga0105240_10761656 Ga0105240_107616561 184
6 3300013306 Ga0163162_11673564 Ga0163162_116735642 184
7 3300014325 Ga0163163_10839763 Ga0163163_108397632 184
8 3300014325 Ga0163163_11462070 Ga0163163_114620702 184
9 3300025913 Ga0207695_11134936 Ga0207695_111349361 184
10 3300025949 Ga0207667_10877607 Ga0207667_108776071 184
11 3300026067 Ga0207678_10621981 Ga0207678_106219811 184
12 3300028800 Ga0265338_10023832 Ga0265338_100238324 184
13 3300046463 Ga0495653_0030385 Ga0495653_0030385_3128_3775 184
14 3300046516 Ga0495628_0077031 Ga0495628_0077031_1514_2161 184
15 3300046517 Ga0495630_0039683 Ga0495630_0039683_1745_2392 184
16 3300046526 Ga0495666_0107701 Ga0495666_0107701_197_844 184
17 3300046663 Ga0495635_0692020 Ga0495635_0692020_33_593 184
18 3300046675 Ga0495657_0126591 Ga0495657_0126591_340_987 184
19 3300046683 Ga0495658_0599137 Ga0495658_0599137_124_684 184
20 3300047319 Ga0495674_0039812 Ga0495674_0039812_1581_2228 184
21 3300048905 Ga0496102_1141657 Ga0496102_1141657_96_653 184
22 3300048907 Ga0496104_0139549 Ga0496104_0139549_1707_2264 184
23 3300048911 Ga0496108_0034177 Ga0496108_0034177_3061_3618 184
24 3300048912 Ga0496109_0264894 Ga0496109_0264894_743_1303 184
25 3300048917 Ga0496114_0386210 Ga0496114_0386210_97_657 184
26 3300053084 Ga0495595_0279598 Ga0495595_0279598_130_777 184
27 3300005337 Ga0070682_100724630 Ga0070682_1007246301 185
28 3300005343 Ga0070687_100123924 Ga0070687_1001239242 185
29 3300005406 Ga0070703_10209284 Ga0070703_102092841 185
30 3300005436 Ga0070713_100184231 Ga0070713_1001842312 185
31 3300005445 Ga0070708_100045320 Ga0070708_1000453202 185
32 3300005456 Ga0070678_100729674 Ga0070678_1007296741 185
33 3300005456 Ga0070678_100909196 Ga0070678_1009091961 185
34 3300005467 Ga0070706_100074084 Ga0070706_1000740842 185
35 3300005467 Ga0070706_100122315 Ga0070706_1001223152 185
36 3300005471 Ga0070698_100024584 Ga0070698_1000245844 185
37 3300005471 Ga0070698_100161893 Ga0070698_1001618931 185
38 3300005518 Ga0070699_100448898 Ga0070699_1004488982 185
39 3300005536 Ga0070697_100042500 Ga0070697_1000425002 185
40 3300005549 Ga0070704_100577183 Ga0070704_1005771832 185
41 3300005841 Ga0068863_101280096 Ga0068863_1012800962 185
42 3300005937 Ga0081455_10126210 Ga0081455_101262102 185
43 3300005937 Ga0081455_10243554 Ga0081455_102435542 185
44 3300006048 Ga0075363_100014980 Ga0075363_1000149804 185
45 3300006844 Ga0075428_100523991 Ga0075428_1005239911 185
46 3300006846 Ga0075430_100070150 Ga0075430_1000701502 185
47 3300006846 Ga0075430_100461995 Ga0075430_1004619951 185
48 3300006846 Ga0075430_100522342 Ga0075430_1005223421 185
49 3300006847 Ga0075431_100045276 Ga0075431_1000452765 185
50 3300006847 Ga0075431_100179565 Ga0075431_1001795652 185
51 3300006847 Ga0075431_100258961 Ga0075431_1002589612 185
52 3300006847 Ga0075431_100474335 Ga0075431_1004743352 185
53 3300006852 Ga0075433_10011851 Ga0075433_100118513 185
54 3300006871 Ga0075434_100045685 Ga0075434_1000456853 185
55 3300006880 Ga0075429_100011908 Ga0075429_1000119085 185
56 3300006880 Ga0075429_100272047 Ga0075429_1002720472 185
57 3300006914 Ga0075436_100006740 Ga0075436_1000067405 185
58 3300007076 Ga0075435_100031247 Ga0075435_1000312473 185
59 3300007076 Ga0075435_100212143 Ga0075435_1002121432 185
60 3300009094 Ga0111539_10062822 Ga0111539_100628224 185
61 3300009094 Ga0111539_10085572 Ga0111539_100855721 185
62 3300009098 Ga0105245_10101941 Ga0105245_101019412 185
63 3300009147 Ga0114129_10114000 Ga0114129_101140004 185
64 3300009147 Ga0114129_10257659 Ga0114129_102576592 185
65 3300009147 Ga0114129_10308364 Ga0114129_103083642 185
66 3300009176 Ga0105242_10009429 Ga0105242_1000942910 185
67 3300009176 Ga0105242_10401966 Ga0105242_104019662 185
68 3300009176 Ga0105242_10581326 Ga0105242_105813262 185
69 3300011119 Ga0105246_10216108 Ga0105246_102161082 185
70 3300013306 Ga0163162_11843655 Ga0163162_118436552 185
71 3300017792 Ga0163161_10324491 Ga0163161_103244912 185
72 3300025934 Ga0207686_10893672 Ga0207686_108936721 185
73 3300025972 Ga0207668_10518782 Ga0207668_105187822 185
74 3300026121 Ga0207683_10482537 Ga0207683_104825372 185
75 3300028573 Ga0265334_10018588 Ga0265334_100185884 185
76 3300028800 Ga0265338_10000721 Ga0265338_1000072121 185
77 3300031241 Ga0265325_10003452 Ga0265325_1000345210 185
78 3300031249 Ga0265339_10002869 Ga0265339_100028695 185
79 3300031595 Ga0265313_10074103 Ga0265313_100741032 185
80 3300031595 Ga0265313_10182740 Ga0265313_101827402 185
81 3300031711 Ga0265314_10059151 Ga0265314_100591512 185
82 3300031711 Ga0265314_10320201 Ga0265314_103202011 185
83 3300035170 Ga0373943_0170722 Ga0373943_0170722_566_1165 185
84 3300035171 Ga0373946_0268556 Ga0373946_0268556_220_819 185
85 3300035410 Ga0373924_0161415 Ga0373924_0161415_55_639 185
86 3300035692 Ga0373935_0083210 Ga0373935_0083210_548_1132 185
87 3300035695 Ga0373927_0201505 Ga0373927_0201505_531_1130 185
88 3300035695 Ga0373927_0319650 Ga0373927_0319650_398_982 185
89 3300035725 Ga0373947_0030043 Ga0373947_0030043_1382_1981 185
90 3300035725 Ga0373947_0180817 Ga0373947_0180817_690_1274 185
91 3300037068 Ga0373925_0588268 Ga0373925_0588268_117_701 185
92 3300038443 Ga0395901_0682598 Ga0395901_0682598_35_631 185
93 3300046455 Ga0495603_0070530 Ga0495603_0070530_305_904 185
94 3300046462 Ga0495651_0417423 Ga0495651_0417423_107_691 185
95 3300046463 Ga0495653_0039987 Ga0495653_0039987_1453_2037 185
96 3300046514 Ga0495618_0011511 Ga0495618_0011511_3138_3722 185
97 3300046516 Ga0495628_0330309 Ga0495628_0330309_115_699 185
98 3300046517 Ga0495630_0016452 Ga0495630_0016452_3374_3958 185
99 3300046517 Ga0495630_0077737 Ga0495630_0077737_352_951 185
100 3300046517 Ga0495630_0293516 Ga0495630_0293516_431_1015 185
101 3300046531 Ga0495665_0110815 Ga0495665_0110815_361_960 185
102 3300046531 Ga0495665_0136367 Ga0495665_0136367_649_1233 185
103 3300046533 Ga0495640_0028842 Ga0495640_0028842_1611_2195 185
104 3300046543 Ga0495645_0060561 Ga0495645_0060561_629_1213 185
105 3300046559 Ga0495667_0190559 Ga0495667_0190559_169_753 185
106 3300046642 Ga0495634_0276845 Ga0495634_0276845_381_1010 185
107 3300046675 Ga0495657_0185929 Ga0495657_0185929_348_932 185
108 3300046675 Ga0495657_0249966 Ga0495657_0249966_341_925 185
109 3300046680 Ga0495646_0061229 Ga0495646_0061229_751_1335 185
110 3300046681 Ga0495647_0023324 Ga0495647_0023324_520_1119 185
111 3300046690 Ga0495624_0217015 Ga0495624_0217015_464_1048 185
112 3300047317 Ga0495604_0334007 Ga0495604_0334007_220_804 185
113 3300047317 Ga0495604_0628876 Ga0495604_0628876_60_644 185
114 3300047321 Ga0495676_0080708 Ga0495676_0080708_934_1518 185
115 3300047444 Ga0495675_0030123 Ga0495675_0030123_2482_3066 185
116 3300047471 Ga0495684_0565858 Ga0495684_0565858_14_598 185
117 3300048913 Ga0496110_0047345 Ga0496110_0047345_2057_2641 185
118 3300049592 Ga0501076_0399627 Ga0501076_0399627_191_760 185
119 3300049593 Ga0501077_0458605 Ga0501077_0458605_180_752 185
120 3300050490 nmdc:mga03n38_69630_c1 nmdc:mga03n38_69630_c1_931_1521 185
121 3300050490 nmdc:mga03n38_94038_c1 nmdc:mga03n38_94038_c1_767_1351 185
122 3300050507 nmdc:mga05p37_210448_c1 nmdc:mga05p37_210448_c1_199_798 185
123 3300050507 nmdc:mga05p37_398054_c1 nmdc:mga05p37_398054_c1_941_1540 185
124 3300050508 nmdc:mga09592_47275_c1 nmdc:mga09592_47275_c1_2107_2706 185
125 3300050510 nmdc:mga06r32_175450_c1 nmdc:mga06r32_175450_c1_158_760 185
126 3300050510 nmdc:mga06r32_230546_c1 nmdc:mga06r32_230546_c1_1211_1810 185
127 3300050510 nmdc:mga06r32_732603_c1 nmdc:mga06r32_732603_c1_38_634 185
128 3300050510 nmdc:mga06r32_92882_c1 nmdc:mga06r32_92882_c1_827_1426 185
129 3300050511 nmdc:mga08y16_247449_c1 nmdc:mga08y16_247449_c1_1197_1781 185
130 3300050511 nmdc:mga08y16_85479_c1 nmdc:mga08y16_85479_c1_354_953 185
131 3300050512 nmdc:mga0n895_517110_c1 nmdc:mga0n895_517110_c1_226_801 185
132 3300050513 nmdc:mga0rr50_32284_c1 nmdc:mga0rr50_32284_c1_1254_1853 185
133 3300050515 nmdc:mga0a205_23346_c2 nmdc:mga0a205_23346_c2_1159_1758 185
134 3300053084 Ga0495595_0027096 Ga0495595_0027096_56_640 185
135 3300053085 Ga0495619_0011190 Ga0495619_0011190_2939_3523 185
136 3300053085 Ga0495619_0154544 Ga0495619_0154544_863_1447 185
137 3300053085 Ga0495619_0306450 Ga0495619_0306450_156_740 185
138 3300028558 Ga0265326_10071688 Ga0265326_100716881 186
139 3300035114 Ga0373939_0015277 Ga0373939_0015277_116_733 186
140 3300046463 Ga0495653_0093633 Ga0495653_0093633_964_1566 186
141 3300046559 Ga0495667_0063558 Ga0495667_0063558_1333_1935 186
142 3300046675 Ga0495657_0117524 Ga0495657_0117524_996_1598 186
143 3300047319 Ga0495674_0326878 Ga0495674_0326878_574_1176 186
144 3300047322 Ga0495680_0033624 Ga0495680_0033624_2520_3122 186
145 3300048915 Ga0496112_0696294 Ga0496112_0696294_86_682 186
146 3300048917 Ga0496114_0757895 Ga0496114_0757895_58_639 186
147 3300049587 Ga0501071_0453188 Ga0501071_0453188_72_680 186
148 3300053077 Ga0495601_0228593 Ga0495601_0228593_464_1066 186
149 3300053084 Ga0495595_0155630 Ga0495595_0155630_58_660 186
150 3300053085 Ga0495619_0153416 Ga0495619_0153416_69_671 186
151 3300009545 Ga0105237_10418294 Ga0105237_104182942 187
152 3300009551 Ga0105238_11155212 Ga0105238_111552121 187
153 3300014325 Ga0163163_10650617 Ga0163163_106506172 187
154 3300021384 Ga0213876_10119139 Ga0213876_101191392 187
155 3300025914 Ga0207671_10566646 Ga0207671_105666462 187
156 3300025924 Ga0207694_10969417 Ga0207694_109694171 187
157 3300028379 Ga0268266_11164391 Ga0268266_111643912 187
158 3300028800 Ga0265338_10400577 Ga0265338_104005772 187
159 3300031249 Ga0265339_10096812 Ga0265339_100968122 187
160 3300031251 Ga0265327_10013887 Ga0265327_100138875 187
161 3300031344 Ga0265316_10149440 Ga0265316_101494402 187
162 3300039437 Ga0436365_0578656 Ga0436365_0578656_107_691 187
163 3300041406 Ga0439439_0003995 Ga0439439_0003995_925_1497 187
164 3300044735 Ga0466968_0179988 Ga0466968_0179988_123_698 187
165 3300047319 Ga0495674_0980643 Ga0495674_0980643_23_610 187
166 3300048905 Ga0496102_0047605 Ga0496102_0047605_2035_2607 187
167 3300048907 Ga0496104_0261859 Ga0496104_0261859_250_837 187
168 3300048907 Ga0496104_0698931 Ga0496104_0698931_131_718 187
169 3300048908 Ga0496105_0692031 Ga0496105_0692031_186_773 187
170 3300048912 Ga0496109_0005969 Ga0496109_0005969_1045_1632 187
171 3300048913 Ga0496110_0020055 Ga0496110_0020055_391_978 187
172 3300048914 Ga0496111_0140574 Ga0496111_0140574_248_835 187
173 3300048915 Ga0496112_0000800 Ga0496112_0000800_5738_6325 187
174 3300048915 Ga0496112_0004313 Ga0496112_0004313_3066_3653 187
175 3300048915 Ga0496112_0523203 Ga0496112_0523203_49_636 187
176 3300048918 Ga0496115_0073549 Ga0496115_0073549_299_871 187
177 3300054114 Ga0501084_0240919 Ga0501084_0240919_858_1448 187
178 3300006846 Ga0075430_100379147 Ga0075430_1003791472 188
179 3300006914 Ga0075436_100260448 Ga0075436_1002604482 188
180 3300025912 Ga0207707_10007036 Ga0207707_100070368 188
181 3300025949 Ga0207667_10451606 Ga0207667_104516062 188
182 3300045836 Ga0466958_0120425 Ga0466958_0120425_147_740 188
183 3300046511 Ga0495608_0096726 Ga0495608_0096726_364_999 188
184 3300046683 Ga0495658_0011935 Ga0495658_0011935_467_1102 188
185 3300047322 Ga0495680_0178888 Ga0495680_0178888_849_1484 188
186 3300050509 nmdc:mga0qj67_359572_c1 nmdc:mga0qj67_359572_c1_258_863 188
187 3300050514 nmdc:mga08x19_173248_c1 nmdc:mga08x19_173248_c1_842_1435 188
188 3300005445 Ga0070708_100090526 Ga0070708_1000905262 190
189 3300005467 Ga0070706_100166230 Ga0070706_1001662301 190
190 3300047322 Ga0495680_0241075 Ga0495680_0241075_415_1014 190
191 3300006846 Ga0075430_100822364 Ga0075430_1008223642 191
192 3300031251 Ga0265327_10008048 Ga0265327_100080488 191
193 3300046516 Ga0495628_0223929 Ga0495628_0223929_484_1065 191
194 3300046543 Ga0495645_0589459 Ga0495645_0589459_84_665 191
195 3300050509 nmdc:mga0qj67_377709_c1 nmdc:mga0qj67_377709_c1_224_841 191
196 3300053077 Ga0495601_0110438 Ga0495601_0110438_718_1299 191
197 3300005336 Ga0070680_100139409 Ga0070680_1001394092 192
198 3300005440 Ga0070705_100006852 Ga0070705_1000068522 192
199 3300005518 Ga0070699_100308630 Ga0070699_1003086302 192
200 3300005545 Ga0070695_100055426 Ga0070695_1000554263 192
201 3300005549 Ga0070704_100104139 Ga0070704_1001041392 192
202 3300025917 Ga0207660_10341380 Ga0207660_103413802 192
203 3300041406 Ga0439439_0032986 Ga0439439_0032986_649_1239 192
204 3300041413 Ga0439465_0075890 Ga0439465_0075890_182_772 192
205 3300042435 Ga0439434_0110909 Ga0439434_0110909_22_612 192
206 3300046491 Ga0495584_0119764 Ga0495584_0119764_600_1190 192
207 3300046681 Ga0495647_0244183 Ga0495647_0244183_94_735 192
208 3300049575 Ga0501039_0220778 Ga0501039_0220778_184_786 192
209 3300049592 Ga0501076_0407640 Ga0501076_0407640_279_881 192
210 3300049742 Ga0501080_0825837 Ga0501080_0825837_67_669 192
211 3300049743 Ga0501081_0320653 Ga0501081_0320653_122_724 192
212 3300054114 Ga0501084_0214530 Ga0501084_0214530_629_1231 192
213 3300054114 Ga0501084_0762195 Ga0501084_0762195_162_803 192
214 3300061734 Ga0530510_0031247 Ga0530510_0031247_1381_1983 192
215 3300039437 Ga0436365_1063168 Ga0436365_1063168_94_732 193
216 3300046533 Ga0495640_0438696 Ga0495640_0438696_13_636 193
217 3300005329 Ga0070683_100339760 Ga0070683_1003397602 194
218 3300005337 Ga0070682_100661704 Ga0070682_1006617042 194
219 3300005338 Ga0068868_100297202 Ga0068868_1002972022 194
220 3300005436 Ga0070713_100337731 Ga0070713_1003377312 194
221 3300005439 Ga0070711_100341099 Ga0070711_1003410991 194
222 3300005985 Ga0081539_10051003 Ga0081539_100510032 194
223 3300006028 Ga0070717_10084764 Ga0070717_100847642 194
224 3300006173 Ga0070716_100256903 Ga0070716_1002569031 194
225 3300006175 Ga0070712_100181075 Ga0070712_1001810752 194
226 3300006871 Ga0075434_100442349 Ga0075434_1004423491 194
227 3300014969 Ga0157376_10740127 Ga0157376_107401272 194
228 3300025915 Ga0207693_10132303 Ga0207693_101323032 194
229 3300025916 Ga0207663_10095891 Ga0207663_100958912 194
230 3300025928 Ga0207700_10974711 Ga0207700_109747112 194
231 3300025939 Ga0207665_10157525 Ga0207665_101575251 194
232 3300026023 Ga0207677_10259893 Ga0207677_102598932 194
233 3300028380 Ga0268265_10372548 Ga0268265_103725482 194
234 3300031251 Ga0265327_10047547 Ga0265327_100475472 194
235 3300031251 Ga0265327_10105380 Ga0265327_101053802 194
236 3300035691 Ga0373931_0008215 Ga0373931_0008215_3282_3872 194
237 3300046455 Ga0495603_0205914 Ga0495603_0205914_186_776 194
238 3300046517 Ga0495630_0051814 Ga0495630_0051814_1137_1763 194
239 3300046517 Ga0495630_0066378 Ga0495630_0066378_1238_1837 194
240 3300046533 Ga0495640_0215065 Ga0495640_0215065_16_609 194
241 3300046675 Ga0495657_0100664 Ga0495657_0100664_1036_1626 194
242 3300047319 Ga0495674_0402976 Ga0495674_0402976_131_742 194
243 3300047322 Ga0495680_0050946 Ga0495680_0050946_1153_1743 194
244 3300048903 Ga0496100_0003371 Ga0496100_0003371_2567_3157 194
245 3300048904 Ga0496101_0009938 Ga0496101_0009938_946_1536 194
246 3300048906 Ga0496103_0045155 Ga0496103_0045155_1670_2260 194
247 3300048907 Ga0496104_0010012 Ga0496104_0010012_1501_2091 194
248 3300048907 Ga0496104_0308856 Ga0496104_0308856_206_826 194
249 3300048908 Ga0496105_0034238 Ga0496105_0034238_192_782 194
250 3300048908 Ga0496105_0141903 Ga0496105_0141903_1127_1747 194
251 3300048909 Ga0496106_0027064 Ga0496106_0027064_875_1465 194
252 3300048914 Ga0496111_0240321 Ga0496111_0240321_580_1185 194
253 3300048918 Ga0496115_0000992 Ga0496115_0000992_14926_15516 194
254 3300049571 Ga0501034_0195366 Ga0501034_0195366_527_1177 194
255 3300049572 Ga0501036_0082763 Ga0501036_0082763_437_1087 194
256 3300049573 Ga0501037_0222925 Ga0501037_0222925_521_1171 194
257 3300049579 Ga0501043_0035302 Ga0501043_0035302_3089_3739 194
258 3300049580 Ga0501046_0193506 Ga0501046_0193506_139_789 194
259 3300049581 Ga0501047_0253933 Ga0501047_0253933_522_1172 194
260 3300049582 Ga0501048_0134480 Ga0501048_0134480_544_1194 194
261 3300049586 Ga0501070_0012237 Ga0501070_0012237_4655_5305 194
262 3300049742 Ga0501080_0171792 Ga0501080_0171792_360_1010 194
263 3300049744 Ga0501083_0324097 Ga0501083_0324097_74_724 194
264 3300050512 nmdc:mga0n895_396898_c1 nmdc:mga0n895_396898_c1_689_1279 194
265 3300053085 Ga0495619_0322653 Ga0495619_0322653_370_981 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

36

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.8633 18 181
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7686 18 181
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7585 16 190
6h59-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound 0.7297 17 183
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7066 16 194
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8593 20 185 1.20.120.1760
af_Q8MZC4_124_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8564 16 181 1.20.120.1760
af_Q2FZ11_2_191_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.854 18 187 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8531 18 186 1.20.120.1760
af_Q80ZM8_99_300_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8396 6 185 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A6J6KRV3-F1-model_v4 Unannotated protein 0.9814 79 189 GO:0008654
GO:0016020
GO:0016780
AF-A0A2E9LCK8-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9657 18 191 GO:0005886
GO:0008444
GO:0046474
AF-A0A1Z9FAX1-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9648 18 194 GO:0005886
GO:0008444
GO:0046474
AF-A0A382ASV2-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9481 18 190 GO:0005886
GO:0008444
GO:0046474
AF-A0A6L7JKQ3-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.948 5 188 GO:0005886
GO:0008444
GO:0046474

Feature Viewer

pLDDT pTM Quality
86.03 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map